current user: public

If you have questions about the server, please let us know.

Query: [RT] KOG4070 Putative signal transduction protein p25, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFQGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKKLast
1 -92.000[RT] KOG4070 Putative signal transduction protein p25  ali  100  1MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFQGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK 176
2 -8.640[Z] KOG0031 Myosin regulatory light chain, EF-Hand protein superfamily  ali follow..  92LKGADPEDVITGAFKVLDPEGKG-----TIKKKFLEELLTTQ----CDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKD.......................................................................................... 168
3 -8.440[Z] KOG0030 Myosin essential light chain, EF-Hand protein superfamily  ali follow..  22  9TADLIPSTEFKEAFQLFDRTGDGK-----ILYSQCGDVMRAL----GQNPTNAEVLKVLGNPKEMNVKVLDFEHFLPMLQTVAKNKDQGTYED................................................................................... 94
4 -8.020[S] KOG0043 Uncharacterized conserved protein, contains DM10 domain  ali follow..  10  596....NARDDLMEHFHHI------PTNQPFLPEVKVRSALRGCRL----PFSLELIDNILSILNRNECDDIEVCDLMNFID................................................................................................ 662
5 -8.010[T] KOG0027 Calmodulin and related proteins (EF-Hand superfamily)  ali follow..  13  46..TRKELKEYRQLFNMFDTDGSG-----AIGNEELKQAMISI----GLHANKAEIDNVIKEVDADGNGEIDFEEFCACMKKSQNIVKSTNEEL................................................................................... 127
6 -7.640[P] KOG2643 Ca2+ binding protein, contains EF-hand motifs  ali follow..  13  457....YHIDDVDIALHFH------KMAGMSIDAKLLQRVAVKV----GIPLSDHVVDVVITLFDDNLDGKLSHEEMVAVMRR............................................................................................... 524
7 -7.270[T] KOG0034 Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein  ali follow..  146HPYASIQEKTDFAFRLYDLRQTGFIEREEVQ-QMVSAILLESDMMLSDELLTMIIDKTFADADSDKDGKISKDEWNVYVHK............................................................................................... 225
8 -7.200[ZD] KOG0028 Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein  ali follow..  10  74.LSEAQKCDIKEAFDLF------NEGTGYIEVKELKVAIRAL----GFEPKKEEIKRMISDIDKDCSGRIAFNVFLQLMTIKMAEKDTKEEILKA................................................................................. 158
9 -7.010[TZDR] COG5126 Ca2+-binding protein (EF-Hand superfamily)  ali follow..  13  92TSRGTLEEKLSWAFELYDLNHDGYITFDEM-ASVYKMMGSMVTLNEDEATPEMRVKKIFKLMDKNEDGYITLDEFREGSKV............................................................................................... 175
10 -6.670[T] KOG0044 Ca2+ sensor (EF-Hand superfamily)  ali follow..  16  92TSRGKLEQKLKWAFSMYDLDGNGYISRSEM-QAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKS............................................................................................... 175

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.