current user: public

If you have questions about the server, please let us know.

Query: [C] KOG3469 Cytochrome c oxidase, subunit VIa/COX13, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MSAILNHAIRRQFGASAARNMSGTAAVAGEHSGGYKVWKRLSFFVAVPAVGLCMLNAYLKHQEEHDKPRQEFVKYDYLRRREKRFPWGEGQKSLFHNPHVNALPDGYEHLast
1 -88.500[C] KOG3469 Cytochrome c oxidase, subunit VIa/COX13  ali  100  1MSAILNHAIRRQFGASAARNMSGTAAVAGEHSGGYKVWKRLSFFVAVPAVGLCMLNAYLKHQEEHDKPRQEFVKYDYLRRREKRFPWGEGQKSLFHNPHVNALPDGYEH 109
2 -6.940[T] KOG3776 Plasma membrane glycoprotein CD36 and related membrane receptors  ali follow..  11  12......................HKEMALAPDTRVYENWKSPPIDLSLDIYLYNWTNPEDFGNLSTKPILEQVGPYRFIERPDKDIHWHPENASVTYRRRSLF....... 92
3 -6.690[W] KOG3848 Extracellular protein TEM7, contains PSI domain (tumor endothelial marker in humans)  ali follow..  10  421.LPTEDDTKIALHLKDNGASTDDSAAEKKGGTLHAGLIVGILILVLIVATAIL------------------VTVYMYHHIERRPSRWGSGHPA-----YAEVEPVGEKE 521
4 -6.190[D] COG2917 Intracellular septation protein A  ali follow..  142.................................PQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS...................................... 179
5 -6.040[C] COG3658 Cytochrome b  ali follow..  18  2...............................KNKTKVWDRLFHWLLAASLPFMWYSAKTGGDMLQWHTRVGLFILFLLVFR---LCWGGSDTARFSR............ 69
6 -6.040[P] KOG0252 Inorganic phosphate transporter  ali follow..  17  178AGGIVSLIVSSTFDHAFKAPTYEVDPVGSTVPQADYVWRIVLMFGAIPALLTYYWRMKM----------PETARYTALVARNTK......................... 251
7 -6.030[S] COG5528 Predicted integral membrane protein  ali follow..  102........MQMEMRRLAETASKAGEPLPKRYHQLFRLWFAFGFPAFGAVLAIFWLMITRPALE.............................................. 156
8 -5.950[O] COG3555 Aspartyl/asparaginyl beta-hydroxylase and related dioxygenases  ali follow..  12  72..QAIRSEALHLHDAGNIKRSEQYDDIGFNSFFKSG-WKRFALLRQIPSVKAAMFAELPPGSKLVRHRDPPNDPACFIEVDGERYHWRDGEAVVFDETFIHYAENATEH 210
9 -5.730[C] COG3125 Heme/copper-type cytochrome/quinol oxidase, subunit 4  ali follow..  55........................................AIVIMAFAVVQIVVHMVFFLHMKTASEGGWSMLALIFVVIVLTGSLW------VMYHLNANMMP..... 116
10 -5.700[S] KOG2998 Uncharacterized conserved protein  ali follow..  15  112.....................SATYPDEKLQDLISDQWKNMGWQGKDPSAGFISLENLLFFAKTFSTSFQRLLNKQGGKRAAWEYPFAVAGVNI............... 189

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.