current user: public

If you have questions about the server, please let us know.

Query: [Y] KOG4714 Nucleoporin, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .
# Score Template Links and tools%idFirst MSIANVSTHYISEKVSQVRWLPEELQQSERFVTGSWDMDQNFVRLWRLQSNQYVTATDSEVDQIPRCMDKVRMEDDVTAMEFVDKDTLAVSCADGHLSVFNVHRAVEEDQMQRTSRSGRLHCFQRSQEPAPCTDLSVYGTDIATAGEDGCVSIVSVENVRQVKRQIEADSMALFSICYISQQELVTANRMGVIRMLDARVATEAQPKTTFMVASQDDKSNFVSSLAKHPMQQHILLCGSEEGSITVWDMRNLSYPASYLSAHKSPINEIGFHQKDPSKLFTAAEGGEVWMWSENKVLGCDYNKDGHSPWLSGDRVRSLVDVEGVLSNVRKSINSFDVHGSRLVCGGDTEAVYLVDNIVLast
1 -97.800[Y] KOG4714 Nucleoporin  ali  100  1MSIANVSTHYISEKVSQVRWLPEELQQSERFVTGSWDMDQNFVRLWRLQSNQYVTATDSEVDQIPRCMDKVRMEDDVTAMEFVDKDTLAVSCADGHLSVFNVHRAVEEDQMQRTSRSGRLHCFQRSQEPAPCTDLSVYGTDIATAGEDGCVSIVSVENVRQVKRQIEADSMALFSICYISQQELVTANRMGVIRMLDARVATEAQPKTTFMVASQDDKSNFVSSLAKHPMQQHILLCGSEEGSITVWDMRNLSYPASYLSAHKSPINEIGFHQKDPSKLFTAAEGGEVWMWSENKVLGCDYNKDGHSPWLSGDRVRSLVDVEGVLSNVRKSINSFDVHGSRLVCGGDTEAVYLVDNIV 358
2 -54.900[S] KOG0290 Conserved WD40 repeat-containing protein AN11  ali follow..  12  17.KRSEIYTYEAPWHIYAMNWSVRRDKKYRLAITSLLEQYPNRVEIVQLDESNG--------EIRSDPNLSFEHPYPPTKTIFIPPDLLATSSDFLRLWRIADDH-----SRVELKSCLNSNKNSEFCGPLTSFDWNEEPRRIGTSSTDTTCTIWDIEREAVDTQL-IAHDKEVFDIAWGGVGVFASVSADGSVRVFDLRDKEHST-----IIYESSEPDTPLVRLGWNKQDPRYMATIMDSAKVVVLDIRFPALPVVELQRHQASVNAIAWAPHSSCHICTAGDDSQALIWDISSMGQHVEGGLDPILAYTAGAEIEQL--------------QWSSSQPDWVAIAFSTKLQILR... 345
3 -53.700[U] KOG0277 Peroxisomal targeting signal type 2 receptor  ali follow..  13  11......MLRTPGRHGYAAEFSPY---LPGRLACATAQHGCGTLLILDPDEAGL------------RLFRSFDWNDGLFDVTWSENNVLITCSGDGSLQLWDTAKAA-----------GPLQVYKEHAQEVYSVDWSQTRGLVVSGSWDQTVKLWDPTVGKSLCTFRGHESIIYSTIWSPIPGCFASASGDQTLRIWDVKAAG--------VRIVIPAHQAEILSCDWCKYNENLLVTGAVDCSLRGWDLRNVRQPVFELLGHTYAIRRVKFSPFHASVLASCSYDFTVRFWNFSKPDSLLETVEHHTEFTCGLDFSLQ-------------------SPTQVADCSWDETIKIYDPAC 318
4 -53.200[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  11  458......TLRSHFDGIRALAFHPI----EPVLITASED---HTLKMWNLQKTAPAKKSTSLDVEPIYTFR--AHKGPVLCVVMSSNGQCYSGGTDGLIQGWNTTNP-NIDPYDSYDPSVLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWNTTEVAPALSVKELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRILTLES-NVDTTANSSCQINRVISHPTLS-ISITAHEDRHIKFYDNNTGK-LIHSMVAHLEAVTSLAVDP-NGLYLMSGSHDCSIRLWNLESKTCIQ-------------------EFTAHRKKFEESIHDFHPSKCYIASAGADALAKVF.... 779
5 -52.800[B] KOG0264 Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1  ali follow..  15  32...DLVMTHALQWPSLTVQWLPEKDYALHWLVLGTHSDEQNHLVVARVHIPNDDAQFDASHTGKIECEIKINHEGEVNRARYMPQNIIATKTPSSDVLVFDYTKHPAKPD--PSGECNPDLRLRGHQKEGYGLSWNSNLSHLLSASDDHTVCLWDINAGPDAKAIFTGHSAVVEDVAWHHESLFGSVADDQKLMIWDTRSNTTSKP-----SHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAED---------GPPELLFIHGGHTAKISDFS-EPWVICSVSEDNIMQIWQ... 402
6 -49.700[T] KOG4378 Nuclear protein COP1  ali follow..  13  1..............MMSNLVEPSW----RLLAASG----GDTVKLFDVSADSGDPCV---------LSYTPSPGCAVNSVKWNHTNLVASTGEDKKISLWRKNGQSLGTVPVTGKDGG-----DSAEECLSAISFSKKGSRICSGGTGQIVKIWDLQRKLCIKKLKGHTSTITGVMYNCKDEHLASVSVGGDLIVHNLASGARATELKDPN-GQVVQFVHVLRLLDYSRSSRHLLVTAGDDGTVHLWDTTGRSPKMSWLKQHSAPTAGVCFSPSNEKIIASVGMDKKLYTYDSGSRRS----------------------SSCIAYEAPFSSLAFGDNGYILVAGTSNGRVVFYD... 298
7 -48.700[Z] KOG0313 Microtubule binding protein YTM1 (contains WD40 repeats)  ali follow..  16  96......QCMFHDDWISSIKGAEEW------ILTGSYD---KTSRIWSLEGK--------------SIMTIVGHTDVVKDVAWVKKDLLLSASMDQTILLWEWNVERN--------KVKALHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEMEESHMEAVSSVLWSDAEEICSASWDHTIRVWDVGSGSLKSTL---------TGNKVFNCISYSPLCK-RLASGSTDRHIRLWDPRTKDLVSLSLTSHTGWVTSVKWSPTHEQQLISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTD---------------------TGLLLSGGADNKLYSYRYSP 416
8 -48.400[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  14  26......RITGHVARINDVILLSKD----EGVWTASDD---RSVRLYLKRDNDQFWPSIHH-----------FMPVAPTSLYYSEETYLLVGLINGNVYEFSVADD--------FNSMTESRKWTCHAGPISGLGFALSSELIFSCSRDKSIVWHCSENSNKMGSYLLENSCTAMV---IDLPFVFVGDHGGHVTVLRIVDNQPN------LVSKLSAHTNAITSLTWDGNKK-VLYSGSSDHLIIMWDIGGGRGEAYELNGHNGKVTTLCAAP-AAKRLFSADEHGKLMCWDMNCGSAVCGSCCDNWTTYPPMGYETKIRILAIPHEIHTGITALQETLGLLVTSGQNRVIMIWDVRS 406
9 -48.300[R] KOG0302 Ribosome Assembly protein  ali follow..  12  97.....LHNIQVKWPFLSFDILQDSLGEERYLVGGSQALDSNDNEL-QHDENDDASDNSDVEEDPILEHKSISTKGACNRVRSARESLLASFHETGKVHIWDIAPHLRSLDSPGVMVSRKLYTVNRHKTEGYALDWSPFEYSLLSGDNANEIFLTKYSNGGWQTDSFLSHTAAVEDLQWSEKNVFSSCSCDGTFRIWDVRNKQKTSA-----LTVNAHPGVDVNVLSWNTRVPNLLATGADNGVWSVWDLRSVATPVASFKWHRAPIYSIEWHPNEDSVIGVVGADNQISLWDLSVELDEEEQDSRAAEGLQDVP-----PQLMFIHMGQQEIKHWHRQIPGTIVSTAMTGINVFKTIT 479
10 -48.000[S] KOG4328 WD40 protein  ali follow..  13  213........................................................................VPGRIFVVQFLPCEMVAAGDKLGNVGFWNLDCGNEEDN-------DGIYLFTPHSAPVSSIVFQQNSSRVISSSYDGLIRLMDVEKSVFDLVYSTDEAIFSLSQRPNDEQSLYFGQDYGVFNVWDLRAGKS--------VFHWELHERRINSIDFNPQNPHVMATSSTDGTACLWDLRSKKPKTLSTVNHSRAVHSAYFSP-SGLSLATTSLDNYIGVLSGANFENTCMIYHNNTSRWISK--------------------VWGWDDSYIYVGNLSKKIDVINPKL 472
11 -47.900[D] KOG1036 Mitotic spindle checkpoint protein BUB3, WD repeat superfamily  ali follow..  14  17...........SDGISNLRFSNN----SDHLLVSSWD---KRVRLYDVSTNS--------------LKGEFLHGGAVLDCCFHDDFSGFSVGADYKVRRIVFNVGKEDILGTHDKAVRCVEFDFSILFFYTLCLFCDVTGQVITGSWDKTVKCWDPRGASGPERTQTYLQPERVYSMSLVGHRLVVATAGRHVNIYDLRNMSQP------EQRRESSLKYQTRCVRCYPNGTG-YALSSVEGRVAMEFFDLSERKSEAGRDIVYPVNSIAFHP-IYGTFATGGCDGFVNIWDGNNKKRL-YQYSKYPTSISAL--------------------SFSRDGQLLAVASSYTAIFVRSVNE 339
12 -47.500[E] KOG0280 Uncharacterized conserved protein  ali follow..  13  5.GIIPKSTDYTDWPADVCKYSQVF---EDVLVVGTYKLRHGKLVLYDTKEDVLSPH---------------------------DASVLAVAHSTGHVSFYRHQFRAELMFLRG-------IKVADSSVLMLSLDFSDSGKELAVSMSNGSVLIIDIDSGVIKNKWKEHDYEATCHYSRQDNNLLYSGGDDAALVCYDQRIPNSC------IWRDIQVHHSGVVSILSRAPFGPYIATGEYGDFMHTLDTRNIGKPLFSAN-LGGGVWRLEHMETTENKVLGILMHRGAQVLRISNDFSSIDASKRIFKEHESMCYG-----------------DWRHTDGLLATCSYDKRVCLWEDI. 310
13 -47.100[Z] KOG1523 Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC  ali follow..  11  3......LHQFLLEPITCHAWNRDR----TQIALSPNN---HEVHIYKKNGSQWV-----------KAHELKEHNGHITGIDWAPKSRIVTCGADRNAYVWSQKDG----------VWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFEAENSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEKMPFGQLMSEFGGSGTGGWVHGVSFSASGS-RLAWVSHDSTVSVADASKSVQ-VSTLKTEFLPLLSVSFVSE--NSVVAAGHDCCPMLFIYDDRGCLTFVSKLDIPKQSIQRNMSAMERFRLETLHQNSITQVKQDCRKFCTTGIDGAMTIWDFKT 359
14 -47.100[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  14  61......SLDGHRDGVNCLAKHPEKL---ATVLSGACD---GEVRIWNLTQRNCIRTIQ-------------AHEGFVRGICTRFCGTFFTVGDDKTVKQWKMDGPGYG---------DEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPIETLLGSCASDRNIVLYDMRQATPLKKV---------ILDMRTNTICWNPMEAFIFTAANEDYNLYTFDMRALDTPVMVHMDHVSAVLDVDYSP-TGKEFVSASFDKSIRIFPVDKSRSREVYHTKRMQHVICV--------------------KWTSDSKYIMCGSDEMNIRLWKANA 356
15 -47.100[S] KOG0293 WD40 repeat-containing protein  ali follow..  11  269......ILESHTDEVWFLQFSHNG----KYLASSSKD---QTAIIWEISADGHISLKH----------TLVGHHKPVIAILWSPDDRVLTCGAEEVIRRWDVDSG------------DCVHMYEKGGISPISCGWYPDGQGIIAGMTDRSICMWDLDGREKECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLFDREATVE----------RLIEEEDMITSFSLSNDNK-YILVNLLNQEIRLWNIEGDPKIVSRYKGHKRSIRSCFGGY-KQAFIASGSEDSQVYIWHRSTGK-LIVELPGHAGAVNCVSWSPT-------------------NLHMLASASDDGTIRIWGLDR 563
16 -47.000[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  11  18......IFRENTDKINAIDFAPNG----EHLISCSED---DQIVIYDCEKGTQSRTVN-------------SKKYGVDLIHFTHANIHSSTKVDDTIRYLSLHDN------------KYLRYFPGHTKKVISLCISPVEDTFLSGSLDKTLRLWDLRSPNCQGLMHLSGRPIAA--YDPEGLIFAAGVNSESIKLYDLRSFDKGPFVT---FKLNQEKECDWTGLKFSRDGK-TILISTNGSVIRLVDAFHGTQTFTGYPNNKGIPIEASFSP-DSQFIFSGSTDGRVHIWNADTGNKVSVLNGDHPGPVQCV--------------------QFNPKYMMLASACTNMAFWLPTSEE 315
17 -46.800[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  13  319......TFHHTNNNMNCAEFSPDS----TMIACGFQE---SYIRLWSIKADKKSLPKSTSVEDSDGSVRLLSHSGPVYGTTFSPDNKLLSCSEDASARLWSVDT------------KTALVAYKGHTGPVWDVAFGPFGHYFATASHDQTAQLWSCDHIYPLRVFAGHLSDVDCVTFHPNSAYVLTGSSDKTCRLWDVHRGH--------SVRVFNGHTQPVTAVAIAPDGH-TMASADSEGLIHLWDIGTGR-RIKTMRGHRGNIYSLSFSR-ESTVLVSGGSDCTVRAWDVFKTNYNVTPFSAKTSTFNEVNWSTSPDQMVALYTKQTPIFNFTRRNLCLAISVS........... 643
18 -46.800[R] KOG0322 G-protein beta subunit-like protein GNB1L, contains WD repeats  ali follow..  12  1MAVLPSLRSPDMGAVNSLCFQESD-----RLLAGTIK---GSVFLWDLQTNRSALHFE-------------VGSDPITSLHHTPDR-LVTQEKGGTITMFSIGGSSYVKERSI-----PGNHLGFCRSALHTNTSKTNEQLLFYPCEESSIGVLHVTDAAAPTQILVPDDTCFKPFECASQLFLLAGYESGHFLTWDISSSV---------ILDVMELAQDATSVDYDPVTNR-GIVGGPTDKLISFSYQRSSQLGSELCIKNPGVNGVRIRP-DQKVFASAGWDGRIRIFSWKSLRPLAVLTQHKNGGVMDLAFSSQ--------------QVAMWHAPIMAAAGMDGQISLWDLYN 323
19 -46.400[R] KOG0645 WD40 repeat protein  ali follow..  16  1........SGHTGRLWSVAAHPML----PLFATSSQD---KSVRIYNSNTYNLVHVIDG------------FHTRSIRRVAWRPIEVLAVASFDSVVSINEKIDD----------DWECTAALEGHENEVKCIAWSCNGNYLATCSRDKSVWIWEATEDDELAVLQEHTQDVKVVTWHPTEDLLVSGSYDNSICFWRDDGDDWA------LTCQLQGHTNTVWALAFSPNGN-TLASADNDGNVFLWIKISSNEQTSLPHIHKGAVYTISWMND--ATLCSAGGDGKIVVYQREKHDEALWH----------------VAYEQDHAHGVYEINSLEYLRDRLLSGGDDGECRVWS... 320
20 -46.300[U] KOG1332 Vesicle coat complex COPII, subunit SEC13  ali follow..  12  2VSVINTVDTSHEDMIHDAQMDYYG----TRLATCSSD---RSVKIFDVRNGGQI-----------LIADLRGHEGPVWQVAWAHPMILASCSYDRKVIIWREENG----------TWEKSHEHAGHDSSVNSVCWAPHGLILACGSSDGAISLLTYTGEGEVKKINNAHTIGCNAVSWAPAKRFASGGCDNLIKLWKEEEDGQ------KEEQKLEAHSDWVRDVAWAPSIGSTIASCSQDGRVFIWTCDDASSSPKLLHKFNDVVWHVSWSI-TANILAVSGGDNKVTLWKESVDGQ............................................................ 296
21 -46.200[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  15  20.....LLDEDEPAVVSSVRISPK----KPYHVATTSS---VRLTLYDTVVCEPLNLFS-------------RFKKGVCSIDFRHDGRLAIGGDEGKVRIFDVEKTTGS-------SKVALRVMQASQSTVKSVHFSPRGDTVFSMADDGKIKQYRVADTAYGVNAVHEDAIRCGAVSSINDHIVLTGGYDHKVRLWDIRSKEKSLEL---------DCEHPVESVLFLPGEQLIATAA--GPIVKIWDTTTGRQ-LTALQAHYKTVTSLRLAT-NSTCLLSAGIDRRVNAFRTTNYSL----------------------INSWSMPSPVLDIDVSRDDQTMAIGMGNLLALYRRAEI 318
22 -46.200[S] KOG0270 WD40 repeat-containing protein  ali follow..  127......NQEDSQEEKQELQVYPS----DNLVLAARTEDDVSYLDIYVYDDGAGFHSSDIPVKKSKTGHITTHHTDAVLSMAHNKRSVLASTSADHTVKLWDLNSGNAARSLASI----------HSNKNVSSSEWHMNGSILLTGGYDSRVALTDVRISDESQMSSAMAGEEIETVTFASENIILCGTDSGNVYSFDIRNNENRKP-----VWTLKAHDAGISTLCSNKFIPGMMSTGAGEKTVKLWKFPLDDSMVLSRDFDVGNVLTSSFAPDIEVTMVIGGVNKVLKLWDVFTNRSVRKSFKSELENVQAR--------------------AKEEAQKIGKSSRIARKYTSNDNPD 551
23 -46.100[R] KOG1188 WD40 repeat protein  ali follow..  15  39...................................................................................KENLVAVLCSNGSIRIYDKERL------------NVLREFSGYPGLLNGVRFANSCDSVYSACTDGTVKCWDARVAKPVQLFKGYPSNIFISFDINCNDHIICAGTDALLVFWDARMNSQNLSTTKDSLGASETHSDDVTQVRFHPSNPNMVVSGSSDGLVNVFDINIDNEALVTTCNSISSVSCIGWSGKGYKQIYCMTHDEGFYWWDLNHLDTVIGGTNKGRIHLMNCSMSGLTHVTSLQGGHAATVRSWNVQDDSLLTGGEDAQLLLWKPGA 352
24 -46.000[T] COG5170 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  10  29...........ADIISAVEFDHTG----DYLATGDKG---GRVVLFERNHSKKGCEYKFFTEPEFDYLKSLEIEEKINKIRWCKRTHFLLSTNDKTIKLWKLYEKNLKVVAENIAAYPRRVYANAHAYHINSISVNSDAETYISAD-DLRINLWNLSISDHSPENMEELTEVITSAEFHNCNHLMYSSSKGNIKLLDLRQSALCDQEDQDSKSFFSEIISSISDVKFSQNGRYILS--RDYLTLKIWDVNMEKAPVKTIPLHDVDKFECTFSG-DDKHVLSGSYSNNFGIYPTDSSLPGDRGQIVLQADKAAAMGSASVGLDPDNLDYNKKILSWHPFEDSVAIAATNN-LFVFSKL. 463
25 -45.900[R] KOG0289 mRNA splicing factor  ali follow..  11  133......TLKPQAGLIVPQAVPSSQ----PSVVGAGEP---MDLGELVGMTPEIIQKLQDKATVLTTERKKSASIPGILALDLCPSDKILTGGADKNVVVFDKSSE------------QILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKV------TDETSGCSLTCAQFHPDGL-IFGTGTMDSQIKIWDLKERTN-VANFPGHSGPITSIAFSE-NGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALFTEHSGLTTGFGHHAKFIASTGMDRSLKFYS... 503
26 -45.700[R] KOG1334 WD40 repeat protein  ali follow..  13  272......LLGSHAGSVSTIHFNQRG----TRLASSGDD---LRVIVWDWVRQKPVLNFES------------GHDINVIQAKFFPNCTLAMCGHDGQVRVAELINASYC---------ENTKRVAKHRGPAHELALEPDSPYFLTSGEDAVVFTIDLRQDRPASTRENDKKVGLYTISMNPIYQFAVGGHDQFVRIYDQRRIDKKENNGVLHHLVYCDFPTNITCVVYSHDGTELVVSGSDCGHVFFWEKSSSQIIQFMEGDRGDIVNCLEPHP-YLPVLATSGLDQHVRIWTPTAKT--ATELTGLKDVIKK--------------------NKQERDEDNLNYTDSFDNRMLRF... 631
27 -45.500[S] KOG1407 WD40 repeat protein  ali follow..  13  15......EYQGHKKKVHSVAWNSNG----TKLASGSVD---QTARIWNIEPHGHSKA---------KDLELKGHTDSVDQLCWDPKHLVATASGDKSVRLWDARSGKCTQQV-------------ELSGENINITYKPDGTHVAVGNRDDELTILDVRKFKPLHRR-KFNYEVNEIAWNMPGDFFFLTTGLGTVEVLSYPSLK--------PLDTLTAHTAGCYCIAIDPKGR-YFAVGSADSLVSLWDISD-MLCLRTFTKLEWPVRTISFNY-SGEYIASASEDLFIDIANVQTGR----------------------TVHQIPCRAAMNSVEWNPKYNLLAYAGDDKNPKYNTD.. 303
28 -45.000[A] KOG0299 U3 snoRNP-associated protein (contains WD40 repeats)  ali follow..  136......LRGRHMRPLVGVVAYENF------VYSADKS---GLIQKWEALQEKDTENRENDDHEIGKAIKLNDHVKEITCLAISNDGRIVTGGLDHRIVIRDSVTL------------EPQHCWKHHRDAVMGLAMRRGTNEMFSCSADRSIKVWSLDQMSYIETLFGHQDVIFGVDALARERCVSVGGRDRTSRLWKIVEESQLVRSGGTSMKATAGYMEGSVDCVAMIDEDH-FVTGSDNGVIALWSVQRKKPDPVTIPPQPRWITSLAAIP-YSNLFASGSWDGNIRLWKIAEGLRSFEPLTIAT-----------------PLSVYGCINSLSLSLQVFAACGRETRVGRWKTLR 497
29 -44.900[B] KOG0273 Beta-transducin family (WD-40 repeat) protein  ali follow..  16  174......VLRGHESEVFICAWNPVS----DLLASGSGD---STARIWNLNENSNGGSTQLVLRHCIREGGHDPSNKDVTSLDWNSDGTLAMGSYDGFARIWTENG-------------NLASTLGQHKGPIFALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQQF-PFHSAPALDVDWQNNMTFASCSTDMCIHVCRLGCDH--------PVKTFQGHTNEVNAIKWDPSGM-LLASCSDDMTLKIWSMKQDA-CVHDLQAHSKEIYTIKWSPTSSIMLASASFDSTVRLWDVEQG-----------------------VCTHTLMKHQEPVYSFSPDGKYLASGSFDKYVHIWNTQS 483
30 -44.400[S] KOG0282 mRNA splicing factor  ali follow..  12  283......VWSGHTKGVSAVRLFPLS---GHLLLSCSMD---CKIKLWEVYGERRC------------LRTFIGHSKAVRDICFNTAGTFLSAAYDRYLKLWDTETGQCISRFTDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLPNGKWLACQSMDNQILIFGAQNRFRLNKKKIF---KGHMVAGYACQVDFSPDMS-YVISGDGNGKLNIWDWKTTK-LYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD.................................................................. 579
31 -44.300[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali follow..  12  1..MKPILLQGHERSITQIKYNREG----DLLFTVAKD---PIVNVWYSVNGERLGTYM-------------GHTGAVWCVDADWDTKVLTGSADNSCRLWDCETGKQLALLKQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTF---------RTERPVNSAALSPNYDHVVLGGGQEAEARFFHLAFEEE-FGRVKGHFGPINSVAFHP-DGKSYSSGGEDGYVRIHYFDPQY............................................................. 318
32 -44.000[T] KOG1354 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  11  20...AVDDDVAEADIISTVEFNHSG----ELLATGDKG---GRVVIFQQEQENKIQSHSRGEEPEFDYLKSLEIEEKINKIRWLPQKQFLLSTNDKTIKLWKISERDKRPEGYNVEASPRRIFANAHTYHINSISINSDYETYLSAD-DLRINLWHLEITDRSFNIMEELTEVITAAEFHPCNTFVYSSSKGTIRLCDMRASALEEPEDPSNRSFFSEIISSISDVKFSHSGRYMMT--RDYLSVKIWDLNMENRPVETYQVHEYDKFECCWNG-SDSVVMTGSYNNFFRMFDRNTKRDIRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNN-LYIFQDKV 446
33 -43.900[S] KOG0296 Angio-associated migratory cell protein (contains WD40 repeats)  ali follow..  12  58........FEHKDSVFSVSINPVH---SNLCASGGGD---DLGYIWDITTGEQICQLT-------------GHKDSIVAIDWSFDGTIATGGMDSQVRLWKSSTG------------FEFITAFETVDEIVWLSWHPKGLFLAAGCNDGSIWMWSLPSGKVVQVMYGHTAPVNAGKFIPPGKRLATVDDSGTLIVWNPATGAPESSDDHRFDPGNEETAAGWTSFDCNAEGN-VLFLGGSSGKVKVVNINSSH-ILASLEAQTESVEAIALCT-ALPICACASVDGTVALYDSASLKFRKSKFLPNTPYLLTACADCVIRKWDVRSGQLLGE-AITPDGKRVVTGSDDTELLVFD... 396
34 -43.900[R] KOG0286 G-protein beta subunit  ali follow..  13  50......TLRGHLAKIYAMHWATDS----KLLVSASQD---GKLIVWDSYTTNKVHAIP-------------LRSSWVMTCAYAPSGNVACGGLDNMCSIYNLKSREGNVKV--------SRELSAHTGYLSCCRFLDDNN-IVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGT--------CRQTFTGHESDINAICFFPNGE-AICTGSDDASCRLFDLRADQELICF-ESIICGITSVAFSL-SGRLLFAGYDDFNCNVWDSMKSERV-GILSGHDNRVSCL--------------------GVTADGMAVATGSWDSFLKIWN... 340
35 -43.800[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  12  345......SLSISDYPISAALFNCTG----DWVALAS--REIGQLLVWEWQSEQYIMKQQ-------------GHSSEMTCIAYSSDGQIATGGEDSKVKLWNTQSS------------FCFVTFSEHTSGVTGIQFSRNKKFLVSSSLDGTVRAFDVNRYRNFRTFTSPNPAQFSCVAVDSGELVVAGGQDFDIFLWSVKTGK--------LLEIISGHEGPVVSIAFSPVATSTLVSGSWDKTVKIWNCLESNS-EHETIDAVSDVTNVTFSP-SGEEIAVATLSGNITIFDIKSAGQV-TTIEGRNDLSAGRLETDIITARKNAQANYFSTIEYSADGECILAAGKSANICIYHVRE 658
36 -43.700[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  12  10......NLQTYGVPIYAVDWILE----EAVRSKITKD---QDDDDDDGSSSSSYIDLHTNSLSEQPIGRRVIGTDLPYRMAIHPRQGGLICALPNSCRLFDWEN---IIEDDNEEESEKVVKELKDVGQQLSLSFNQDGTVLATGAEDGTLRVFEWPSMKTLLNESKTHASVKSLTFSESGKFLVSLG-APLCRVWDVNASAAIASLS-------KEKDEMFASCRFSVDNSYVAANTQRGGSIITWDTTSWRRRSSKLIKRNNSISAFNVSA-DGKLLAVGTLEGDVLIIDSTKMQTNQIVKKAHLGLVTAL--------------------TFSPDSRCLVSVSFDSRARLTVIKQ 349
37 -43.700[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali follow..  12  50......QLEGHEGEIFTAEFHPEG----ELLLSSGFD---RQIYIWQVYEDCE------------NVMAMSGHSGAVMEAHFTPDGSIFTCSTDKTLAFWDIATG------------QRQRRFKGHGNFVNSVQGSRRGQQLCSGSDDRTIKIWDARKKHAAHTL-ESPFQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQA--------VLHHLRGHSDTITGMSLSPEGD-FILTNAMDNTLRVWDVRPGERCVKVFQGHQHNLLRCAWSP-GSDKITSGSADRHVYIWDVNTRR-ILYKLPGHNGSVNAV--------------------DFSPKEPLILSGSSDKTLYLGE... 344
38 -43.500[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  15  10......KLAQRSERVKSVDLHPT----EPWILASLYS---GTLCIWNYQTQVMAKSFEV-------------TELPVRSAKFVARKQVVAGADDMYIRVYNYNTM------------DKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWACTQIFEGHSHYVMQVTFNDTNTFASASLDRTIKIWNLGSPD--------PNFTLDAHQKGVNCVDYFTGGDKYLITGSDDHTAKVWDYQTKSC-VQTLEGHTHNVSAVCFHP-ELPIIITGSEDGTVRIWHATTYR-LENTLNYGLERVWAI--------------------GYIKSSRRVVIGYDEGTIMVKL... 299
39 -43.300[YU] KOG2445 Nuclear pore complex component (sc Seh1)  ali follow..  11  4......FDSGHDDLVHDVVYDFYG----RHVATCSSD---QHIKVFKLDKDTSNWELSDSWR---------AHDSSIVAIDWASPRIIASASYDKTVKLWEEDPDQEECS---GRRWNKLCTLNDSKGSLYSVKFAPAGLKLACLGNDGILRLYDALEPSDLRSWTANHLQSDFCLSWCPSREKLAVSALEQAIIYQRGKDGKLH-----VAAKLPGHKSLIRSISWAPSIGQLIATGCKDGRIRIFKITEKLELLSEHDDHNGEVWSVSWNL-TGTILSSAGDDGKVRLWKATYSNE............................................................ 338
40 -43.000[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  14  474.HARQINTLNHGEVVCAVTISNPT----RHVYTGG----KGCVKVWDISHPGNKSPV--------SQLDCLNRDNYIRSCKLLPDGCLIVGGEASTLSIWDLAAP----------TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQH---------DFTSQIFSLGYCPTGE-WLAVGMESSNVEVLHVNKPDK--YQLHLHESCVLSLKFAY-CGKWFVSTGKDNLLNAWRTPYGASI--FQSKESSSVLSC--------------------DISVDDKYIVTGSGDKKATVYEVI. 769
41 -42.700[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  12  24......HEYSNRSAVSALQYDAQN----GRLFTGGSD---TIIRTWSVPHHKDAFSARGGVRSPGKQGSLEQHTDWVNDMILCGHGKLISASNDTTVKVWNIERDNKH---------GFIDCIRTHKDYVSCLAYAPIVEKAVSASFDHNIFVYDINANFKTVNNLIGCKDSIYSLATTNLSLVLGAGTEKCIRLFDPRTNEK--------IMKLRGHTDNVRALVVNDDGTR-ALSAGSDATIRLWDIGQ-QRCIATCIAHEEGVWTLQVDS-SFTTVYSAGKDKMVVKTPLYDFTKLLLSEKDNPVSLWVGTWKSDIKRWSIRPSAQLSIGAMLSDKRHVLTRDSDGNVALYDVLA 422
42 -42.600[KL] KOG4283 Transcription-coupled repair protein CSA, contains WD40 domain  ali follow..  13  17..................................SFANRFKSRRILSLQLSNRKDFVS-------------PHRGSVNSLQVDLTEYLLSGAADGSAAVFDVQRATDYEASGLIAKHKCIQHENGHKYAISSAIWYPDTGLFITGSFDHYLKVWDTNTAQAVVDFKGKVYRTAMSSMAMSHTLIAAGTEDVQVRLCDIASGA--------FSHTLSGHRDGVMSVEWSTSSEWVLYTGGCDGAIRFWDIRRAG----CFRVLDQSQTQLGFRP-PILKRTAVGSKVC....................................................................... 253
43 -42.500[R] KOG0646 WD40 repeat protein  ali follow..  14  2..........................EITVIASSSID---EGIGSWDLKTGTEQLQFK-------------PCASPAHGLTAVGEKQLSARNTSGSIFYWSWTK-------------PQAEVKSYPVEPIKALAANNEGTYLVGGGISGDIYLWEVATGKLLKKWHGHYRSVTCLVFSGDDSLLVSGSQDGSIRVWSLIRDFQRQQGNTLYEHNFNEHTMSVTDIVIDYGGCNVIISSSEDRTCKVWSLSRGKLLKNI--IFPSVINALALDP-GGCVFYAGARDSKIYIGAINATSEYGT------------------QVLGSVSEKGKAITAYCADGNLLISGSEDGVVCVWDPKS 294
44 -42.500[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  12  13......ILKGHEGAVLAARFNGDG----NYALTCGKD---RTIRLWNPHRGILIKTYK-------------SHGREVRDVHVTSDNAFCSCGGDRQVYYWDVSTG------------RVIRKFRGHDGEVNAVKFNDSSSVVVSAGFDRSLRVWDCRSHSVEPVQIIDTFLDTVMSVVLTKTEIIGGSVDGTVRTFDMRIGREMSDN----------LGQPVNCISISNDGN-CVLAGCLDSTLRLLDRTTGEL-LQVYKGHISKKTDCCLTN-SDAHVIGGSEDGLVFFWDLVDAKV----------------------LSKFRAHDLVNSIDVDFYLRKFFVAGDKRELPPEGRLY 302
45 -42.500[R] KOG2096 WD40 repeat protein  ali follow..  11  81......TLKGHGDAVTGLCFSSDG----KSLATACAD---GVIRVFKLDDASSKSFNRWCFLKFRFLRINLPAGGHPTAVAFADDASSIVVACHHMLYMYGEDKQKDQQGKLDHHHIHEKRSVLTISGATATYGTADGSVVIASCSEGTDIVLWHGKTGRNLGHVDTNQLKNHMAAVSPNGRFLAAAAFTADVKVWEIVYQKDGSVKEVSRVMQLKGHKSAVTWLCFSPNSE-QIITASKDGSIRVWNINVRPIPLCDSGGNPLHYDRLSLCP-EGKILAASH-GSTLQWLCAETGNVLDTAEKAHEGDITCISWAPK------------AITVGERHAMVLGTSGDDKKVKLWEAPK 450
46 -42.300[S] KOG0295 WD40 repeat-containing protein  ali follow..  12  101......KLTGHRLPITRVIFHPLW----TIMASCSED---ATIKVWDYETGQLERTLK-------------GHTDAVNDIAIDAAGKLVSCSSDLSIKLWDFGQ-----------TYDCLKSLKGHEHTVSSVTFLPTGDFVLSASRDHTIKQWDISTGYCVYTFRGHNDWVRMIRISNDGTLFASASLDQTVTVWSFATKS--------AKLVLRDHEHAVECVEWAPDTAYILFSGSRDRSIKAWNINTGDV-LFTLLAHENWVRGLAFHP-KGKYLISVADDKTLRVWELSAQRCM-KAIEAHEHFVSTV--------------------AFHQTSPFVITGSVDMSCKVWE... 402
47 -42.300[T] KOG0279 G protein beta subunit-like protein  ali follow..  12  10......TMCAHTDMVTAIATPVDN---SDVIVTSSRD---KSIILWKLTKEDKSYGV--------AQRRMTGHSHFVQDVVLSSDGQALSGSWDGELRLWDLATG------------ESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKLWNTLGEKYTISEADGHKEWVSCVRFSPNTTIVSASWDKTVKVWNLQNCK--------LRNTLAGHSGYLNTVAVSPDGS-LCASGGKDGVILLWDLAEGKKLYSL--EAGSIIHSLCFSPN--RYWLCAATENSIRIWDLESKSVV----EDLKVDLKAEAEKTDGSTGIGNKTKVIYCTSWSADGNTLFSGYTDGVIRVWGIGR 325
48 -42.100[A] KOG0285 Pleiotropic regulator 1  ali follow..  13  113......NNTGNPGKSTAILPAPGSFSERNLSTAALME---RMPSRWPRPEWHAPWK---------NYRVLQGHLGWVRSVAFDPSNEFCTGSADRTIKIWDVATG------------VLKLTLTGHIGQVRGLAVSNRHTYMFSAGDDKQVKCWDLEQNKVIRSYHGHLHGVYCLALHPTLDVVLTGGRDSVCRVWDIRTKMQIFVL---------PHDSDVFSVLARPTDP-QVITGSHDSTIKFWDLRYGKS-MATITNHKKTVRAMALHPNEDGVMVTGGDKGGLWFWDWKSGHNFQRAET---------------IVQPGSLESEAGIYAYDQTGSRLVTCEGDKTIKMWKEDE 457
49 -41.700[S] KOG0294 WD40 repeat-containing protein  ali follow..  10  1....................MPP----EMEIIEATNE---ELLLGFKLIKSPTDGFTDSVKFELKQTFADSSYARSITSLA-VQWPWVASGGTDGRIFVYDMRTR------------KQSQIILSHAGRVNTLKFTPDLSLLLSGSDDGHMIATRVGSWTKEYDWQKAHQAVTHVSCHPSSKLALSLGGDQVLNTWNLVNGCVAHKTN---LKNKATLDFQTGCLSWSKQGDHFTLSG--PLVLEIWGIENAHVMRRI--EMPSKPICITWLD--GNECLTGLDNGNIAWISLKD---------------------EDDTPPTFILAHEVRVKAIAYLNEFLATVSIAGQIKVWKIDM 290
50 -41.700[R] KOG2394 WD40 protein DMR-N9  ali follow..  13  172......SIHFSNSNPMCHAFDP--AKDGHDLLIGLNS---GDVYTVSLRQQLQDVSKKLVGALHYNKDGSVNRQDRCTSISWVPDGAFVVAHADGNLYNKDGDPTQFSVDKAKYSKSNPVARWHICQGSINSIAFSNDGAHLATVGRDGYLRIFDFLTQKLVCGGKSYYGALLCCSWSMDGKYILTGGEDDLVQVWSMEDRK--------VVAWGEGHNSWVSGVAFDSNWSSPFGSVGQDTQLLLWDLEMDESPIIAHRVHTEPLSGLMFTQ---ESVVTACREGHIKIWTRPSESQTNSSEANPTTALLST--------------------SFTKDNKASLSSKIISGSTFKQ... 556
51 -41.600[I] KOG0301 Phospholipase A2-activating protein (contains WD40 repeats)  ali follow..  10  1.............................MADDGLGD---VPMETESMPQYTISHVIE-------------AHKSDTKALAVTQGGCLISGGRDETVKFWAKKGKQYT---------KTHAFEQPKGITVNSIAYAEDGWRLFVGRRDGTIAVFGPSQAEPYAIFNEHKQNVCCLHINEKATHMLSGSWDSNVIIWPITELNSSSF----TTIVCPGHTLSVWALASFPDLPNTYLSASADKTIRMWF---GDTTLSVFKGHTDVVRALVVLS--SSHFLSAGNDGHIIHWDVASASI----------------------LRKFATQAHEFIYSMTLSDSHILTTGEDGTLEFWA... 272
52 -41.600[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  13  441.....MVYRGHTDLVRSVSVEPKG----EYLVSGSDD---KTVKIWEIATG--------------RCIRTIETDEVVRCVAWCPNPSIIAVATGNRLLLVNPKVGDKVLNAEADEQEKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGANRIHQLSKRRSQIPFSKSKGLIQFVLFHPVKPCFFVAT-QHNIRIYDLVKQE--------LVKKLLTNSKWISGMSIHPKGDN-LLVSTYDKKMLWFDLDLSTKPYQTMRLHRNAVRSVAFHL-RYPLFASGSDDQAVIVSHGMVYNDLLQNPLIVPKKLQTHEKRDEFGVLDV---------NWHPVQPWVFSTGADSTIRLYT... 784
53 -41.500[R] KOG4227 WD40 repeat protein  ali follow..  12  1MK-RRAGLGGSMRSVVGFLSQRGLHGDPLL-------TQDFQRRRLRGCRNLYKKDLL-------------GHFGCVNAIEFSNNGWLVSGGDDRRVLLWHMEQAIHS-------RVKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETLDVFAHEDAVYGLSVSPVNDNIFASSSDDGRVLIWDIRESPHGEPF------CLANYPSAFHSVMFNPVEPRLLATANSKEGVGLWDIRKPQSSLNQGYFNSCTMKSCCFAGDRDQYILSGSDDFNLYMWRIPADPEAGGIGRVVN------------GAFMVLKGHRSIVNQFNPHTYMICSSGVEKIIKIWS... 361
54 -41.300[A] KOG0647 mRNA export protein (contains WD40 repeats)  ali follow..  15  25LANDIVINSPAEDSISDIAFSPQQ---DFMFSASSWD---GKVRIWDVQNGVPQGR------------AQHESSSPVLCTRWSNDGTVASGGCDNALKLYDIASGQ-------------TQQIGMHSAPIKVLRFPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPERVYSMDN---KQSLLVVATAERHIAIINLANPTTI------FKATTSPLKWQTRCVACYNEADG-YAIGSVEGRCSIRYIDDGMQKKSGFSSLVYPVNSIAFHP-LYGTFVTAGGDGTFNFWDKNQRHRLKGYPT---------------------LQASIPVCSFNRNGSVFAYALSYDWHQGHMGNR 342
55 -41.000[S] KOG0271 Notchless-like WD40 repeat-containing protein  ali follow..  13  100......SIPGHGEPVISAQFSPDG----RGLASGSGD---QTMRIWDIELELPLHTCK-------------SHKSWVLCIAWSPDATIASACKNGEICIWNAKTGEQIGK-----------TLKRHKQWITSLAWQPTCRLLASCGKDGNIFIWDTVQGTVVRCL-SGHTASVTCLRWGGEGLIYSGSQDRTVKMWRADDGV--------MCRNMTGHAHWINTLALNTDYALRLVSGSDDFTLFMWNPKETKQSINRMTGHMQLVNQVVFSP-DTRYIASASFDKSVKLWCGRTGKYL-ASLRGHVGPVYQVAWSADSRLLVSLPGHGDEVFTWSPEGTKVVSGGKDKVLKLWR... 472
56 -41.000[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali follow..  13  101......YVTSHKQACRAGAFSCDG----SLVATGSVD---ASIKILDVERMLAKSAPEDEQQGHPVIRTLYDHTDEVSYLEFHPKEHLASASRDGTVKLFDIAKP----------SVKKAHKVFTDCEPVLCLSFHPTGDYVAIGTEHNVLRVYDVATTQCFVSAQQHKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGRCINTIAE------AHGGAAICSLEFTRNGK-YLLSSGMDSLVYLWELCTSRPIQTTTGKQEHQTEAVFNHT-EDYVLFPDEATTSLCSWNSRNGCRLTLNSLGHNGPVRYI--------------------THSPNGPAFLTCSDDFRARFWYRRA 421
57 -40.800[S] KOG0281 Beta-TrCP (transducin repeats containing)/Slimb proteins  ali follow..  14  193.RHNLQRIQCRSENSKGVY-----QYDDEKIISGLRD---NSIKIWDKTSLECLKVLT-------------GHTGSVLCLQY-DERVIVTGSSDSTVRVWDVNTG------------EVLNTLIHHNEAVLHLRFSNGL--MVTCSKDRSIAVWDMASATTLRRVLVGHRAAVNVVDF-DDKYIVSASGDRTIKVWSTSTCE--------FVRTLNGHKRGIACLQYR---DRLVVSGSSDNTIRLWDIECGA-CLRVLEGHEELVRCIRF---DNKRIVSGAYDGKIKVWDLQAALDPRAPAST--------------LCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLN 487
58 -40.500[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali follow..  15  36..........ETSQVNALDRTPDK----TRLAACGYQ----CIRLYDLESNCTA-----------PVINFDGVQKNVTRLGFQEDGNMFTAGEDHHVRIWDMIAAPPH-----------CSRIFDCEAPVNAACLHPNQVEIAMGSQNGSVFLWDVKSERHERIVPEVDASIQDVAISPDGRYLAAANNKGNCYIWSLTSQDQ-KMSTLRPNRKIPAHSRYILRCKFSPDSR-LLLTTSGDGTVCIWKTDDFSK-WRELCIENYWVWDAAFSA-DSKWLFTASSDGIARLWKLQTKSSI-RDYTGHTKAITALSFKDEIPVKSTNIPGTNNLAFFETVGRVAMNPYMGNTTTELN... 362
59 -40.400[BK] KOG1063 RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily  ali follow..  13  54......TLPGHKASVNCTHWLPTSKLDRQYLLSGDSD---GIIILWELSTLN---NDQQWRHVLQLPLSHKKGVTCITAYMVSETDAFASASSDGVVNVWDVSFPSQPSE---ECKVVCLDSICVDTKAIVTLSLNPGRFALALGGLDNKIKLYSGERTGKFTSVCKGHTDWIRSLDFSNSIMLVSSSQDKVIRIWKLVLVGGTFTYQISVESVLIGHEDWVYSVEWQPPVIDFILSASMDKTMMIWRPEKKTVCVGELSHCALGFYGGHWSP-NSLSILAHGYGGAFHLWRNVSSSKESEN-----------------QMQKVPSGHFAAVTTWARTGEYLLSVSQDQTTRVFSAWK 446
60 -40.300[DO] KOG0305 Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits  ali follow..  12  119....DAPGLRDDFSLNLLDWGSAN-----VLAIAL----GDTVYLWDASSGSTS-----------ELVTIDEDKGPVTSINWTQDGLLAVGLDNSEVQLWDCVSNRQVRTLR-------------GGHESRVGSLAWDNHILTTGGMDGKIVNNDVRIRSSIVETYLGHTEEVCGLKWSSGNKQASGGNDNVVHIWDRSLASSKQTRQ--WLHRFEEHTAAVRALAWCPFQASLLATGVGDGKIKFWNTHTGAC-LNSVETGSQ-VCSLLWSQSERELLSSHGTQNQLTLWKYPSMSKM-AELNGHTSRVLFM--------------------AQSPNGCTVASAAGDENLRLWNVFG 419
61 -40.100[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  13  74......KSAKAAAKIEKWLLPAEAG----YLETEGLE---KTWRVKQTDIANEVDILSSR-----NQYDIVLPDFGPYKLDFTASGRMLAGGRKGHLALLDMMNMS-------------LIKEIQVRETVRDVAFLHNDQFFAAAQKKYAYIY---GRDGTELHCLKERGPVARLRFLKNHFLLASVNMSGQLHYQDVTHGG--------MVASIRTGKGRTDVMEVNPYNS-VVGLGHSGGTVTMWKPTS-QAPLVQMQCHPGPVSSVAFHP-NGHLMATSGKERKIKIWDLRKFEEVQTIHSFHAKTLSGGSSHNYTRYMNHSMVKGYQIEKFRPYEDVIGIGHSMGWSSILIPGS 411
62 -40.000[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  14  1.....MSLCGHTSPVDSVAFNSE----EVLVLAGASS---GVIKLWDLEESKMVRAFT-------------GHRSNCSAVEFHPFGELASGSSDTNLRVWDTRKK------------GCIQTYKGHTRGISTIEFSPDGRWVVSGGLDNVVKVWDLTAGKLLHEFKCHEGPIRSLDFHPLEFLLATGSADRTVKFWDLETFE--------LIGTTRPEATGVRAIAFHPDGQ-TLFCGLDDG-LKVYSWEPVIC-RDGVDMGWSTLGDF-CIN-EGKFIGCSYYRNSVGIWVSDISELEPYSEDKNECMVKRFSVLNDQSERMGSGPRGS---YVDSTGGNLNVAQNPGSLKATLPLE 322
63 -40.000[R] KOG1273 WD40 repeat protein  ali follow..  11  15...EVIEEYLEHGVIKCVAFNHRG----SLLAAGCAD---GGCVIWDFETRGIAKEIRDN-----------DCSAAITSVSWSKYGHLLVSAADKSLTLWDVSTGEKIARTILQQPQRSKCPESNPPFSPAAACFNKCGDLVYIGNSKGEILIVDYKSVRVLALVSASGAAPVKNIVFSNGQYLLTNSHDRTIRIYENLLPAGSKCLTLFREFQDSVTKMHWKAPCFSGDGEWVVGGSAGEHKIYIWD--RAGHLVKILEGPKEALIDLAWHP-VHPIIVSVSLAGLVYIWAKDYTENWSAFAPDFKELEENE--------------------EYVEREDEFDLIPETEKVKVLDVNE 391
64 -40.000[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  13  409.....ITIGGHRSDVRTLSFSSD----NIAVLSAA----ADSIKIWNRSTLQCIRTMTC---------------EYALCSFFVPGDRVVIGTKTGKLQLYDLASG------------NLLETIDAHDGALWSMSLSPDQRGFVTGGADKSVKFWDFELVKDETRTLQLDEDVLCVSYSPNQKLLAVSLLDCTVKIFYVDTLK--------FFLSLYGHKLPVICMDISHDGA-LIATGSADRNVKIWGLDFGDC-HKSLFAHDDSVMYLQFVP-KSHLFFTAGKDHKIKQWDADKFEHI-QTLEGHHQEIWCL--------------------AVSPSGDYVVSSSHDKSLRLWERTR 706
65 -39.900[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  12  309IRSKDYSRTRKAKVVLCVTFSENGD-----TITGD---SSGNILVWGKGTNRISYAVQG------------AHEGGISPLCMLRDGTVSGGGKDRKLISWSGNYQKLRKTEIPEQSGDFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFH-PSGSVVAVGTLTGRWFVFDTETKD--------LVTVHTDGNEQLSVMRYSPDGN-FLAIGSHDNCIYIYGVSDNGTRVGKCSGHSSFITHLDWSV-NSQFLVSNSGDYEILYWVPSACKQVVSVETTRDTYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPC 672
66 -39.800[DK] KOG0973 Histone transcription regulator HIRA, WD repeat superfamily  ali follow..  8...........TGSILAIDCHPSGK----KFITCG-RTSNGLVVVWNAE--PVLDKKKASNENVPKLLFQVESQSQSNSCRWSPDGKFAFGSDDSSVSVWEYVGLINTGGAQNVERYKECCVLRGHSMEVLTVEWSPNGKYLASGSIDYRIIIYNARKLPDRITVLNDIQLPVKGLSWPIGKYLASLEGDKKLRFWATDSWQCVKSVT--EPFESNIEETMLTRLDWSPDGKYLMTPAAVRSLIKLIQ-RQTWKSDQFLAGHHKGTTCVRAMPRQLTCAAVGSRDKSISIWVFPGTLKP---------------------LFVINNIFNHTVMDFAWCGRNLLACSQDGTVKVIH... 345
67 -39.800[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  10  116....EAKISHGTQAISALRVEPPG----VRFASGGLD---YYVKLFDFQKMDMSMRYDKEL--------LPAESHVINSLAFSPNGTLVVASGEAIIRLLDRAGKQWSETVRGDQYIIDLNITKGHTATVNCVEFNPLNKNFISCSDDGSLRLWNLDDHKVITKCINKHRKVIVCTFSPDGKWIAAGCDDGSVQAWKYGSQYVNVN-----YLVRKAHNGSITSIAFSPDSK-RLLSRGFDDTLKMWSLDNPKEPLLVKTENAFKSTDCGFSP-RAEVVFTGTTPGTLQFFDPMTFDLVYKIDYPGISCHR----------------------QWHPRLNQIIAGLSDGTIHVYYDQT 449
68 -39.600[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  13  128......AMNKVKCPVYSVCWSPEG----KRLITGCQT---GEFTLWNGTAFNFETILQ-------------AHDSAIRALKWASNEQLLSADQGGYVKYWQPNMN------------NAHMFSAHKDEAIRGLAFAPTDVKFATASDDGTARVWDFARYTEERVLRGHGAEVRCIDWHPTKGLIATGSRDTPVKIWDPKSGS--------CLATLQEHKSSVMAVEFNKNGN-WLLTGGRDHLVKMYDIRMMKE-MRTYRAHKKEVISLAWHPIHEGLFVSGGGDGSIVYWMVDGEKEIGLLEHAHDQAIWSM--------------------KWHPLGHILATGSNDNNTKFWA... 417
69 -39.500[R] KOG2919 Guanine nucleotide-binding protein  ali follow..  13  121......SSTEAQHYTKGCYWSPDGT----CLLVPVHL---DGMHVIEMPSDLYSADTVQPARSLTKLQVHVPEGGTVYDCVWYPHMNWLATRQHEPIHMWDAFDGSLRCSYSGYDAVD-------EVMAAISLAFSHDGEQIYA-GYKRCIKIFDTSRPGRFCDDYPVKFAISCIAQTTAHPTLTCGNWHGYIQHFDLRCSHKQGP-----LFTLGGHKGGITQLRYGEFGNGLFSGARKCDKILQWDMRNYKQPLVELQRHVDTNQRIQFDASDSNWLASGDTRGFVNVWDLKKYGDP-SVLPLHSDCCNGVALNPAMPILATSSGQTTELPAPADVNQNQKEVLYENAVVMWW... 482
70 -39.400[A] KOG0272 U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats)  ali follow..  15  256......SQVGDTRPVSSAAFSEDS----SLLLTSSWS---GLCKLWSVPDCELKQTLR-------------GHASYVGGVALRPGVKMASGGHDGAVKLWGFNNEESIADIT-----------GHMPHRVSKVAFHPSGRFLATACYDSSWRLWDLEQKTEVLHQEGHAKPVHCLSYHSDGSVLVTGGLDAFGRVWDLRTGR--------CIMFLEGHLGAVFGVDFSPNG-FHIATGSQDNTCKIWDLRRRQ-PVYTIPAHTNLISDVKYQQECGSFLVTCSYDSTTKIWSNKTWQPL-KTLQGHDNKVISV--------------------DIAPNSQYIATTSFDRTFKLWSPDS 553
71 -39.300[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  11  59......VYTEHSCAVNVAKYSPSG----FYIASGDAS---GKIRIWDTVNKEHLLKNEFQ-----------PIAGPIKDISWSPDNQRIVAVGEGRGHVFMSETG------------TSVGEISGQSKSINSADFRPARPRIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEF------GSPAHKGGVYALAWKPDSTQ-LLTCSGDKTCRLWTVESRELVSEFVMGTTVDDQQVSCLW-QGDNLITVSLSGVITYLNVADPSKPLRVVKGHNKPITVL--------------------GLSDDRSTIYTGSHDGVVTNWNSGS 356
72 -39.200[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  15  1MKLKLSASTRHTEMVCGVGWIGTEA-----ILSAADD---HVFLLTNTATNESQQILNMPETFFPTSLHIFPRSQTKGG----QNDVFAVSTSDGKINILS-------------RNGKVENMVDAHNGAALCARWNSDGTGLLSSGEDGFVKMWSR-SGMLRSVLAQFATAVYCVAWDSTSSNVLYCNADHCYIKSLKMQVAPI---------KWKAHDGIILCCDWNPTSD-LIVTGGEDLKFKVWDGF--GQILFNSSVHDYPITSISWNT-DGTLFAVGSHN-ILRLCDKSGWSHSLEKMNAGSVMAL----------------------SWSPDGTQLAVGTAAGLVFHAHIID 298
73 -39.200[R] KOG2444 WD40 repeat protein  ali follow..  11  5..........FDNPPLCMKSNKD----GSRLVVGFVD---GSIRFYDTQQHEEEF----------QEIWKFQTKSSIRGVDLDEHKKVYAVTKNRSLCVFDIDTGKRVRCIL-----------KCHRSVPTAICTLPKSQQLATADESGEVKTWNLDPEVASERKWQEQDEDINDLKVDVKSNLLATSSDGTLGAYDLRKAK--------LKMRSELMHSELYSVCGT---NRSVYVGGEDGYVEVFNLNEYGNLLRVESGFEMGVNGIVELR-SGLLGLTSQGSNRMRLLNVQPSKRL-----------------GYAGYHGDEKSDDDGIDAITISTDVFTMISMSCTIKKWD... 305
74 -39.100[S] KOG0283 WD40 repeat-containing protein  ali follow..  13  399......EIQAHEGAVWTIKFSQDA----HYLASGGAD---RVIHVWEVQECELMSMNE-------------GSLTPIHPSLCDSSGNITVVEKKKKGKGSSGRRHNHIPDYVHVPSDKPVCSLKGHLDAILDLSWSKSQ-LLLSSSMDKTVRLWDIETKTCLKLFAHNDYVTCIQFSPVDENYFLSGSLDAKIRIWSIQDRH---------VVEWSDLHEMVTAACYTPDGQG-ALIGSHKGICRAYDTEDCKLSQNKKSQAKRKITSFQFSPVNPSEVLVTSADSRIRILDGSEVIHKFKGFRNTCSQLSA---------------------SYSQDGKYIICASEDSQVYLWKNDF 713
75 -39.100[S] KOG0321 WD40 repeat-containing protein L2DTL  ali follow..  13  125.......................................................................MLNQLPFCLGFANNESLAVCTETGALELFDSRFYDRQNE-ENQPSARRIHGWLAHNNAIFSVNFSKDDSLLATSSGDQTSKVFDLSTQQCITRLGGYHSHSVKQVNFCNDSNLVSCSRDGSIIFWDMRTHGQKPVLRIRKAHENSGRDCSITSATWLPQSTSVISSCSANSALKLWDLRTATTPELTTSKRDFGVTNVCTSP-DGERIYAASRDSIIYEYSSRHLNSGKDPRLRISSFYVKLACSPDGATLALTGGHTKDVTAVDWSSEQLASISDDGSVRVWNSSL 467

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.