|
current user: public |
|
Query: [S] COG0011 Uncharacterized conserved protein, from COG1018 |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 | |||||||
# | Score | Template | Links and tools | %id | First | MPKVTVSIKVVPAVEDGRLHEVIDRAIEKISSWGMKYEVGPSNTTVEGEFEEIMDRVKELARYLEQFAKRFVLQLDIDYKAGGITIEEKVSKYR | Last |
1 | -5.270 | IDP05084 putative ATP-dependent DNA helicase (together with adjacent 3 orfs) [Escherichia coli O157:H7 EDL933] Z4803 [Escherichia coli O157:H7 str. EDL933] | ali follow.. | 10 | 40 | .......LVVQRTGWGKSAVYFIASKIFRDRGAGPTIIISPLLALMRNQVAAAERL...................................... | 88 |
2 | -4.840 | IDP90294 eukaryotic translation initiation factor 2 alpha subunit, putative [Toxoplasma gondii ME49] TGME49_113230 [Toxoplasma gondii ME49] | ali follow.. | 16 | 34 | .................DVEDLVMVKVNRIADLGAYVSLLEYNN-MEGLMSELSK-FRSVNKLIRVGRHEVVMVLRVDPKKGYIDLSKR..... | 107 |
3 | -4.710 | IDP90772 gene: pheA; chorismate mutase/prephenate dehydratase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0316 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819] | ali follow.. | 17 | 117 | ....................ANIEDVFKELSNKEAKYGVVPIENNTEGAVGITLDCLGKYNEL------KIFGEIYMDIHHSFVGINENLKEIK | 184 |
4 | -4.470 | IDP02743 gene: bfmbAb; 3-methyl-2-oxobutanoate dehydrogenase, beta subunit [Bacillus anthracis str. `Ames Ancestor`] GBAA4383 [Bacillus anthracis str. `Ames Ancestor`] | ali follow.. | 18 | 204 | ......DITVITYGL---CVHFALQAAEKLAQDGISAHILDLRTVYPLDKEAIIEAASKTGKVL.............................. | 258 |
5 | -4.430 | IDP05207 putative sulfonate ABC transporter,solute-binding lipoprotein [Clostridium difficile 630] CD2365 [Peptoclostridium difficile 630] | ali follow.. | 9 | 42 | ......TITVGYYNCDHMTAGPVAESAGIYKDLGLNVKTVGNGKVPEGKMDAGYIGTKGLVGAIPKGSPITIAANNHTGGSEYLIVSKDIKEPK | 133 |
6 | -4.360 | IDP00790 gene: pdhB; pyruvate dehydrogenase complex E1 component, beta subunit SACOL1103 [Staphylococcus aureus subsp. aureus COL] | ali follow.. | 18 | 204 | ......DISIITYGA---MVQESMKAAEELEKDGYSVEVIDLRTVQPIDVDTIVASVEKTGRAV.............................. | 258 |
7 | -4.310 | IDP02496 gene: pdhB; pyruvate dehydrogenase complex E1 component, beta subunit [Bacillus anthracis str. `Ames Ancestor`] GBAA4183 [Bacillus anthracis str. `Ames Ancestor`] | ali follow.. | 20 | 204 | ......DVSVIAYGA---MVHAALKAAEELEKEGISLEVVDLRTVQPLDIETIIASVEKTGRVV.............................. | 258 |
8 | -4.310 | IDP02275 Type IV pili glycosylation protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1158c [Francisella tularensis subsp. tularensis SCHU S4] | ali follow.. | 16 | 95 | ........FSIP--ERHSIPIFLSALNEAISSSGITII--DFKAKLSGNFSQLIKLFVAL-----IDMKDIAVITNINIKKESDD......... | 180 |
9 | -4.250 | IDP01255 gene: yugI; general stress protein 13 BA_5132 [Bacillus anthracis str. Ames] | ali follow.. | 16 | 1 | ............MSEQYTTGVVVTGKVTGIQDYGAFVALDAETQGLVHISEITNGYVKDIHDFLKVGDTVEVKVLSIDEEHRKMSLSLK..... | 77 |
10 | -4.200 | IDP02425 gene: acoB; TPP-dependent acetoin dehydrogenase E1 beta-subunit [Bacillus anthracis str. `Ames Ancestor`] GBAA2775 [Bacillus anthracis str. `Ames Ancestor`] | ali follow.. | 16 | 216 | ......DVTIVAIGK---QVHTALAAAEQLAKKGLEVEVIDPRSLSPLDEDTILSSVEKTNRLI.............................. | 270 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Alonso A, Rahmouni S, Williams S, van Stipdonk M, Jaroszewski L, Godzik A, Abraham RT, Schoenberger SP, Mustelin T. Tyrosine phosphorylation of VHR phosphatase by ZAP-70. Nat Immunol. 2003 Jan;4(1):44-8. Epub 2002 Nov 25. |