current user: public

If you have questions about the server, please let us know.

Query: [T] KOG4378 Nuclear protein COP1, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .
# Score Template Links and tools%idFirst MMSNLVEPSWRLLAASGGDTVKLFDVSADSGDPCVLSYTPSPGCAVNSVKWNHTNLVVASTGEDKKISLWRKNGQSLGTVPVTGKDGGDSAEECLSAISFSKKGSRYICSGGTGQIVKIWDLQRKLCIKKLKGHTSTITGVMYNCKDEHLASVSVGGDLIVHNLASGARATELKDPNGQVVQFVHVLRLLDYSRSSRHLLVTAGDDGTVHLWDTTGRSPKMSWLKQHSAPTAGVCFSPSNEKIIASVGMDKKLYTYDSGSRRSSSCIAYEAPFSSLAFGDNGYILVAGTSNGRVVFYDIRGKPQPVTVLHAFSNSEDVTSLSWQTSKPVIVNEKNYTSEMALLGSTVEDSVVIPDPLPSTTPSASQSAMAPGSRGVSASTVNASSVEQTPNRNHLWPSGPLGRLHALRANDSYNDDMGVFSPIIDVSSVEKWADSEGYNNKDHLVVDNKPSSLLFPSSSKGYSFGDNGSKEHPIFDWKPSSTSKQDDPRAAFSSFGSITPTASSKSEDSALTPPEAWGGDKFSEKFNQLANEKFSDKFSHLHAPSRLAVSSTGASTSGSMFSSSRDFPLSHGQTNFANASLEFPRIRDFSSTFETSSTQTDNNLPSSPLFTKGITAPGNIDSLRLSPNFTRRFSTYAERISTTSSFSDGASLSLGGSPKIKKTGSETREEVLNHLLARPETVVATEAGAMPLMNGGLKQSQTDQQQVMGSSNFTLQLFQRTLEGTLDSFQNSIHDDVRNLHIEILRQFHMHEMEMSKVLSSILENQAEQMKELKLLRKENQELRQRLLast
1 -190.000[T] KOG4378 Nuclear protein COP1  ali  100  1MMSNLVEPSWRLLAASGGDTVKLFDVSADSGDPCVLSYTPSPGCAVNSVKWNHTNLVVASTGEDKKISLWRKNGQSLGTVPVTGKDGGDSAEECLSAISFSKKGSRYICSGGTGQIVKIWDLQRKLCIKKLKGHTSTITGVMYNCKDEHLASVSVGGDLIVHNLASGARATELKDPNGQVVQFVHVLRLLDYSRSSRHLLVTAGDDGTVHLWDTTGRSPKMSWLKQHSAPTAGVCFSPSNEKIIASVGMDKKLYTYDSGSRRSSSCIAYEAPFSSLAFGDNGYILVAGTSNGRVVFYDIRGKPQPVTVLHAFSNSEDVTSLSWQTSKPVIVNEKNYTSEMALLGSTVEDSVVIPDPLPSTTPSASQSAMAPGSRGVSASTVNASSVEQTPNRNHLWPSGPLGRLHALRANDSYNDDMGVFSPIIDVSSVEKWADSEGYNNKDHLVVDNKPSSLLFPSSSKGYSFGDNGSKEHPIFDWKPSSTSKQDDPRAAFSSFGSITPTASSKSEDSALTPPEAWGGDKFSEKFNQLANEKFSDKFSHLHAPSRLAVSSTGASTSGSMFSSSRDFPLSHGQTNFANASLEFPRIRDFSSTFETSSTQTDNNLPSSPLFTKGITAPGNIDSLRLSPNFTRRFSTYAERISTTSSFSDGASLSLGGSPKIKKTGSETREEVLNHLLARPETVVATEAGAMPLMNGGLKQSQTDQQQVMGSSNFTLQLFQRTLEGTLDSFQNSIHDDVRNLHIEILRQFHMHEMEMSKVLSSILENQAEQMKELKLLRKENQELRQRL 787
2 -74.700[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  11  68VTCLCPSPDGLHLAVGYDGSIRIFSLLSGE----GNVTFNGHKAAITTLKYDQLGGRLASGSKDTDIIVWDVINES-------GLYRLKGHKDAITQALFLREKN-LLVTSGKDTMVKWWDLDTQHCFKTMVGHRTEVWGLVLLSEEKRLITGASDSELRVWDIAYLQEIEDPEEPDSIMREGRDRVVNLAVDKTGR-ILACHGTDSVLELFCILSKKEIQKIKTSAKIKSFDLIHSPHGELKAVFLLQNNLVELYSLNPSLPITIGGHRSDVRTLSFSSDNIAVLSAAAD-SIKIWNRSTLQCIRTM-----TCEYALCSFFVPGDRQVVIGTKTGKLQLYDLASGN----LLETIDAHDGALWSMSLSPDQRGFVTGGADKSVKFWDFELVKDENSTRTLQLDEDVLCVSYSPNQKLLAVSLLDCTVKIFYVDTLKFFLSLYGHKLPVICMDISHDGALIATG---SADRNVKIWGLDFGDKSLFAHDDSVMYLQFVPKSHLFFTAGKDHKIKQWDADKFEHIQTLEGHHQEIWCLAVSPSGDYVVSSSHDKSLRLWERT--REPLILEEEREMEREAEYEESVAKEDQPAVPGETQGDSYFTGKKTIETVKAAERIMEAIELYREETAKMKEHKAICKAAGKEVPLPSNPILMAYGSISPSAYVLEIFKGIKSSEEESLLVLPFSYVPDILKLFNEFIQLGSDVELICRCLFFLLRQMLVPVIEKLRETTISKVSNMALDYLKR-ECEAKSEVMFFADATSHLEEKKRK----RKKREKLILTL 942
3 -74.600[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  10  17NGNLVFTPDGNSVISPVGNRITVYDLKNNK----SRTLSLESRYNYTNIALSPDGSLLIAVNEKGEAQLISMMSCTVIHRPFVLRRRFLGGFDDVTWLDWSSDS-RLLAIGCRDSSTKIVAINYTKRTYNLSGHTDAIVACFFEANSLHLNTISRNGQLCLWECSLAKITRHYLADEPRKEQRDVQLTAANYNTRTK-VLVVAFSSGAFYLYELPDVNMIHS-LSISDYPISAALFNCTGDWVALASREIGQLLVWEWQSEQYIMKQGHSSEMTCIAYSSDGQFIATGGEDSKVKLWNTQSSF---CFVTFSEHTSGVTGIQFSRNKKFLVSSSLDGTVRAFDVNRYRN---FRTFTSPNPAQFSCVAVDYSGELVVAGGQDVFDI----SVKTGKLLEIISGHEGPVVSIAFSPTSSTLVSGSWDKTVKIWNCLESNSEHETIDAVSDVTNVTFSPSGEEIAVA---TLSGNITIFDIKSAGQVTTIEGRNDLSAGRLETDIITARKN--------------------AQANYFSTIEYSADGECILAAGKSANICIYHVREAILLKKFEITQNHSLDGLNDFISRKHLSEFGNMALVEEREELEGGRVAIRL---------VQRGDMSSRRFQQEVRVFSVKFSPTGQAFAAAGTEGLCIYALDKSLEVTPKAVHESLKQQNYTKALVMSLKLNEPNLIALVLERVPYKDVELEFAQRLLQQLARQLQSTPHIEFYLQWSCCLLTKHGNQVFQHTGLLALHEVLSRKYEMLNKICDYNKYTLKVL 893
4 -69.700[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  11  26PIVLGADPKGKNFLYTNGNSVIIRNIENPA----IADVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTVNKEFMSETGTSVGEISGQSKSINSADFRPARPFRIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEFGSP-----AHKGGVYALAWKPDSTQ-LLTCSGDKTCRLWTVESRELVSEFVMGTTVDDQQVSCLWQGDN-LITVSLSGVITYLNVADKPLRVVKGHNKPITVLGLSDDRSTIYTGSHDGVVTNWNSGSGTN----DRITGTGHGNQINGIAAWGDFVYTCGIDDSLRQFSVEGNS----YTDYVVKLNCQPRGLAILRNENIIALACIKELTLVQDQKKIFSLP------IKYEASSIAVNADTSDVAVGGDDQKLHIYTLKGGVLEKVELDHLGAVTDVSYSPDLKYLVACDA---HRKVVLYSVEEYKPAHNFHSARVNTVAWSPNSLLVASGSLDTTIIIWSVANPAKHTIINAHPQSQITRLVWLDNNTVISTGQDCNTKVWHVEN................................................................................................................................................................................................................................ 607
5 -69.400[BK] KOG1063 RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily  ali follow..  11  22VNNVSWGASG-LVSFGAQNAVAVFCPKTAQ----ILTTLPGHKASVNCTHWLPDRQYLLSGDSDGIIILWELSTLNNDQQWRHVLQLPLSHKKGVTCIMVSETDA-MFASASSDGVVNVWDVSFPVCLDSICVDTKAIVTLSLNPGRFALALGGLDNKIKLYSGERTGKFTSVC----ELKGHTDWIRSLDFSLPLHTMLVSSSQDKVIRIWKLVLVGSVESVLIGHEDWVYSVEWQPPVIDFILSASMDKTMMIWRPEKKTVGELSHCALGFYGGHWSPNSLSILAHGYGGAFHLWRNVSSSKESEQKVPSGHFAAVTDVTWARTGEYLLSVSQDQTTRVFSAWKNDEGNEA-----------------------------------EDEHWHELARPQVHGHDINCVAMVQGKGNHRFVSGAEEKVVRVFEAPLSHTCAGGEGSFPEDLQADVQVLGANMSAL---GLSQKPIYLHSSSEPLERNGGGEGLDTFETVPEAAPAELKEPPIEDQLAFHTLWPESHKLYGHGNELFSLCSDHKGNLVASSCKAQSASMAEIGTWKAVGRLQSHSLTVTHLEFSYDDTLLLSVSRDRHFSVFSIQRT--------------DNGEVSHKLMAKVEAHKRIIWACSWNPFGHQFATSSRDKTVKIWSVENDAQILVLPPFGSSVTAVAWTGLDRNEKSGCVAVGMESGLIELSNVKII---ETEEGTTATAALALRLEPFMCHVSAVNRLAWRSNQSLRWLTSCGDDNCVRVFNFK............. 839
6 -69.300[R] KOG4227 WD40 repeat protein  ali follow..  10  56VNAIEFSNNGQWLVSGGDDRVLLWHMEQAHSRVKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETLDV---------AHEDAVYGLSVSPVNDNIFASSSDDGRVLIWDIRESPHGECLANYPSAFHSVMFNPEPRLLATANSKEGVGLWDIRKPQSSLLRYGGNL----SLQSAMSVRFNSNGTQ-LLALRRRLPPVLYDIHSRLPVFQFGYFNSCTMKSCCFAGDRDQYILSGSDDFNLYMWRIPADPEAVLKGHRSIVNQVRFNPHTYMICSSGVEKIIKIWSPYKQPGCTGDLD--GRIEDDSRCLYTHEEISLVLNSGSGLSHDYANQSVQED---PRMMAFFDSLVRREIEGWSSDSDSDLSESTILQLHAGVSERS-RLSALRRYQDKRLLALSNESDSEENVCEVELDTDLFPRPRSPSDESSSSSSSSSSEDEEELNERRASTWQRNAMR---RRQKTTREDKPSAPIKPTNTYIGEDNYDYPQIKVDDLSSSPTSSPERSTSTLEIQPSRASPTSDIESVERKIYKAYKWLRYSYISYSNNKDGETSLVTGEADEGRAGTSHKDNPAPSSSKEACLNIAMAQRNQDLPPEGCSKDTFKEETPRTPSNGPGHEHSSHAWAEVPEGTSQDTGNSGSVEHPFETKKLNGKALSSRAEPPSPPVPKASGSTLNSGSGNCPRTQSDDSEERSLETICANHNNGRLHNNGQNLGELLHKDCCGSEMA-TREDPTDTPATDS--SRAVHGHSGLKRELEDTDSENSSSEKKL 940
7 -69.100[A] KOG0319 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  10  20GGTVRWSANGQKLFSTCTNVVKVIDLADNTASYTIGD--PEDELRITCTAVDKNRNRLLVAYNNQIIREYSIPLDPSTTKPELARTWKTIHTAPILVMEFNEEGH-LLATGSADHIVKVWNLTEQKLVNTWKSHNSHITALLQVPDSRVVVALSRDQTMSIHETETQETLRVLPLYES--------IEGGAIGHNGN--LFTVGEEGVVKEFVIETAKLVRK-KRIASSNLDHLAYDVVSNR-FLAISAEQNLIILDFENLKIARQIFHDEIYSCCLLGKDESHMAVASNTSEIRLYNTKTLDCQLIR----HTESVLSVVSPTWDTSLLASCSKDNSIIFWRLVTSPENDSCSTAATGHANTVTALAISNTGRAPFLASVSTDCTIKVEQLPKLTCSSTMVAHGKDVNCVDISESDALIATGGMDKLVKLWQVDTHKMAGTLSGHRRGVGDVKFAKNSHKLASC---SGDMTIKIWNISEKSQTISGHSCAVFRVIFARNDSQLISADSAGIIKIWTIKTADCECSIDAHTDKIWSLSKNHNESEFVTAGTDGRIVVWKDVTEEKQKAEDNKR--REAIEQDQTLTNLLSQKRYSEALVFALTLAKPF---------------------CAFKVINALMAEETPEELGSAIRRLDTRQIEILLQFTVKWNTNSRTSSVAQRVLYEIVHIVDPEE-LVSMPGAYGYIESFLPYTQRHMDRLFDFVWRQMRSSV...................................................... 793
8 -69.100[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  16  429LTVANEADSLTYDIANNKDLRKTWNP---------KFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTASTSLDVEPIYTFRAHKGPVLCVVMSSNGEQ-CYSGGTDGLIQGWNTTNPNLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWNTTEVAPALSVF---NDIKELGIPASVDLVSSDPSH-MVASFSKGYTSIFNMETQQRILTLTANSSCQINRVISHPTLS-ISITAHEDRHIKFYDNNTGKLISMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV............................................................................................................................................................................................................................................................................................................................................................................................................................................................ 780
9 -68.800[R] KOG1539 WD repeat protein  ali follow..  10  17VPFSVQRLGTETFVTVSGKAFQIYNCAKLN-SKFFLLLKPKLPKKIRALASYRDGEHVLSLDVEGNMFIWAFKGIEEHLAPIGNLQ-LTGKFTPTSIVHPDTYLNK-VLVGSQEGPLQLWNINTKKMLYQFKGWGSSVTSCVSSPALDVVAIGCADGKIHVHNIKLDEEIVTFEH------ASRGAVTALSFSTDGRPLLASGGSFGVISIWNLNKKRLQSVIRDAHDSSIISLNFLANEP-VLMSASADNSLKMWIFDTNDLRFRSGHSAPPLCIRFYSNGRHILSAGQDRAFRLFSVIQEQQSRELVSRNHLLLAILACAISACGNFAVVGTAGGWIERFNLQSGISRGSYFDMRYAHDGEVIGVACDSTNTLMISAGYHGDLKVWDFKKRELKSQ----DVGCSLVKIVYHRVNGLLATVADDFVIRLYDVVTLKMVREFRGHTDRITDLCFSEDGKWVISS---SMDGSLRIWDVILAKQIDGHVDVPITALSLSPNMDVLATAHSDQN-VNQSMFSGLPSVESYASGKDVVNVKLPSVSALTSSEADDDMDRQVLENSEALQASSFSISQKQIPELV--------------------TLSLLPKSQWQSLINLDIIKARNKPIEPPKKPEKAPFFLPSIPSLSGDILFKANDSEADGENEENNKKDQNSMKNFDALESPFSKHLKSSWDSKHFLDFTNYMKSLSPSALDMELIGQLLDYFINEVSCKNDFEFMQAVVKLFLKIHRCHPSLQEKAKKLLETQSLVWQKMEKLFQSTRCIVTFL 926
10 -68.700[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  12  18VKSVDLHPTEPWILASLSGTLCIWNYQTQV----MAKSFEVTELPVRSAKFVARKQWVVAGADDMYIRVYNYNTMDKVK-------VFEAHSDYIRCVAVHPTLP-YVLSSSDDMLIKLWDWEKGACTQIFEGHSHYVMQVTFNPKDNTFASASLDRTIKIWNLGSPDPNFTLDAHQKG-------VNCVDYFTGGDKYLITGSDDHTAKVWDYQTKSCVQT-LEGHTHNVSAVCFHPELP-IIITGSEDGTVRIWHATTYRLENTLYGLERVWAIGYIKSSRRVVIGYDEGTIMVKLGREIP----VASMDNTGKIIWAKHNEIQTANIKSIGADYEVTDGERLPLS-----VKELGTCDLYPQSLKHNPNGRFVVVCGDGEYII--------YTALAWRNRSFGSGLEFVWSSEGECAVRESSSKIKIFSKNFQ------EKRSIRPTFSAEKIFGGTLLAMCSSDF----ICFYDWAECRLIQR-IDVTVKNLYWADSG-------------------------------------------DLVAIASDTSFYILKFNRDLVTSHFDSGRPTEEEGVEDAFEVLHENDERVRTGIWVGDC-----------NNSSWKLNYCVGGEVTTMYHLDRPMYLLGYLASQSRVFLVDKEFNVIGYTLLLSLIEYKTLVMRGDLDKASE-ILPTIPKDQHNSVAHFLESRGMIEDALEIATD-LEIAQEIAVEVQSESMSSGKLQMAEECMKYAMDLSGLLYSSLGDAEGV-TKLATLAKEQGKNNVAF 730
11 -67.800[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  11  17VCGVGWIGTEAILSAADDHVFLLTNTATNESQQILNMPETFFPTSLRSQTKGGQNDVFAVSTSDGKINILSRNGKVENMV--------DAHNGAALCARWNSDGTG-LLSSGEDGFVKMWSR-SGMLRSVLAQFATAVYCVAWDSTSSNVLYCNADHCYIKSLKMQVAPI--------KWKAHDGIILCCDWNPTSD-LIVTGGEDLKFKVWDGFGQ--ILFNSSVHDYPITSISWNTDGTLFAV--GSHNILRLCDKSGWSHSLEKMNAGSVMALSWSPDGTQLAVGTAAGLVFHAHIIDKRQKTVIEVRDVSSEVSRETLETKERISKIAILYKYLIVVTSSHIYIYSSKNWNTPTMIEYNERTVNIIVQCEKIFLVSDGMTITIFTYEGRKLINPPGQVMALLDERKIDLANDTLVVRDRADNKVLHFFDPTTGKAQGDNLKHEHDIVELTVNQCGRNVAFRDQIGA--HIAMVKTFGVSQRMVKIGSLVEQLVFNDVTNMLCGIS-------------EGKIAVWPLPNVAFHDRNLLQKSLIQKNIGSVGKFPQLANFAGNTIVIRKSDGCLLPTGILPFYGTLITMASQSKWDQAIRLCRSIGNDTM------------ATFAGLAVLHKNMIVMEIAYAALED----------------EKVSLINEIKDKTDKETRQAMQVVLTGKLADADVL-----------ERSGLSFRSLM---------LNIQMFKWKLELGLKNKQWLEIVMGYREKYLETDPLFLKHMSEVEIDWVHIRELI 751
12 -67.700[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  10  10VDSVAFNSEEVLVLAGASGVIKLWDLEESK----MVRAFTGHRSNCSAVEFHPFGEFLASGSSDTNLRVWDTRKKGCIQ-------TYKGHTRGISTIEFSPDG-RWVVSGGLDNVVKVWDLTAGKLLHEFKCHEGPIRSLDFHPLEFLLATGSADRTVKFWDLETFELIGTTRPEATG-------VRAIAFHPDGQ-TLFCGLDDG-LKVYSWEPVI-CRDGVDMGWSTLGDF-CINEGK-FIGCSYYRNSVGIWVSDISELEPY-YETREIKNIYVDSTGGNLNVAQNPGSLKATLPLESGKVATM-----VSEKQNAAYFGPAGDKYSSTSRDSDSGEESSYSERESIPFSRTKSGAHVRKTLAKFEESKQSAVVQSATRKKSGLAVEEEPQTQNKPFDAEDSIIKGITNKFEKALSSEPPTDEANRMFLKPPRIHRSSNSKYNDTRRAMSADPATFGKGGMENSGDVEDIPSKTERVLSREKPGDEQKNTEYPSGSRELNPVKIVEGVNVVSGRTRSLVEKFERGEKTTHTEGASTTIEQNNNAVQEDPRKTSRQTGETPVISTRRARSTPARVMPIVLNRDSNVTSDEPPLTQPARTSSFPVMPVILNQASNVTYDEPSVALTQESRTSHARILPVTFNQATNITSEEASVTLRRQRRNSAARVRPVLLSQATSHECPVTSVRPLRTSPARVMPTKLNQSVNMSDREDDSDITENLMLTH-NEFLSTLQSRLTKL--QIVRHF--ERSDVKGAIGALRKLTDQSVDVISILTEKIEILTLDM 869
13 -66.100[S] KOG0296 Angio-associated migratory cell protein (contains WD40 repeats)  ali follow..  16  64VFSVSINPVHSNLCASGDDLGYIWDITTGE----QICQLTGHKDSIVAIDWSFDGTYIATGGMDSQVRLWKSSTGFEFI-------TAFETVDEIVWLSWHPKGL-FLAAGCNDGSIWMWSLPSGKVVQVMYGHTAPVNAGKFIPPGKRLATVDDSGTLIVWNPATGAPECRMSSDDHRFDETAAGWTSFDCNAEGN-VLFLGGSSGKVKVVNINSSH-ILASLEAQTESVEAIALCTALP-ICACASVDGTVALYDSASLKFRKSLPHEQAVIDCKFLPNTPYLLTACADCVIRKWDVRSGQ---LLGEYTGHQEPILCMAITPDGKRVVTGSDDTELLVFDCEH......................................................................................................................................................................................................................................................................................................................................................................................................................................................... 399
14 -66.000[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  12  137RNNLYLLPTGETVYFIAS-VVVLYNVEEQL-----QRHYAGHNDDVKCLAVHPDRITIATGQVAGTVRIWDSVTLNTLHV------GIGFFDRAVTCIAFSNGGTNLCAVDDSDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGEITSLLLDTRRKLPLIRSKSENGDTITHEGGISPLCMLRDGT-LVSGGGKDRKLISWSGNYQKLRTPITQGHTDELWGLAIHASKP-QFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKD---LVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVS-PEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRHIYGGHSSHVTNVDFLCEDSHLIST--GGKDTSIMQWR..................................................................................................................................................................................................................................................................................................................... 715
15 -65.800[S] KOG0271 Notchless-like WD40 repeat-containing protein  ali follow..  12  7ISVSFVSEDENELGGSGILPVDISTNELQI---LCNQLLGSSDDPVPISFFTTEGAEIVDSIRKSLEEIDFETTLKLVYQPQA-SASIPGHGEPVISAQFSPDG-RGLASGSGDQTMRIWDIELELPLHTCKSHKSWVLCIAWSPDATKIASACKNGEICIWNAKTGEQIGK------TLKRHKQWITSLAWQPMHCRLLASCGKDGNIFIWDTVQGTVVRC-LSGHTASVTCLRWGGEGL--IYSGSQDRTVKMWRADDGVMCRNMGHAHWINTLALNTDYALRTSCFEPSKRCIKPDTVEECQKVA------QTRYEAALEIAGGERLVSGSDDFTLFMWNPKETKQSI---NRMTGHMQLVNQVVFSPDTRYIASASFDKSVKLWCGRTGKY--LASLRGHVGPVYQVAWSADSRLLVSGSADSTLKVFELKTKSLYYDLPGHGDEVFTVDWSPEGTKVVS---GGKDKVLKLWR..................................................................................................................................................................................................................................................................................................................... 472
16 -65.800[A] KOG0285 Pleiotropic regulator 1  ali follow..  11  23RAREIFSPVHGQFPQPDPEGVEPASKPTRIAD---HNSEKTAPLKALALPGPKGSKELRKSATEKALVVGPTLPPRDLNN--------TGNPGKSTAILPAPGSFSLSTAALMERMPSRWPRPPWKNYRVLQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATGVLKLTLTGHIGQ-------VRGLAVSNRHT-YMFSAGDDKQVKCWDLEQNKVIRS-YHGHLHGVYCLALHPTLD-VVLTGGRDSVCRVWDIRTKMQIFVLPHDSDVFSVLARPTDPQVITGSHDSTIKFWDLRYGKSMATI---TNHKKTVRAMALHPKENDFVSASADNIKKFSLPKGEF----CHNMLSLQRDIINAVAVNEDGV-MVTGGDKGGLWFWDWKSGHNFQRPGSLESEAGIYAACYDQTGSRLVTCEGDKTIKMWKEDED--------ATPETHPLNFKPPKEIRR.................................................................................................................................................................................................................................................................................................................................... 476
17 -65.300[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  10  3VKMLSRNPDNYVRETKLDLQRV-------------------------PRNYDPALHPFEVPREYNATKLERVFAKPFLA-------SLDGHRDGVNCLAKHPEKLATVLSGACDGEVRIWNLTQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEE----PLHTILGKTVYTGIDHHWKE-AVFATCGQQVDIWDEQRTNPICS-MTWGFDSISSVKFNPIETFLLGSCASDRNIVLYDMRQATPLKKVILDMRTNTICWNPMEAIFTAANEDYNLYTFDMRALDTPVMVHM--DHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVY---HTKRMQHVICVKWTSDSKYIMCGSDEMNIRLWKANASEKLEKAAKDYNQKLKEKFQHYPHIKRIARHRHL-PKSIYSQIQEQRIMKEARRRKEVNRIKHSKPGSVPLVSEKKKH............................................................................................................................................................................................................................................................................................................................. 439
18 -63.700[B] KOG0273 Beta-transducin family (WD-40 repeat) protein  ali follow..  18  182VFICAWNPVSDLLASGSGDTARIWNLNENSNGGSTGGHDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTENGNLASTL--------GQHKGPIFALKWNKKGN-YVLSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMT-FASCSTDMCIHVCRLGCDHPVKTFQGHTNE-------VNAIKWDPSGM-LLASCSDDMTLKIWSMKQDACVHD-LQAHSKEIYTIKWSPTGPIMLASASFDSTVRLWDVEQGVCTHTLKHQEPVYSVAFSPDGKYLASGSFDKYVHIWNTQSGS----LVHSYQGTGGIFEVCWNARGDKVGASASDGSVCVL............................................................................................................................................................................................................................................................................................................................................................................................................................................................. 520
19 -63.400[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  11  32VSALQYDAQNGRLFTGGDTIIRTWSVPHHKSPVQYQGSLEQHTDWVNDMILCGHGKILISASNDTTVKVWNIERDNKHGF----IDCIRTHKDYVSCLAYAPIVEK-AVSASFDHNIFVYDINANKTVNNLIGCKDSIYSLATTPNLSLVLGAGTEKCIRLFDPRTNEKIMKLRGHTDN-------VRALVVNDDGTR-ALSAGSDATIRLWDIGQQRCIAT-CIAHEEGVWTLQVDSSFT-TVYSAGKDKMVVKTPLYDFTKSQLLKEEAPVKKLLLSEKDNSLWVGTWKSDIKRWSIRPSAQLSIGELVIPGAPAIKKHAMLSDKRHVLTRDSDGNVALYDVLAARKIKDYKRIFEEVVDENSRQVYIPSWFVVDSKSGMLQITLDELDALSSWLSSKLRSLFERWPPCKMTNVDAADADDVQKATLNFISLPEHTPLIICEGNGRPLYRLLVGDAGKEFEA---NELAQIAPMWVID................................................................................................................................................................................................................................................................................................................... 576
20 -63.100[S] KOG0293 WD40 repeat-containing protein  ali follow..  12  277VWFLQFSHNGKYLASSSDQTAIIWEISADGH--SLKHTLVGHHKPVIAILWSPDDRQVLTCGAEEVIRRWDVDSGDCVHM-------YEKGGISPISCGWYPDGQG-IIAGMTDRSICMWDLDGREKECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLFDREATVER---------LIEEEDMITSFSLSNDNK-YILVNLLNQEIRLWNIEGDPKIVSRYKGHKRSIRSCFGGYKQA-FIASGSEDSQVYIWHRSTGKLIVELGHAGAVNCVSWSPTNLMLASASDDGTIRIWGLDRINQ-QNQKKKLVQGSSSNGVIHRCNGN........................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 589
21 -63.000[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  14  285HKGVDILSEVEAVKDW-SKRLHLGPRASLPS--VCMYTFHHTNNNMNCAEFSPDSTMIACGFQESYIRLWSIKADKKSLPKSTSVEDSDSHSGPVYGTTFSPDN-KYLLSCSEDASARLWSVDTKTALVAYKGHTGPVWDVAFGPFGHYFATASHDQTAQLWSCDHIYPLRVFAGHLSD-------VDCVTFHPNSA-YVLTGSSDKTCRLWDVHRGHS-VRVFNGHTQPVTAVAIAPDGH-TMASADSEGLIHLWDIGTGRRIKTMGHRGNIYSLSFSRESTVLVSGGSDCTVRAWDVFKTNYNNPV---SSSLTGSVVTPFSAKTSTFNEVNWSTSPDQMV------------ALYTKQTPIFNVSFTRRNLCLAISVS...................................................................................................................................................................................................................................................................................................................................................................................................................... 643
22 -62.900[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  1...MEISSEDNNLMEKVPPVEQVLTWTLIQ----ICMQESDVELETKVKKYLRGEGANLETLKDKKLKTQLASREKLYG-------KSAKAAAKIEKWLLPAEAG-YLETEGLEKTWRVKDILSSRNQYDIVLPDFGPYKLDFTASGRHMLAGGRKGHLALLDMMNMSLIKEIQVRETHCLKERGPVARLRFLKNHF-LLASVNMSGQLHYQDVTHGGMVAS-IRTGKGRTDVMEVNPYNS-VVGLGHSGGTVTMWKPTSQALVQMQCHPGPVSSVAFHPNGHLMATSGKERKIKIWDLRKFEEVQTI-----HSFHAKTLSFSQKGLLAAGTGSFVQILGDSSGGSHNYTRYMNHSMVKGYQIEKVMFRPYEDVIGIGHSMGWSSILIPGSGEP---------ANPFETSKQRREKEVLLDKLPPETIMLDPSKIGAMRPSRRKEKPSRGEIEAEKEVAIEAAKSTELKNKT.......................................................................................................................................................................................................................................................................................................................... 491
23 -62.500[I] KOG0301 Phospholipase A2-activating protein (contains WD40 repeats)  ali follow..  1...........MADDGLGDPMETESMPQYT----ISHVIEAHKSDTKALAVTQGGC-LISGGRDETVKFWAKKGKQYTKT----HAFEQPKGITVNSIAYAELADWRLFVGRRDGTIAVFGPSQAEPYAIFNEHKQNVCCLHINEKATHMLSGSWDSNVIIWPITELNSSSFTT----VCPGHTLSVWALASFPDLPNTYLSASADKTIRMWFGDT---TLSVFKGHTDVVRALVVLSSSH--FLSAGNDGHIIHWDVASASILRKFATQAHEFIYSMTLSDSHILTTGEDGTLEFWAIDGGKD-VSEAVIQLPTTNTWDAKVLLNSD-IAVAGSDGRIYIMTTDKNRKADD--DILDAFDAEVVAKLTAKTERMKQEEHETVTIKVDIDDRPTQLNLKYKKGTDPGLCAQEFLSENNLPIHYLEEITRFIKDRIPEARAFDLKSGKKVALGVNFGKGEPDKQMPFNVNESPQFAAQRVERHQLPVSVIPSLAGMISQEMDKLSKGAASAQSGYEDPFTGPGRYVPQGSSNSGGHGADPFTGSGRYVPQASNSSGFDTGFSGDPLTGDGGYRASAPENTGSHAVPLSSLPQNKKKPRGPLGLAGKGEKAIAKLKELNEKQDAFQLNPDQINGLEELFVLPTSSNYSSEVTQSAFEMSLQWPVEHLTPVLDFLRIALTHHSLNSYFDRERGQELVGRLIAILVSDPADVALKVLVCRCIANAFSHP-TVLQMSAATALANWSLALLQQ---EQCEQLGPKEDLLRAILNGIESVDSFGYLGEDAIIRL 805
24 -62.400[R] KOG0286 G-protein beta subunit  ali follow..  13  18IADARKACADVTLAEL-VSGLEVVGRVQMR----TRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVH-------AIPLRSSWVMTCAYAPSG-NFVACGGLDNMCSIYNLKSRKVSRELSAHTGYLSCCRFLDDNN-IVTSSGDTTCALWDIETGQQKTVFVGHTGD-------CMSLAVSPDFN-LFISGACDASAKLWDVREGTCRQT-FTGHESDINAICFFPNGE-AICTGSDDASCRLFDLRADQELICFSIICGITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVGIL---SGHDNRVSCLGVTADGMAVATGSWDSFLKIW............................................................................................................................................................................................................................................................................................................................................................................................................................................................. 339
25 -61.800[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  15  487VCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPT------RIKAELTSSAPACYALAISPDS-KVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQH--------DFTSQIFSLGYCPTGE-WLAVGMESSNVEVLHVNKPDKYQ--LHLHESCVLSLKFAYCGK-WFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEV........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 768
26 -61.700[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  10  2........DDNTAPKKNSEKARVFDLQAMISNAPRTEEPTHVPQSVSVSSKSESGVSSSAVSDDEDDFMPDLPPGF---------QMQQSEAGPSSSRAEGPEDSD-DSDFDETEAISIIKLIPAACEAKISHGTQAISALRVEPPGVRFASGGLDYYVKLFDFQKMDM--SMRYDKELLPAESHVINSLAFSPNGE-TLVVASGEAIIRLLDRAGKQWSLNITKGHTATVNCVEFNPLNKNEFISCSDDGSLRLWNLDDHKVIGANGKRVSPQVCTFSPDGKWIAAGCDDGSVQAWKYGSQYVNVNYLVRKAHNGSITSIAFSPDSKRLLSRGFDDTLKMWSLDNPKEPLLV-KTGLENAFKSTDCGFSPRAEVVFTGTSSPNKDTPGTDPMTFDLVYKIDYPGISCHRIQWHPRLNQIIAGLSDGTIHVYYDQTMSQRGVMSCVTKPLKRNRFQPRGEEGEEKEVTGWRIKKYLRMQDNKLRPEFRKPADMPINGKSANGRVAASGGSLHSYLAKQIGTARNAEFLKDTDVRASILKHAKDAEE................................................................................................................................................................................................................................................. 577
27 -61.200[S] KOG0282 mRNA splicing factor  ali follow..  209SEEEQKELDEITAKRQKKGKQEEEKPGEEK----TILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVW--------SGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKV--------PYCVKFNPDEDNLFVAGMSDKKIVQWDIRSGEIVQE-YDRHLGAVNTIVFVDENRR-FVSTSDDKSLRVWEWDIPVDFKYIPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTK----LYSRFKAHDKVCIGAVWHPH-------------------------------------------ETSKVITCGWDGLIKLWD.................................................................................................................................................................................................................................................................................................................................................................. 579
28 -61.200[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali follow..  15  21NDLMAYTNRDKALLESGRRTSNLQAP---------IMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDC------ENVMAMSGHSGAVMEAHFTPDGSH-IFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLCSGSDDRTIKIWDARKKHAAHTLESPFQ--------VTAVCFGDTGEQ-VISGGIDNEVKIWDIRKQAVLHH-LRGHSDTITGMSLSPEGD-FILTNAMDNTLRVWDVRPYAPGERCNFEKNLLRCAWSPGSDKITSGSADRHVYIWDVNTRR---ILYKLPGHNGSVNAVDFSPKEPLILSGSSDKTLYLGEIDE......................................................................................................................................................................................................................................................................................................................................................................................................................................................... 347
29 -60.800[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  2.........AAIINQRVEQESSMGG-----AKPALLHRITGHVARINDVILLSKDEGVWTASDDRSVRLYLKRDND-----QFWPSIHHFMPVAPTSLYYSEETYK-LLVGLINGNVYEFDFNSMTESRKWTCHAGPISGLGFALSSELIFSCSRDKSIVWHCSENSNK----------MGSYLLENSCTAMVIDLPF-VFVGDHGGHVTVLRIVDNQNLVSKLSAHTNAITSLTWDGNKK-VLYSGSSDHLIIMWDIGGGRGEELNGHNGKVTTLCAAPAAKRLFSADEHGKLMCWDMNCKRVETPEWKTSDCCQKC-NQPFFWNLQAMWQRKVVGLRQHHCRTCGS---------------AVCGSCCDNWTTYPPMGYETKIRICNDCNARMKPLAIPHEIHTGITAMHLQETLGLLVTSGQNRVIMIWDVRSVCSAPS......................................................................................................................................................................................................................................................................................................................................................... 412
30 -60.300[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  13  1.MAQPYLPAEK-----------FLSRKQET-----ILLDEDEPAVVSSVRISPKKPYHVATTSSVRLTLYDTVVCEPLNL-------FSRFKKGVCSIDFRHDG-RLLAIGGDEGKVRIFDVESKVALRVMQASQSTVKSVHFSPRGDTVFSMADDGKIKQYRVADTAYGVN-AVPIIEIQAHEDAIRCGAVSSINDHIVLTGGYDHKVRLWDIRSKEKSLEL--DCEHPVESVLFLPGEQ--LIATAAGPIVKIWDTTTGRQLTALAHYKTVTSLRLATNSTCLLSAGIDRRVNAFRTTNYS----LINSWSMPSPVLDIDVSRDDQTMAIGMGNLLALYRRAEIKKEA----TASAAIEDKRSLIRTSAPPVKLVEKDRDMQKVDVVAKNADK---LKIPKIDGMLSNFKHAAVIKLLRSAMDTAVVSYLRVMRGAIHRALAGQERSVQKNILV........................................................................................................................................................................................................................................................................................................................................... 428
31 -59.700[R] KOG2096 WD40 repeat protein  ali follow..  1.MDSVLVVGIASVILGALIVLFFGSYFRKRT----SEVQSMAKAEPQDPIRNPKSNHPAPKKNHPKSQASDKNQNKRHH-----LNTLKGHGDAVTGLCFSSDG-KSLATACADGVIRVFKLDDFRFLRINLPAGGHPTAVAFADDASSIVVACHHMSSIKWDHHHIHEKRSVLTISGAT--------ATYGTADGSVVIASCSEGTDIVLWHGKTGR-NLGHVDTNQLKNHMAAVSPNGR-FLAAAAFTADVKVWEIVYQKVMQLKGHKSAVTWLCFSPNSEQIITASKDGSIRVWNINVRYHPIPLCDSGGNPLHYDRLSLCPEGKILAASHGSTLQW-----CAETGNVLDTAEKAHEGDITCISWAPKAITV------------------------------------GERHAMVLGTSGDDKKVKLWEAPKSQSL........................................................................................................................................................................................................................................................................................................................................................... 454
32 -59.500[DK] KOG0973 Histone transcription regulator HIRA, WD repeat superfamily  ali follow..  12  11ILAIDCHPSGKKFITCGNGLVVVWNAEPSNENVPKLLFQVESQSQSNSCRWSPDGKRFAFGSDDSSVSVWEYVGLINSMGSITGGAVLRGHSMEVLTVEWSPNG-KYLASGSIDYRIIIYNARKPDRITVLNDIQLPVKGLSWDPIGKYLASLEGDKKLRFWATDSWQCVKSVTEP--ESNIEETMLTRLDWSPDGKYLMTPAAVRSLIKLIQRQTWKSDQF-LAGHHKGTTCVRAMPRQLTCAAVGSRDKSISIWVFPGLKPLFVINNIFNHTVMDFAWCGRNLLACSQDGTVKVIHLSESV---EMISNEAMSDLCYQIYSIRPPRYELTDKEEDESQDSFNLSDLSSSANNASFVTCPEDVLIKRKKLVAAQQSSDIQLTKSMEDNSKENESKNSEKTMMEERNKQIDVRKDGKRRIQPV---------GTTTADPMTSLSSEGKKTVAPPPAKRKALAPAVPAKKGEVDLEDSSDSDDDDEEEEEDMEISDIESVRNKKRKVPATTSQPMLALDLKKPALRPMEPKSLKTQEGTVLMEAPEQQPKLSQHVVDRKGMFVEIDNRWKHGGVETTQIKLIKKKQQTAENEDDMMDGERRVNHVAANKHNVVLGCGDKCLRVYRTFCGFDCVEASTDNSLISADVSETGVPLIVFSNNVSLSCWIQAITT--DAQLSCSNGTTNSAGPLVRLLKRMRKQATAPGVAPQVVKAVKESQLEQLLHCALGNPQD--YQTMLMLYVETLCE---SEKKLKNILNDLS-RRSALYDDVRMIKLKQPAIAARI 913
33 -59.300[R] KOG0289 mRNA splicing factor  ali follow..  13  98TTRQELSHALYQHDAACRVARLTKEVTA---AREALATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESA-------VTGLSLHATGD-YLLSSSDDQYWAFSDIQTGRVLTKVTETSGCSLTCAQFHPDGL-IFGTGTMDSQIKIWDLKERTNVANFGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQL--DNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWT------EILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYS.............................................................................................................................................................................................................................................................................................................................................................................................................. 503
34 -59.200[R] KOG1334 WD40 repeat protein  ali follow..  10  280VSTIHFNQRGTRLASSGDDRVIVWDWVRQK---PVLNFESGHDINVIQAKFFPNDSTLAMCGHDGQVRVAELINASYCEN----TKRVAKHRGPAHELALEPDSPYKFLTSGEDAVVFTIDLRQDRVVTRENDKKVGLYTISMNPANIYFAVGGHDQFVRIYDQRRIDKKENNGVLKKVYCDFPTNITCVVYSHDGTELVVSGSDCGHVFFWEKSSSQIIQFMEGDRGDIVNCLEPHPYLP-VLATSGLDQHVRIWTPTAKTATELTGLKDVIKKNKQERDEDNLNYTDSFDNRMLRFFVR-----HLLQRAHQPGWRDHGAEFPDEEELDESSSTSDT................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 667
35 -59.200[S] KOG0295 WD40 repeat-containing protein  ali follow..  16  67ESKLQESQREINHGAPTRDRQAADWIPRPP----ETQKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYETGQLER-------TLKGHTDAVNDIAIDAAG-KQLVSCSSDLSIKLWDFQTYDCLKSLKGHEHTVSSVTFLPTGDFVLSASRDHTIKQWDISTGYCVYTFRGHNDW-------VRMIRISNDGT-LFASASLDQTVTVWSFATKSAK-LVLRDHEHAVECVEWAPDTAHILFSGSRDRSIKAWNINTGDVLFTLAHENWVRGLAFHPKGKYLISVADDKTLRVWELSAQR---CMKAIEAHEHFVSTVAFHQTSPFVITGSVDMSCKVW............................................................................................................................................................................................................................................................................................................................................................................................................................................................. 401
36 -59.000[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali follow..  17  40VNALDRTPDKTRLAACGYQCIRLYDLESNCTAP--VINFDGVQKNVTRLGFQEDGNWMFTAGEDHHVRIWDMIAAP------PHCSRIFDCEAPVNAACLHPNQVE-IAMGSQNGSVFLWDVKSERHERIVPEVDASIQDVAISPDGRYLAAANNKGNCYIWSLTSQDQKMSTLRPNRKIPAHSRYILRCKFSPDSR-LLLTTSGDGTVCIWKTDDFSKWRE-LCIENYWVWDAAFSADSK-WLFTASSDGIARLWKLQTKSSIRDYGHTKAITALSFKDEIPVKSTNISDVQSSAKPPTQRD---------NPPGTNNLAFFETVGRVAMNPYMGNTTTEL............................................................................................................................................................................................................................................................................................................................................................................................................................................................. 361
37 -58.900[R] KOG0646 WD40 repeat protein  ali follow..  10  2........EITVIASSSIDGIGSWDLKTGT----EQLQFKPCASPAHGLTAVGEKFLLSARNTSGSIFYWSWTKPQAEVK--------SYPVEPIKALAANNEGT-YLVGGGISGDIYLWEVATGKLLKKWHGHYRSVTCLVFSGDDSLLVSGSQDGSIRVWSLIRLFDDFQRQQGNTNFNEHTMSVTDIVIDYGGCNVIISSSEDRTCKVWSLSRGKLLKNI--IFPSVINALALDPGGC-VFYAGARDSKIYIGAINATSEYSVSEKGKAITCLAYCADGNLLISGSEDGVVCVWDPKSLR---HVRTLIHAKGSRKGPVNNQIVRKTIVANSNKTQVSWKSRGAL-------IPPPLEKYERPVEDTMDGIVTVDPPPFSDVPVYSSFLSADLIDEQVKELQQQGSAATEMEMERL-----KLEYKRSLQMNEQWQKNYENLLQVVMEEEQIGGTN........................................................................................................................................................................................................................................................................................................................................ 438
38 -58.100[R] KOG2055 WD40 repeat protein  ali follow..  14  220IRCMSIHPYFPLLLTCGDRTLRIYQLDGKVNP--LVTSLHLRSSALQTALFHPDGKRVIAAGRRKYMYIWDLESAQVQKVSRM--YGQENFQPSMERFHVDPTG-KYIALEGRSGHINLLHALTGQFATSFK-IEGVLSDVLFTSDGSEMLVLSYGAEVWHFNVEQRSVVRRWQVQDG------VSTTHFCLDPSNK-YLAIGSKSGIVNIYDLQTSNKPVTTLDNITFSINSMSFSQDSQVLIASRGKKDTLRLVHVPSFSVFRNWTPLGRVTCLAFGKGGE-LCVGNEAGRVGLWKLAHYDLKFVP-----DKIINWEIRLGKFGYVLLGIQILIL................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 549
39 -57.800[R] KOG2394 WD40 protein DMR-N9  ali follow..  14  137MTNTNFDGKGTYLVFNVSDAIFICDLNSQEKDP--VKSIHFSNSNPMCHAFAKDGHDLLIGLNSGDVYTVSLRQQLVGALHYNKDGSVNNRQDRCTSISWVPGGDGAAIRDPTQFSVDKAKYSKSNPVARWHICQGSINSIAFSNDGAHLATVGRDGYLRIFDFLTQKLVCGGKSYYGA-------LLCCSWSMDGK-YILTGGEDDLVQVWSMEDRK-VVAWGEGHNSWVSGVAFDSNWSSPFGSVGQDTQLLLWDLEMDEIVVPLRHTEPLSGLMFTQES--VVTACREGHIKIWTRPSESETQTNSSEANPTTALLSTSFTKDNKASLSSKIISGSTFK............................................................................................................................................................................................................................................................................................................................................................................................................................................................. 555
40 -57.700[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  11  136VYSVCWSPEGKRLITGCQTEFTLWNGTAFN----FETILQAHDSAIRALKWASNEQWLLSADQGGYVKYWQPNMNNAHMF-------SAHKDEAIRGLAFAPTDVK-FATASDDGTARVWDFARYTEERVLRGHGAEVRCIDWHPTKGLIATGSRDTPVKIWDPKSGSCLATLQEHKSS-------VMAVEFNKNGN-WLLTGGRDHLVKMYDIRMMK-EMRTYRAHKKEVISLAWHPIHEGLFVSGGGDGSIVYWMVDGEKEIGLLAHDQAIWSMKWHPLGHILATGSNDNNTKFWARNRPGDTVENTNMIGHLDKEREPRMAPPKPSIETQETYRPDTFIPGMGLDEHLY--EQLNRDHNMMTTDSTLLVPDDLTRQNFAPMIGAKRTLIKQPPA-KKAQRQFERMWNNSKGIGAGSDDFTTMKGGLGREDAEGAQFGPSTTGGSLLGPSQPRPQEFRSVPPPQQQQGPPPNWRHQGPPMSGPGQGYGPPGRMGGNQGGWQRPPPQGS..................................................................................................................................................................................................................................................................................... 639
41 -57.700[A] KOG0299 U3 snoRNP-associated protein (contains WD40 repeats)  ali follow..  11  144LVGVVAYENF-VYSADKSGLIQKWEALQEKDTENRRRGENDHVKEITCLAISNDGRWIVTGGLDHRIVIRDSVTLEPQH-------CWKHHRDAVMGLAMRRGTNE-MFSCSADRSIKVWSLDQMSYIETLFGHQDVIFGVDALARERCVSVGGRDRTSRLWKIVEESQLVFRSGGTSATAGYMEGSVDCVAMIDEDH-FVTGSDNGVIALWSVQRKKPLFTYIPPQPRWITSLAAIPYSN-LFASGSWDGNIRLWKIAEGLIATPLSVYGCINSLSLSLQGKVFAACGRETRVGRWKTLRGIP----NSGFVFNIPLTVIPSVTDGDEIDE....................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 524
42 -57.400[DO] KOG0305 Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits  ali follow..  15  129LNLLDWGSANV-LAIALGDTVYLWDASSGSTSE--LVTIDEDKGPVTSINWTQDGLDLAVGLDNSEVQLWDCVSNRQVRT---------RGGHESRVGSLAWDNH-ILTTGGMDGKIVNNDVRIRSIVETYLGHTEEVCGLKWSESGNKQASGGNDNVVHIWDRSLASSKQT-RQWLHRFEEHTAAVRALAWCPFQASLLATGGGDGKIKFWNTHTGACLNSV--ETGSQVCSLLWSQSERELLSSHGTQNQLTLWKYPSSKMAELNGHTSRVLFMAQSPNGCTVASAAGDENLRLWNVFGEP----PKTTKKAASKKYPELFSHVNSL.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 443
43 -57.400[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  13  21VLAARFNGDGNYALTCGKDTIRLWNPHRGI----LIKTYKSHGREVRDVHVTSDNAKFCSCGGDRQVYYWDVSTGRVIR-------KFRGHDGEVNAVKFNDSSS-VVVSAGFDRSLRVWDCRSHSVEPVQIIDTFLDTVMSVVLTKTEIIGGSVDGTVRTFDMRIGREMSDNLG---------QPVNCISISNDGN-CVLAGCLDSTLRLLDRTTGE-LLQVYKGHISKKTDCCLTNSDA-HVIGGSEDGLVFFWDLVDAKVLSKFRAHDLVNSIDVDFYLRKFFVAGDKRELPPEGRLYVDEKMKKQQILTSIDFVIYVSNSPFFFY.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 340
44 -57.200[U] KOG0277 Peroxisomal targeting signal type 2 receptor  ali follow..  16  19GYAAEFSPLPGRLACATAQTLLILDPDEAG---LRLFRSFDWNDGLFDVTWSENNEVLITCSGDGSLQLWDTAKAA------GPLQVYKEHAQEVYSVDWSQTRGELVVSGSWDQTVKLWDPTVGKSLCTFRGHESIIYSTIWSPIPGCFASASGDQTLRIWDVKAAGVRIVIPAHQAE-------ILSCDWCKYNENLLVTGAVDCSLRGWDLRNVRQPVFELLGHTYAIRRVKFSPFHASVLASCSYDFTVRFWNFSKPDLETVEHHTEFTCGLDFSLQSPQVADCSWDETIKIYDPACLTIPA................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 323
45 -57.100[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  11  18IYAVDWILEEAVRSKITKDDDDDDDGSSSSSYIVLIGRRVIGTDLPYRMAIHPRQGGLICALPNSRLFDWENIIEDDNEEESEKVVKELKDVGQQLSLSFNQDGT-VLATGAEDGTLRVFEWPSMKTLLNESKTHASVKSLTFSESGKFLVSLG-APLCRVWDVNASAAIASLSKEKDEM------FASCRFSVDNSYVAANTQRGGSIITWDTTSWRRRSSKLIKRNNSISAFNVSADGK-LLAVGTLEGDVLIIDSTKMQTNQIVAHLGLVTALTFSPDSRCLVSVSFDSRARLTVIKQKGEKRRVYL--WVAALLFVLVYVVLYYLMVAMGII................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 382
46 -57.000[T] KOG0279 G protein beta subunit-like protein  ali follow..  17  2.............................AEGLVLKGTMCAHTDMVTAIATPVDNSVIVTSSRDKSIILWKLTKEDKSY---VAQRRMTGHSHFVQDVVLSSDG-QFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKLWNTLGECKYTI-----SEADGHKEWVSCVRFSPNTLPTIVSASWDKTVKVWNLQNCKLRNT-LAGHSGYLNTVAVSPDGS-LCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAAT-ENSIRIWDLESKSVVEDLIGNKTKVIYCTSLNWSADGNTLFSGYTDGVIRVWGIGR......................................................................................................................................................................................................................................................................................................................................................................................................................................................... 325
47 -57.000[S] KOG0321 WD40 repeat-containing protein L2DTL  ali follow..  11  130PFCLGFANNESLLAVCTETALELFDSRFYDPSARRIHGWLAHNNAIFSVNFSKDDSLLATSSGDQTSKVFDLSTQQCITR-LGRRGVDGYHSHSVKQVNFCNDSPYNLVSCSRDGSIIFWDMRTHGITHENSGRDCSITSATWLPQSTVISSCSANSALKLWDLRTVHTVRPLPAATTTTSKRDFGVTNVCTSPDGER-IYAASRDSIIYEYSSRHLNSGKDPRLRISSFYVKLACSPDGATLACGGGKTSGVVVFDTTRNSAMLTGGHTKDVTAVDWSSEGQ-LASISDDGSVRVWNSSLHGSAANLRE--KNFSEIFYWGFSEK............................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 490
48 -56.900[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  12  401CLDLYLCPRAKRVKLNIDAYLIPKLPSPRD-PTVESMVYRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGRCIRT---------ETDEVVRCVAWCPNPKLSIIAVATGNRLLLVADEQEKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGAALIHQLSKRRSQIPFSKSKGL-------IQFVLFHPVKPCFFVAT--QHNIRIYDLVKQELVKK-LLTNSKWISGMSIHPKGDN-LLVSTYDKKMLWFDLSTKPYQTMRLHRNAVRSVAFHLRYPLFASGSDDQAVIVSHGMVYNDPLKKLQTHEDEFGVLDVNWHPVQPWVFSTGADSTIRLYT............................................................................................................................................................................................................................................................................................................................................................................................................................................................ 784
49 -56.700[T] KOG1354 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  13  1............MAGAGGGNDIQWCFSQVKGA---VDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSHSRGEYKSLEIEEKINKIRWLPQKNAQFLLSTNDKTIKLWKVEASPRRIFANAHTYHINSISINSDYETYLSAD-DLRINLWHLEITDRSFNIVDKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALNRSFFSEIISSISDVKFSHSGRYMMT--RDYLSVKIWDLNNRPVETYQVHEYDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEVDSLDFNKKILHTAWHPKENIIAVATTNN.................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 438
50 -56.600[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali follow..  16  109CRAGAFSCDGSLVATGSDASIKILDVERMQQGHPVIRTLYDHTDEVSYLEFHPKEHILASASRDGTVKLFDIAKPSVKKA-----HKVFTDCEPVLCLSFHPTGD-YVAIGTEHNVLRVYDVATTQCFVSAQQHKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGRCINTIAEAHGG-----AAICSLEFTRNGK-YLLSSGMDSLVYLWELCTSRPIQTYTGKQEHQTEAVFNHTED-YVLFPDEATTSLCSWNSRNGCRLTSLGHNGPVRYITHSPNGPAFLTCSDDFRARFWYRRANNQ................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 424
51 -56.400[R] KOG0645 WD40 repeat protein  ali follow..  17  7LWSVAAHPMLPLFATSSQDSVRIYNSNTYNLVHVIDG---FHTRSIRRVAWRPIERVLAVASFDSVVSINEKIDDDWECT-----AALEGHENEVKCIAWSCNGN-YLATCSRDKSVWIWEATEDDCLAVLQEHTQDVKVVTWHPTEDLLVSGSYDNSICFWRDDGDDWALT-----CQLQGHTNTVWALAFSPNGN-TLASADNDGNVFLWIKISSNQQTSLPHIHKGAVYTISWMNDAT--LCSAGGDGKIVVYQREKHDEQDHAHGVYEINSLEYLRDDR-LLSGGDDGECRVWSFK....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 322
52 -56.400[Z] KOG1523 Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC  ali follow..  11  11ITCHAWNRDRTQIALSPNNEVHIYKKNGSQ---VKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPTLV-----ILRINRAATFVKWSPLENK-FAVGSGARLISVCYFEAENSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKKASTPWGGSGTGGWVHGVSFSASGS-RLAWVSHDSTVSVADASKSV-QVSTLKTEFLPLLSVSFVSENS--VVAAGHDCCPMLFIYDDRGCLTFVSHQNSITQVSIKQDCRKFCTTGIDGAMTIWDFKTLESSIQGLR............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 368
53 -56.300[R] KOG2321 WD40 repeat protein  ali follow..  56SNRIKCTRDGKYAMATGKPHIKVFDFAEMS----LKFERHTDAENVQFEILSDDWTKSVHLQTDRTVDFHSQGGIHYST----------RIPKYGRDLKYHYPNCDLYLAAA-GDEVYRLNLEQGRFLNPLKSPTGGVNVIDINPMHQLLAFGTDAGSVEFWDPRDRSRVGILEIPSTPYSDNSRSVTALKYRNDGLN-VAIGLSDGATLLYDLRSSSPYMSKDQGYSMPIKSLHWMDSALTARVLSADSKIIKIWEKDTGKPFSSIEPTVELNDVCPIEGTGLILTANEGSPMHAFYIPSLNPAPRWCS--FLDNITEEMEENPA-------------------------------------------------------------------------------------PTIYDDYKFVTKKELLNLGLDHLVGTGVIRAYM-HGFFIDNNLYEKARLIANPFSYEE-------HRQKIVKERLEKQRASKIRSQNRPKVNAGLASRLSYQENKLRKKTGVTDGPSILEDERFKNVFTDKEFEVDEDTLEYKQLHPSRSEARGLTAAEESEEEKEHTKGIKFSSDEESLSDMEEENETFDALVDRRKTEQQVSNEKTPQETIRSTPSGMEMTFKVEKKKKSKPVNRDEDSTSGKKKQVTQGRRSASKNVFRNM................................................................................................................ 634
54 -55.900[Z] KOG0313 Microtubule binding protein YTM1 (contains WD40 repeats)  ali follow..  14  52..EFDFLIKGQFLRMPLDKHMEVENISSEEVTAPQPEQCMFHDDWISSIKGAEEWILTGSY--DKTSRIWSLEGKSIMTI--------VGHTDVVKDVAWVKKDSLLLLSASMDQTILLWEWNVEKALHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEMEESTNTLSGHMEAVSSVLWSDAEE--ICSASWDHTIRVWDVGSGSLKSTL--TGNKVFNCISYSPLCK-RLASGSTDRHIRLWDPRTKDSLSLTSHTGWVTSVKWSPTHQQLISGSLDNIVKLWDTRSCKAPLYDLA--AHEDKVLSVDWTDTGL-LLSGGADNKLYSYRYSPTTSHV.................................................................................................................................................................................................................................................................................................................................................................................................................................................... 421
55 -55.500[S] KOG1407 WD40 repeat protein  ali follow..  14  23VHSVAWNSNGTKLASGSDQTARIWNIEPHGHSKAKDLELKGHTDSVDQLCWDPKHSLVATASGDKSVRLWDARSGKCTQQ---------ELSGENINITYKPDG-THVAVGNRDDELTILDVRKFKPLHRR-KFNYEVNEIAWNMPGDFFFLTTGLGTVEVLSYPSLKPLDTLTAHTAG-------CYCIAIDPKGR-YFAVGSADSLVSLWDISDMLCLRT-FTKLEWPVRTISFNYSGE-YIASASEDLFIDIANVQTGRTVHQIPCRAAMNSVEWNPKYNLLAYAGDDKNPKYNTDEGVFR................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 308
56 -55.300[R] KOG1273 WD40 repeat protein  ali follow..  12  26IKCVAFNHRGSLLAAGCADGCVIWDFETRGIAKEIRDN--DCSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEVLAPPQRSKCPESNPPFSPAAACFNKCGD-LVYIGNSKGEILIVDYKSVRVLALVSSGAAPVKNIVFSRNGQYLLTNSHDRTIRIYENLLPAKNKMKTVGSKCLTLFREHWKAPCFSGDGEWVVGGSKGEHKIYIWDRAGH--LVKILEGPKEALIDLAWHPVHP-IIVSVSLAGLVYIWAKDYTENWSAFAFKELEENEEYVEREDEFDLIPETEKVKVLDVNEDEEVDID---TVEKDAFSDSDMSVEELRYLPAEPIPDTNDQQDNLVESIKLIEGQISASPASEEAGQNGHHASSPQAGKKDSNSVI................................................................................................................................................................................................................................................................................................................................................................................................................ 474
57 -55.200[R] KOG4497 Uncharacterized conserved protein WDR8, contains WD repeats  ali follow..  11  11SLLCKFSPDGKYLASCVQYRLVVRDVNTLQ-----ILQLYTCLDQIQHIEWSADSLFILCAMKRGLVQVWSLEQPEWHC-------KIDEGSAGLVASCWSPDGRHILNTTEFHLRITVWSLCTKS-VSYIKYPKACLQGITFTRDGRYMALAERRDCVSIFVCSDWQLLRHFDTDTQD-------LTGIEWAPNGCVLAVWDTCEYKILLYSLDGRLLSTYSAYEWSLGIKSVAWSPSSQ-FLAVGSYDGKVRILNHVTWKMITEFGHPAAINDLAFSPDSYFLATRNDNNAVWVWDIQKLR----LFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCM----SVQVPGEGDFAVLSLCWHLSGDSMALLSKDHFCLCFLETEAV......................................................................................................................................................................................................................................................................................................................................................................................................... 448
58 -55.200[S] KOG0294 WD40 repeat-containing protein  ali follow..  10  2.......PPEMEIIEATEELLLGFKLIKSPTDGELKQTFADSSYARSITSLAVQWPWVASGGTDGRIFVYDMRTRKQSQ-------IILSHAGRVNTLKFTPDLS-LLLSGSDDGHMIATRVGSWTKEYDWKAHAGAVTHVSCHPSSKLALSLGGDQVLNTWNLVNGCVAHKTN---KNKATLDFQTGCLSWSKQGDHFTLSG--PLVLEIWGIENAHVMRRI--EMPSKPICITWLDGN--ECLTGLDNGNIAWISLKDEDPTFILAHEVRVKAIAY--LNEFLATVSIAGQIKVWKIDMETRKLEEIARSFMDCRPTDLGLLDLRQFGNVRPVEQRTKVEEKPKAKVE-SDQSAKPAAPRGFVTIEYEQDKKLDAEKKKEKKKNKKDEESSE......................................................................................................................................................................................................................................................................................................................................................................................................... 382
59 -55.200[S] KOG4328 WD40 protein  ali follow..  14  217IFVVQFLPNVKMVAAGDLGNVGFWNLDCGNEDNDGIYLFTPHSAPVSSIVFQQNSSRVISSSYDGLIRLMDVEKSVFDLV---------STDEAIFSLSQRPNDEQSLYFGQDYGVFNVWDLRAGKSVFHWELHERRINSIDFNPQNPVMATSSTDGTACLWDLRSMGAKKPKT----STVNHSRAVHSAYFSPSGLS-LATTSLDNYIGVLSGANFENTCMIYHNNTSSKFKAVWGWDDS-YIYVGNLSKKIDVINPKLKRTVMELLQRAIPCRIHCHPNVGTLAGSTAGGQVYVWTTK....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 516
60 -55.100[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali follow..  16  13ITQIKYNREGDLLFTVAKDIVNVWYSVNGE----RLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLAL---------KTNSAVRTCGFDFGGNIIMFSTDKQCFVSFFDLDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQ-------INDIQLSRDMT-MFVTASKDNTAKLFDSTTLEHQKTF--RTERPVNSAALSPNYDHVVLGGGQEAEARFFHLAFEEEFGRVGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 323
61 -54.700[T] COG5170 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  13  1...........MDDIEDSLQWKFAQCFGDKGD----VEDITEADIISAVEFDHTGDYLATGDKGGRVVLFERNHSKQSHEPEFDYLKSLEIEEKINKIRWCKRTNAHFLLSTNDKTIKLWKLYEKNLKVVANAHAYHINSISVNSDAETYISAD-DLRINLWNLSISDHSFNIVDKPENMEELTEVITSAEFHPINCNHLMYSSSKGNIKLLDLRQSALSKSFFSEIISSISDVKFSQNGRYILSR--DYLTLKIWDVNKAPVKTIPLHDVDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLPGDRDPDNLDYNKKILHASWHPFEDSVAIAATNN.................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 456
62 -54.300[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  12  2...................KIKLIDSVVRS---KVAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDCEKGTQSRT-------VNSKKYGVDLIHFTHANNTAISSTKVDDTIRYLSLHDNKYLRYFPGHTKKVISLCISPVEDTFLSGSLDKTLRLWDLRSPNCQGLMHLSG---------RPIAAYDPEGL-IFAAGVNSESIKLYDLRSFDKTFKLNQEKECDWTGLKFSRDGK-TILISTNGSVIRLVDAFHGTPLQTFNNKGIPIEASFSPDSQFIFSGSTDGRVHIWNADTGNKVSVLNG--DHPGPVQCVQFNPKYMMLASACTNMAFWLPTSEEG........................................................................................................................................................................................................................................................................................................................................................................................................................................................ 316
63 -54.200[S] KOG0283 WD40 repeat-containing protein  ali follow..  407VWTIKFSQDAHYLASGGADVIHVWEVQECE----LMSMNEGSLTPIHPSLCDSSGNEITVVEKKKKGKGSSGRRHNVFSFSDKPVCSLKGHLDAILDLSWSKSQL--LLSSSMDKTVRLWDIETKTCLK-LFAHNDYVTCIQFSPDENYFLSGSLDAKIRIWSIQDRHVV--------EWSDLHEMVTAACYTPDGQG-ALIGSHKGICRAYDTEDCKLSQTNKSQAKRKITSFQFSPVNPSEVLVTSADSRIRILDGSEVIHKKGFRNTCSQLSASYSQDGKYIICASEDSQVYLWKNDFHRTRSTL-DVSAAVPWHGHVRGEPPPVQIHSKRHSKRISTSSQPSSTIS----SPTKEETSATGPTTSNRNKKSGLPPMPKKAATKSQIQPEE--EAGPELGSSESFRSSMNSSEQ---HSSRFGESPSINTSSRLSSWSWFDSGGHGPQTIQPTAWGMVIVTAT----HGEIRSYQNFGLPRRIGRQTTL....................................................................................................................................................................................................................................................................................................... 902
64 -54.100[R] COG2319 FOG: WD40 repeat  ali follow..  10  194TSLLSWSPKGD-LAIGLAENIYLWSKELGP-----TRVLEESIYDVSSVAYSYNGDILAVGRVDGTLQFWQDNERVPRIS--------IHHPGDIGVLAWKPVLENRLLVGKGNGNIFVYDIIAVLVATITNAHDEQVCGLTWNHDGSQFASGGNDNRVCLFKGSDLRQPLYVWQQNAA-------VKALSFCPWQRSLLATGAHDKHIRFYNCFNGKKIDEL--YCGAQITSIHWSPKYREFSVTFGVQHRFAVYSWPQLECLVSVVPDIRCVHSVLTSQTDSIIIASSNETIKFFDLSEESSWHNSRVLTWHGIFDSQILEMLEG---IDGKIDSH................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 533
65 -53.800[R] KOG0288 WD40 repeat protein TipD  ali follow..  13  191GLETLARQQVDGIVRRNEDTDHFVESTIPS---TCANRIHAHEGGCGSIVFEYNSGTLFTGGQDRAVKMWDTNSGTLIK-------SLYGSLGNILDMAVTHDNK-SVIAATSSNNLFVWDVSSGRVRHTLTGHTDKVCAVDVSKFSRHVVSAAYDRTIKLWDLHKGYCTNTV--------LFTSNCNAICLSIDGL-TVFSGHMDGNLRLWDIQTGKLLSE-VAGHSSAVTSVSLSRNGNR-ILTSGRDNVHNVFDTRTLEICGTLRLASNWSRSCISPDDDYVAAGSADGSVHVWSLSKGNIVSIL---KEQTSPILCCSWSGIGKPLASADKNGYVCTWT............................................................................................................................................................................................................................................................................................................................................................................................................................................................ 515
66 -53.500[R] KOG2444 WD40 repeat protein  ali follow..  9PLCMKSNKDGSRLVVGFDGSIRFYDTQQHEEE-FQEIWKFQTKSSIRGVDLDEHKKRVYAVTKNRSLCVFDIDTGKRVR------CILKCHRSVPTAICTLPPKSQQLATADESGEVKTWNLDPNANIRKWQEQDEDINDLKVDVKSNLLATSS-DGTLGAYDLRKAKLKMRSELMHSEL---------YSVCGTNRS-VYVGGEDGYVEVFNLNEGNLLERVESGFEMGVNGIVELRSG-LLGLTSQGSNRMRLLNVQPSKRLGYAGDDDGIDAITISTDKSTVTMISMSCTIKKWDMGPIIDEIPI----LRAQDAKSKKMRKTEGFFDGLVGPKNDSDSDDDDEPKSKKRRND-EDSDEEIDEEEQEEDDEEEEEDS....................................................................................................................................................................................................................................................................................................................................................................................................................... 382
67 -53.500[R] KOG1188 WD40 repeat protein  ali follow..  10  31TSKTVQAGKENLVAVLCSNSIRIYDKERLN----VLREFSGYPGLLNGVRFANSCDSVYSACTDGTVKCWDARVAREKPV----QLFKGYPSNIFISFDINCNDHIICAGTDDDALLVFWDARMDSLGAYSETHSDDVTQVRFHPSNNMVVSGSSDGLVNVFDINIDNEEDALV----TTCNSISSVSCIGWSGKGYKQIYCMTHDEGFYWWDLNHLDTDEPVTRLNIQDVRGGLYHEKTDTHVIGGTNKGRIHLMNCSMSGLTHVTGHAATVRSFCWNVQDDSLLTGGEDAQLLLWKPGAIEKTFTK---KESMKIASSVHQRVRVHSNDSYKRRKKQ................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 387
68 -53.300[S] KOG0270 WD40 repeat-containing protein  ali follow..  10  135KQELQVYPSDNLVLAARTEYLDIYVYDDGAGFHSSDIPVEEGDDYKVGSNSEEAANYAAIGTFDPQIEIWNLD-SKKKKKKSKTGHITTHHTDAVLSMAHNKYFRSVLASTSADHTVKLWDLNSGNAARSLAHSNKNVSSSEWHMNGSILLTGGYDSRVALTDVRISDESQMSKYWS---AMAGEEIETVTFASEN--IILCGTDSGNVYSFDIRNNENPVWTLKAHDAGISTLCSNKFIPGMMSTGAGEKTVKLWKFPLDDVLSRDFDVGNVLTSSFAPDIETMVIGGVNKVLKLWDVFTNRSVRKSFK--SELENVQARAKEEAQKIGKSSRIARKYTSNDNPDTVITI----DDQGEDEEEREGGDEHDDMA............................................................................................................................................................................................................................................................................................................................................................................................................................ 576
69 -52.900[A] KOG0647 mRNA export protein (contains WD40 repeats)  ali follow..  11  2...SFFNRSNTTSALGTSTMANEKDLAND------IVINSPAEDSISDIAFSPQQDFMFSASSDGKVRIWDVQNGVPQG------RAQHESSSPVLCTRWSNDGTK-VASGGCDNALKLYDIASGQ-TQQIGMHSAPIKVLRFPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPER--------VYSMDNKQSLL-VVATAERHIAIINLANPTTIFKAT-TSPLKWQTRCVACYNEADG-YAIGSVEGRCSIRNPNRAPGSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQRHR---LKGYPTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGNRPDYPNVI------RLHATTDEEVKEKKKR............................................................................................................................................................................................................................................................................................................................................................................................................................ 365
70 -51.800[S] KOG0281 Beta-TrCP (transducin repeats containing)/Slimb proteins  ali follow..  15  210...YCLQYDDEKIISGLRDSIKIWDKTSLE----CLKVLTGHTGSVLCLQY--DERVIVTGSSDSTVRVWDVNTGEVLNT-------LIHHNEAVLHLRFSNGL---MVTCSKDRSIAVWDMASATLRRVLVGHRAAVNVVDF--DDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRG-------IACLQYR---DRLVVSGSSDNTIRLWDIECGA-CLRVLEGHEELVRCIRFDN---KRIVSGAYDGKIKVWDLQAALLRTLVEHSGRVFRLQF--DEFQIISSSHDDTILIWDFLNVP---PSAQNETRSPSRTYTYIS............................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 507
71 -51.700[BL] KOG1009 Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats)  ali follow..  14  16VYSLDFQHGTARLASAGVDNVRIWKVEKGPDGKEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLWKVNDNKEPEQIAFQDEDEAGHLEDVYDICWATDG-NLMASASVDNTAIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQYVATLSCDRVLRVYSIQKKRVAFNVSKMLSGIDSMKSFFRRLSFTPDGS-LLLTPAGCVESGENVMNTTKRPIAHLPCPGKATLAVRCCPVYRLVFAVASEDS-VLLYDTQQSFPFGYVSHYHTLSDISWSSDGAFLAISSTDGYCSFVTFEKDELGIPL-----KEKPVLNMRTPDTAKKTKSQTHRGSSPGPRPVEGTPA----SRTQDPSSPGTTPPQARQAPAPTVIRDPPSI---TPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAW-----SKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP............................................................................................................................................................................................................................................................................................... 559
72 -51.700[B] KOG0264 Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1  ali follow..  14  44.LTVQWLPEVTKPEGKDALHWLVLGTHTSDEQNHLVEIKINHEGEVNRARYMPQNPIIATKTPSSDVLVFDYTKHPAKPDPSGECNRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGDAKAIFTGHSAVVEDVAWHLHESLFGSVADDQKLMIWDTRSNTTSKPSH----LVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKELLFIHGGHTAKISDFSWNPEPWVICSVSEDNIMQIWQMAEN-------IYNDEESDVTTSELEGQGS........................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 425
73 -51.300[U] KOG1332 Vesicle coat complex COPII, subunit SEC13  ali follow..  12  5..................................INTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILI-----ADLRGHEGPVWQVAWAHPMGNILASCSYDRKVIIWREENGEKSHEHAGHDSSVNSVCWAPHGLILACGSSDGAISLLTYTGEGQWEVKK----INNAHTIGCNAVSWAPAVVKRFASGGCDNLIKLWKEEEDGKEEQKLEAHSDWVRDVAWAPSPTSTIASCSQDGRVFIWTCDDASPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSSVTEGQQNE........................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 321
74 -51.100[A] KOG0272 U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats)  ali follow..  16  264VSSAAFSEDSSLLLTSSSGLCKLWSVPDCE----LKQTLRGHASYVGGVALRPGVKAMASGGHDGAVKLWGFNNEESIAD-------TGHMPHRVSKVAFHPSG-RFLATACYDSSWRLWDLEQKTEVLHQEGHAKPVHCLSYHSDGSVLVTGGLDAFGRVWDLRTGRCIMFLEGHLGA-------VFGVDFSPNGF-HIATGSQDNTCKIWDLRRRQPVYT-IPAHTNLISDVKYQQECGSFLVTCSYDSTTKIWSNKTWQPLKTLGHDNKVISVDIAPNSQYIATTSFDRTFKLWSPDS...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 553
75 -50.900[D] KOG1036 Mitotic spindle checkpoint protein BUB3, WD repeat superfamily  ali follow..  14  20ISNLRFSNNSDHLLVSSDKRVRLYDVSTNSLKGEF-----LHGGAVLDCCFHDDFSGFSVGA-DYKVRRIVFNVGKEDILGTHDKAFDFSILFFYTLCLFCDVTGQ-VITGSWDKTVKCWDPRGASGPERTQTYLQPERVYSMSLVGHRLVVATAGRHVNIYDLRNMSQPEQ-----RRESSLKYQTRCVRCYPNGTG-YALSSVEGRVAMEFFDLSERKSEAGRDIVYPVNSIAFHPIYG-TFATGGCDGFVNIWDGNNKKRLYQYKYPTSISALSFSRDGQLLAVASSYTAIFVRSVNEIE.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 341

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.