current user: public

If you have questions about the server, please let us know.

Query: [O] KOG4146 Ubiquitin-like protein, from COG1018

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst MAIKVELLGGLDLLFNKQKALSLSLSNLGSTKLGSLIDYMAQIIEKPSQKDLFILNGTVRPGIIVLVNDQDWELLEKEEYNLEEGDEVVFVSTLHGKTIFSIFFIIFKTNCINLast
1 -25.000IDP04099 molybdenum cofactor biosynthesis protein D [Vibrio cholerae O1 biovar El Tor str. N16961] VC1027 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  22  2..IKVLFFAQTRELVE-CDSLVVDHA---FATVEALRQHLAQQPGKWDMAL--------PGKLLAAVNQSIVP----FDTELQDGDEVAFFPPVTGG................ 81
2 -13.000IDP05736 gene: thiS; putative thiamine biosynthesis protein [Clostridium difficile 630] CD1702A [Peptoclostridium difficile 630]  ali follow..  18  7.......................EIEFEKDLTVIDLLNKY----------------NLKSDRVVVEVNLEIIEESNYNTYVLKDEDIVELISFIGGG................ 64
3 -6.500IDP02034 hypothetical protein lmo0059 [Listeria monocytogenes EGD-e] lmo0059 [Listeria monocytogenes EGD-e]  ali follow..  20  7MNVTVDF--------TNWGASKYDLRIPVHQPIKALIINLAETL-KIDYKDLSKCTIKTTNKAILLSDDDKLT-----NFQIADGDILEIL...................... 83
4 -6.060IDP01445 gene: sdhB; succinate dehydrogenase iron-sulfur subunit VC2088 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  3LNFSLYRYNPDVDNKPYMKDYILEVEEGSDMMVLDALILLKEQDPSIAFRR----REGVCGSDGLNMNGKNLSALKGDKIVIRPLPGLPVVRDL................... 101
5 -5.970IDP92663 hypothetical protein BB0811 [Bordetella bronchiseptica RB50] NP_887360 [Bordetella bronchiseptica RB50]  ali follow..  10  1MMLTLIVRNPEPGTLGRDAENCLALPAAPGQ-----LCRVQAALRADAQGWRLHNLSGMAA---VHINDAALA--PGAVRAIQAGDTLRV-----GA................ 95
6 -5.800IDP02194 gene: sdhB; succinate dehydrogenase iron-sulfur subunit [Francisella tularensis subsp. tularensis SCHU S4] FTT0075 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  1MEVRFKIYRYNPEVDKKPYYDEYTVEVENEGVKVLTALELIKEQDPTLALRRSCREG-VCGSDGMNINGKNR----ACITSVGELKQPIKVNPLPG................. 92
7 -5.400IDP01383 thiosulfate ABC transporter, periplasmic thiosulfate-binding protein VC0538 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  57VEIKQSHAGSSAQARSILQGLAADVVTFNQVTDVQILHDKGKLIPANWQTLLPNASSPYYSTTAFLVRKGNPKNIQDWSDLVRDDVKSVFPNPKTSGNARYTYLAALGF.... 165
8 -5.260IDP06386 gene: ORF26; ORF26 [Human herpesvirus 8] YP_001129379 [Human herpesvirus 8]  ali follow..  61..................................QIMQYLSKCTLAVLEEV---RPDSLRLTRMDPSDNLQIKNVYAPFFQWDSNTQLAVLPPFFSRKDSTIVLESNGFDLV. 135
9 -5.180IDP01474 fumarate reductase iron-sulfur subunit VC2657 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  11  6.IQKVDILRYDPANDAEPHMQRFEVPFDETMSVLDAIGYVKDHLDKDLSYRWSCRMA-ICGSCGIMVNGV--PKLACKSFLRDYPEGVKIEP..................... 93
10 -5.070IDP00166 gene: rtxC; RTX toxin activating protein VC1450 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17............QMIGGVMLLSQHSPLHRRYVVAEWLQRILPAFELNQFCYYEDEHGRPIAFCNAFVSEQIRDELLSGVREIRSGQQIYIPEMIAPFGHGREVVNDLRRRVFL 123

FFAS is supported by the NIH grant R01-GM087218-01
1 3 8 7 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.