current user: public

If you have questions about the server, please let us know.

Query: [S] KOG4376 Uncharacterized conserved protein, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MMNNYDESDMVYCPYNKEHKMLRKKLQQHILKCRVIYKDTVELMVCPFNSSHLIPEPQFFQHTQSCEDRNIIVHYQTSAPAVLSEDTRHAKIESEENWDDDESVPDYDPQVYCSRANIVREPNGLFPAQRRAFIEQEKRRHFGEDYEEEKKPRKAKARADLRPTPYEHRRPYSRRQLast
1 -82.000[S] KOG4376 Uncharacterized conserved protein  ali  100  1MMNNYDESDMVYCPYNKEHKMLRKKLQQHILKCRVIYKDTVELMVCPFNSSHLIPEPQFFQHTQSCEDRNIIVHYQTSAPAVLSEDTRHAKIESEENWDDDESVPDYDPQVYCSRANIVREPNGLFPAQRRAFIEQEKRRHFGEDYEEEKKPRKAKARADLRPTPYEHRRPYSRRQ 176
2 -14.800[S] KOG2811 Uncharacterized conserved protein  ali follow..  20  11..KRAKPSERLQCEYFMEKKKRRCGMTEHLNKNGSEAEKERERVPCPLDPNHTVWADQLKKHLKKCNKTKLSHL...................................................................................................... 103
3 -10.100[R] COG5084 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins  ali follow..  17  229.....EPTRKTICPK--SHELDPRRIPA----CRYFLLGKCNNPNCRY--VHIHYSENANQHILQCTD............................................................................................................ 316
4 -9.820[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali follow..  13  124.........IQACPVDAIVGATRAMHTVMSDLCTG-------VDPCPTHCISLQPVAETPDSVRIIPVEH.......................................................................................................... 190
5 -9.800[R] KOG4684 Uncharacterized conserved protein, contains C4-type Zn-finger  ali follow..  19  50....ASGIPVINCRVCQSLINLDGKLHQHVVKCTKNPPTGKKYVRCPCNCLLICKDTSRR---IGCP............................................................................................................. 117
6 -9.470[T] KOG4825 Component of synaptic membrane glycine-, glutamate- and thienylcyclohexylpiperidine-binding glycoprotein (43kDa)  ali follow..  12  780.........LTRCDH--KQVVEISSLTEHLLECDKKD----GFGKCY-RCSEAVFKEELPRHIKHCP--------------------HENFSPGEEAW-----------------KAHLMGPAGCTMNLRKT-HILQKAPALQPGKSSAVAASGPLGSKAGSKIPTPKGGLSKSSS 919
7 -9.210[C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit  ali follow..  13  62...........FCPEPAIYIKEDGFVAIDYDYCK--------ANECPTKAITMVREEK...................................................................................................................... 105
8 -9.190[S] KOG3931 Uncharacterized conserved protein  ali follow..  27  575..AKRIENDIVSCPI--FEKMRRTELSNHFDGCRRQRNLFKETVGCPR-CGLEIMPLHLKVHGSVCAGRKK......................................................................................................... 723
9 -8.760[C] COG0437 Fe-S-cluster-containing hydrogenase components 1  ali follow..  19  72.....DPACTKVCPSGAMHKREDGFVVVDEDVC---------HMACPYGAPQYNAEKGHMTKCDGCYSRVA......................................................................................................... 134
10 -8.720[R] KOG3002 Zn finger protein  ali follow..  21  53........ELLECPVPNGHTL-KLRVQNTCPTCRYELGNIRCLALCRYQNQDIFPYYSKLKHEQHCRFR........................................................................................................... 141

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.