current user: public

If you have questions about the server, please let us know.

Query: [S] KOG3455 Predicted membrane protein, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLSSVIRCLCAIDIHNKTLYHITLWTFLLALGHFLSELFVYGTAAPTIGVLAPLMVASFSILGMLVGLRYLEVEPVSRQKKRNLast
1 -99.200[S] KOG3455 Predicted membrane protein  ali  100  1MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLSSVIRCLCAIDIHNKTLYHITLWTFLLALGHFLSELFVYGTAAPTIGVLAPLMVASFSILGMLVGLRYLEVEPVSRQKKRN 140
2 -9.200[I] KOG3845 MLN, STAR and related lipid-binding proteins  ali follow..  15  22........KRFIVITFFDTSITILLWLLCTVTRDDDWDKVFFNEINIFNPKFIRI-IVLLAVLRLGVVYGICLVKQWYTVAFTTLASSAYILMKVLFYFNHSSSAVPPLLLIITSFTLCWSEFYLMPFQILPRERRYARR 159
3 -7.570[C] COG0356 F0F1-type ATP synthase, subunit a  ali follow..  10  191..............................................SLAFRLFG--NMYAGELIFILIAVMYMANNFALNSMGIFMHLAWAIFHILV--------ITLQAFIFMMLTVVYL................... 255
4 -7.230[S] COG4331 Predicted membrane protein  ali follow..  44...........TYFVTPQFLLNTLHRITSRGDIIANYLLHAAQHLSISSLHFAASYLFIHGAIKLWIIIGLKKLGYYPVAVAVFSLFIVYQLYRYTFTHSLLL-------ILITILDVFVIALTLLEYRRLRHGEKTCSE 173
5 -7.010[U] KOG2887 Membrane protein involved in ER to Golgi transport  ali follow..  10  130...........CFTLGCGFIIGSFFALRGPQNQLAHMSSAERLPLTLGF--------IATMVGTIYVSMVLHSYILSVIFSALQVIALAYYCISYFPGGSSGMK.................................... 214
6 -7.000[O] COG5264 Vacuolar transporter chaperone  ali follow..  16  125...............................................ANERTFLKW-LHVVVLLGSLALALYNGQAFGVVYTLLAIFIGFYAWKLHAKRSQMIKSDYWGPLIVGTALAISLIVNMSFALKDAVYQNLIEP 229
7 -6.900[U] COG5102 Membrane protein involved in ER to Golgi transport  ali follow..  12  102...........LWTMGSLLAVLGFAIVQGFVAHFRQLTTMERLPITLSY--------FVTLLATIIATIKIKSTILSIVFGVLHILSFVAYLIAFFPFGTRTVS.................................... 186
8 -6.410[S] KOG4556 Predicted membrane protein  ali follow..  11  4........RWLLSLLLATWTLLSIA---------RLVFDLIGNLWVVVVFDFV---QIVLLISGLFGATQKRRPLLYTLLSSNALSVTINVLIFLWYIGVFGEISRPYLSAGLPYSSSFFL................... 104
9 -6.370[H] KOG3810 Micronutrient transporters (folate transporter family)  ali follow..  12  27.......RECWFLPTALLCAYGFFASLRPSEPFLTPYLLGPDKNLTEVFNEIYPVWTLVLLFPVFLATDYLRYKPVVLLQGLSLIVTMLLYAQGLLAIQFLEFFYGIATATEIAYYSYIYSVVDLGMYQK.......... 156
10 -6.230[R] KOG2489 Transmembrane protein  ali follow..  21  539........RGWYSWV-LNMLYGYLLMFGFITMTPQLFINYKLKSVAHLPWRML-TYKFINTFIDDLFAFVIKMPLLYRIGCFRDDIIFLIYLYQRWIYRV........................................ 628

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35