current user: public

If you have questions about the server, please let us know.

Query: [C] KOG4769 Cytochrome c oxidase, subunit I, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .
# Score Template Links and tools%idFirst MNSWWTYVNRWIFSTNAKDIAILYLLFGLVSGIIGSVFSFIIRMELSAPGSQFLSGNGQLYNVAISAHGILMIFFFIIPALFGAFGNYLVPLMIGAPDVAYPRVNNFTFWLLPPALMLLLISALTEEGPGGGWTVYPPLSSITSHSGPAIDLAILSLQLTGISSTLGSVNLIATMINMRAPGLSLYQMPLFAWAIMITSILLLLTLPVLAGGLFMLFSDRNLNTSFYAPEGGGDPVLYQHLFWFFGHPEVYILIMPAFGVVSHIIPSLAHKPIFGKEGMLWAMLSIALLGLMVWSHHLFTVGLDVDTRAYFSAATMVIAIPTGIKIFSWLATLTGGAIQWSRVPMLYAIGFLILFTIGGLTGVILSNSVLDIAFHDTYFVVAHFHYVLSMGALFGLCGAYYWSPKMFGLMYNETLASIQFWILFIGVNIVFGPQHFLGLNGMPRRIPDYPEAFVGWNFVSSIGSVISILSLFLFMYVMYDQFTSNRVVKTNPYLIPSYFDDNVIFVNEKLGVAQSIEWLLHSPVHEHAFNTLPTKSILast
1 -150.000[C] KOG4769 Cytochrome c oxidase, subunit I  ali  100  1MNSWWTYVNRWIFSTNAKDIAILYLLFGLVSGIIGSVFSFIIRMELSAPGSQFLSGNGQLYNVAISAHGILMIFFFIIPALFGAFGNYLVPLMIGAPDVAYPRVNNFTFWLLPPALMLLLISALTEEGPGGGWTVYPPLSSITSHSGPAIDLAILSLQLTGISSTLGSVNLIATMINMRAPGLSLYQMPLFAWAIMITSILLLLTLPVLAGGLFMLFSDRNLNTSFYAPEGGGDPVLYQHLFWFFGHPEVYILIMPAFGVVSHIIPSLAHKPIFGKEGMLWAMLSIALLGLMVWSHHLFTVGLDVDTRAYFSAATMVIAIPTGIKIFSWLATLTGGAIQWSRVPMLYAIGFLILFTIGGLTGVILSNSVLDIAFHDTYFVVAHFHYVLSMGALFGLCGAYYWSPKMFGLMYNETLASIQFWILFIGVNIVFGPQHFLGLNGMPRRIPDYPEAFVGWNFVSSIGSVISILSLFLFMYVMYDQFTSNRVVKTNPYLIPSYFDDNVIFVNEKLGVAQSIEWLLHSPVHEHAFNTLPTKSI 537
2 -135.000[C] COG0843 Heme/copper-type cytochrome/quinol oxidases, subunit 1  ali follow..  31  39.KKWSYLWNEWITSVDHKKIGVMYCILAIVMLLRGFADAIMMRSQLALASGGGAYLPPEHYDQIFTAHGVIMIFFMAMP-LMTGLINLIVPLQIGARDVAFPFLNTLSFWLAAAGVVLVNLSLGVGNFARTGWLAYPPLSELAYSPDVGVDYYIWALQISGLGTLLTGVNFVATIFKMRAPGMTLMRMPIFTWTALCANILIVAAFPVLTVALALLGLDRYLDMHFFTNTAGGNAMLYVNLIWIWGHPEVYILVLPAFGMFSEIISTFSRKKLFGYTSMVYATAGITVLSFLVWLHHFFTMGSGANVNAFFGIATMIISIPTGVKIFNWLFTMYRGRVEFTSPVLWTIGFMITFVIGGMTGVLLAVPGADFLLHNSLFLIAHFHNTIIGGVVFGYLAGITFWFPKAFGFKLDEKWGKRAFWCWFVGFYLAFMPLYVLGFMGMTRRLNHTDNPWLIVAVIGAAVIACGIASQLIQIVVSIRNRKALADVTGDPW------------------GGRTLEWATSSPPAHYNFATVPVVR. 559
3 -65.200[O] COG3278 Cbb3-type cytochrome oxidase, subunit 1  ali follow..  13  57........APIDPSAYMDGPIRYGAIATMFWGVVGMLVGVVIALQLAYPDLNIQ--PWFNFGRLRPLHTSGVVFAFGGNALL-CTSMYVVQRTCRAR-LFGGDLAWFVFWGYQLFIVMAATGYLLGITESREYAEPEWYVD----------------IWLTIVWVAYLILFLGTILKRKEPHIYVANWFYLSF---------IVTIAMLHVVNNLSMPASFLGSKSYSAFSGVQDALTQ---WWYGHNAVGFFLTAGFGMMYYFVPKQANRPVYSYRLSIIHFWALIFLYIWAGPHHLHYTALPDWAQTLGMVFSIMLWMPSWGGMINGLMTLSGDKIRTDPIIRMMVIAIAFYGMSTFEGPMMSIKSVNSLSHYTDWTIGHVHSGALGWVGMISFGAIYYMVPKLWNRLYSLRLVTWHFWLATLGIVVYAAVMWVSGIMQGLMWREYDEAAMHPYYIMRAVGGAMYLSGALIMAWNIAMTILGHQRQEPLPGSVPALQ...................................... 533
4 -27.800[P] COG3256 Nitric oxide reductase large subunit  ali follow..  10  274..............TPSQKALGKYVFLTVALFVVQVLLGGLTAHYTVEGQGFYGIDEA--YALTRTWHIQSAIFWIATGFL--TAGLFLAPIVNGGKDPK-FQRAGVNFLYIAL-FIVVGGSYAGNFFALTHILPPEFNFWFGHQGYEYLDLGRFWQLLLMVGLLLWLFLMLRCTVSAFKEKGVDKNLLAIFVASMVGVGVFYAP---------------------LFYGEKSPIAVMEYWRWWVVHLWVEGFFVFATAAFAFVFYNMGFVRRSTATASTLAAAAIFMLGGVPTLHHLYFSGSTSASMAIGACFSALEVVPLVLLGREAYEHWSYQHRLRWPLMCFVAVAFWNMIGAGVFGFLINPPISLFYIQGLNTSAVHAHAALFGVYGFLALGFVLLVARYLKPNQFDDKLMTWGFWLLNGGLVMIAISLLPVGVIQAYASIFLQMEILDTLRWVRTAADLVFIGGAICVAIQATKIVFGRDK.................................................. 751
5 -7.480[P] KOG4505 Na+/H+ antiporter  ali follow..  5.............QVEISKPHLAYAIIGGFTSLFM-LCSLIIKEKLFLGE---------------------ATMATATGLIFGPYVKLFVPTSWGNTDYITEELARVLL-EVFAAGAELPRAYMLRHWRSMFVMLLPVMIFGWLVSTGFMYALIPRLSFLEIAACITATDPVLASSIVGKGKFA-RRVPGHLRNMLLAESGC-MAIPFLYLAIYLII-----------EKPARHAGRDWVCIIILYECTFGCVLGAIIGIARKMIKFSERRGLMDRESFLVFYFVLALFCGGI--------------GTIIGVDDLLVSFCAGAAFSWDSWFSKKTEESHVSNVIDLLLNLSFFVYVGAIMPWPQFHMPHMDLSVWRLVVLAICILIARRIPAVLLF-------SFVPDIINWREALFAGHFGPIGVGALYTCLVARAELEVHSTENPEIPNWYCIQVMWPVVCFLVLSSIIV................................................................ 426
6 -6.840[S] KOG4290 Predicted membrane protein  ali follow..  12  209............FSFDEQNTVQLFLLTVVAYAILSIIQSGANFKN--------------------QMPPRSVILSRIITMKLIGYSLQCFNVLLFAYDQGFFIARIAGEVLRNTSVQVHCLLLIM----AKGWDISYPGTEYPKRCVIMWGVLAGLDTVLFFYNCTFVYDVLHDVDIYSAPGHGMILIRIIYAIWFLIEIRKLIDSE-----------QSRQKAEFL-------HFGAGFLVWF--------VSLPMIGIVASFVSQLWRFSLILALTTFSNFVALSCLVHQFWPKSSY.............................................................................................................................................................................................................................................. 450
7 -6.450[JK] KOG2038 CAATT-binding transcription factor/60S ribosomal subunit biogenesis protein  ali follow..  11  204............................................KYKTLAQKLYQHEINLFKSKTNSQKGASSTWMKAIVSSGTLGDRMAAMILLIQDDAVHTLQFVETLVALDTFKELLITDLLPDNRKLRIFSQRPFDKLEQLSSGNKDSRDRRLILWYFEHQLKHAEFVQVLETLSHDTLVTTKT-----RALTVAHELLCNKPEEEKALLVQVVNK-LGDPQNRIATKASHLLETLL-----HPNMKGVVS-------GEVERLLFRSNISSKAQYYA---ICFLNQMALSHEESELANKLITVYFCFFRTCVKKKDVESKMLSALLTGVNRAYPYSQ----------------------TGDDKVREQIDTLFKVLHIVNFNTSVQALMLLFQVM-YYTALYRKMLDPGLMTCSKQAMFLNLVYKSLKADIV-VKAFVKGLLQ----------VTCQQMPPFICGALYLVSEILKAKPGLRSQLDDHPESDDEENFIDANDDEDMEKFTDAD.................... 651
8 -6.240[I] COG1835 Predicted acyltransferases  ali follow..  12  20...........LFHFGVSAIPGGFTGVDIFFVISGYLISGSLLDDLERGQFSIGRFYWRRARRILPALTFVILWFILLPSDLHEYSLSVIAASTFWSNIYFPLLHTWSYYIFAPVLVYLIYRY-------------------------ASKRWLTILLPIAIGSFA-----LAVMATTLAPTAGFYLLPTRIWELALGAMLMLRKPPALASRPLTELI-----------GLAGFGLIAFGFVTI--FPGYNAL-FPCIGTALLIYAADRPVPVATQVLRLTPLVWIGLISYSLYLVHFVHYLSLKAIGVPTILAMIVASVALATFSWKYVEQPFRQKRAFTAPLPIFAFSATAIALLCVGGLAG............................................................................................................................................................................. 368
9 -6.160[S] KOG4610 Uncharacterized conserved protein  ali follow..  14  1.............................MAKIISTIKAILTRI-------------------IFSAHSLLAIWQVVAL------------------------KSDIIYWALCGPLLLLLLTIMIKKTQEWRWFC---PSVFLYLSSIVPAIWLLELDKVPSNYSIPVGNTTIFITSTNSSGVPPVATLLGQAGVTLSVTPDTWTTLIEQFLMLILIVGR----------------------WLLTRDQLSQLLLVYIGTAADIIDSYKDDSIAKIGFLVFLTLGIWSWSLMQFTIVLSATRGRRPSHHKEEHTDCCQNCCCGIDVWGIVLNVILQDAPFLTFRLLII............................................................................................................................................................................................. 283
10 -5.870[S] KOG4843 Uncharacterized conserved protein  ali follow..  622...........................................LEVRIPAEHVTATNRQVRGGQLWGTD-----------IYTDDSDLVAGYCRPTASPPPPTMQELRTTIRVLPSQDYYTSKLRNNVRSRAW-----------GAGIGCSYRVERCYILKKGG--GTIELEPSLTHSSTVEPTLAPMAVERSMTTRAAASNALRQQRIKYSISIV-ADKGLKKPLFTSAR----LKKGEVLYLETHSCRYELCFAGEKTIKAIQASQQQSSHEAMETDNNNNKSQNHLTNGDKTDDVFRWSRCKKPLPQKLMRSIGFPLPADIEVLDWEDVQWS--------------------------------QTGVWIAGKEYTLARVHFL....................................................................................................................................................... 914

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.