current user: public

If you have questions about the server, please let us know.

Query: [E] COG0010 Arginase/agmatinase/formimionoglutamate hydrolase, arginase family, from COG1018

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .
# Score Template Links and tools%idFirst MYNTLNNKEDISLVSNNFGFLRLPVHFNPVETDAEWVITGVPFDASVSGRAGTRFGAEAIRRASVNLAWEHCRFPWDFDVRERLKIVDCGDLVYSFGDNQNFVEELEAHATALLKAGKRCLTFGGDHFITLPLLRAHAKHFGKLAMIHFDAHTDTYENGSRYDHGTMFYHAPNEGLIDAAHSVQIGIRTEFDRNLPFTVLSAPQVNEESVAQTVAKIKEVIGDLPVYLTFDIDCLDPAYAPGTGTPVCGGLSTDRALKILRALKDVNIVGMDLVEVSPAYDQSDITALAGATLALEMLYMQGAKKGLast
1 -96.500sp|Q9BSE5|SPEB_HUMAN Agmatinase, mitochondrial OS=Homo sapiens GN=AGMAT PE=1 SV=2  ali follow..  37  43...QPPSPEFVARPVGVCSMMRLPVQTSPE--GLDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLGTVNPST--GALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGLYHGAPFRRCVDEGLLDCKRVVQIGIRGSSNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVMGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVT. 350
2 -71.900sp|P78540|ARGI2_HUMAN Arginase-2, mitochondrial OS=Homo sapiens GN=ARG2 PE=1 SV=1  ali follow..  25  1..........MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQG-QKRKGVEHGPAAIREAGLMKRLSSLGCHLDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLSGNLHGQPVSFLLRELCISSASIVYIGLRDVDPPEYDIQYFSMRDIDRLGIQKVMERTFDLLRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQT. 326
3 -70.700sp|P05089|ARGI1_HUMAN Arginase-1 OS=Homo sapiens GN=ARG1 PE=1 SV=2  ali follow..  23  1............................MSAKSRTIGIIGAPFSKG-QPRGGVEEGPTVLRKAGLLEKLKEQECDVK--PFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLSGNLHGQPVSFLLKELCISAKDIVYIGLRDVDPGELGIKYFSMTEVDRLGIGKVMEETLSYLKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLA. 307
4 -6.390sp|Q92743|HTRA1_HUMAN(removed signalp:1-22) Serine protease HTRA1 OS=Homo sapiens GN=HTRA1 PE=1 SV=1  ali follow..  11  176...........................................EVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDDIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSQNTVTTGIVSTTQRGGKELGYIQTDAIINYGNSG---------------GPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRSGAYIIEVIP--TPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGN 444
5 -6.050sp|O43464|HTRA2_HUMAN Serine protease HTRA2, mitochondrial OS=Homo sapiens GN=HTRA2 PE=1 SV=2  ali follow..  12  176...........................................EVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSQNTITSGIVSSAQRPARDLGYIQTDAAIDFGNSGGP--------------LVNLDGEV-IGVNTMKVTA-GISFAIPSDRLREFLHRGEKSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSGVLIHKVIL--SPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGR 445
6 -5.980sp|P50613|CDK7_HUMAN Cell division protein kinase 7 OS=Homo sapiens GN=CDK7 PE=1 SV=1  ali follow..  11  19...............GEGQFATVYKARDKNTNQI-VAIKKIKLGHRSEAKDG--INRTALREIKL------------LQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWIL-----HRDLKPNNLLLDENGVL-KLADFGLAKTHQVVTRWYRAPELLFGARMYGVGVDMWAVGC------LAELLLRVPFL-DSDLDQLTRIFE--LGTPTEE-FKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQA............... 289
7 -5.780sp|Q96AB6|NTAN1_HUMAN Protein N-terminal asparagine amidohydrolase OS=Homo sapiens GN=NTAN1 PE=2 SV=3  ali follow..  11  3...................................LLVEGRRVRLPQSAGDLVRAHPP-LEERARLLR----------------------GQSVQQVGPQGLLYVQQRELAVTSPKDGSISILGSDDATTCHIVVLRHTGNGATCLTHCDGTDTKAE-------PLIMNSIKSFSDHAQCGRLEVHLVGGFSDDRQLS------------QKLTHQLLSEFDRQEDDITLCVTELNDREENENHFPVIYGIAV--------NIKTAEIYRASFQDRGPEEQLRAARTLAGGPMI............ 215
8 -5.780sp|P83105|HTRA4_HUMAN(removed signalp:1-31) Probable serine protease HTRA4 OS=Homo sapiens GN=HTRA4 PE=2 SV=1  ali follow..  12  168..............................................VYSGSGFIVSEDGLIITNAHVVRNQQWIEVVLQNGARYEAVVKDDLAVIKIESNAELPVLMLGRSSDLRAGEFVVALGSQNTATAGIVSTKQRGGKELGYVQIDATINYGNSGGP--------------LVNLDGDV-IGVNSLRVTDGISFAIPSDRVRQFLAEYHEHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHYPSGVYVCKVVE--TAAQSSGLRDHDVIVNINGKPITTTTDVVKA-LDSDSLSMAVLRGK 432
9 -5.740sp|Q9UHW5|GPN3_HUMAN GPN-loop GTPase 3 OS=Homo sapiens GN=GPN3 PE=1 SV=2  ali follow..  12  7........................................................................................................................LVMGGKSTYCATMVQHCEALNRSVQVVNLDPAAEHFN----YSVMADIRELIEVDDVMEDDSLRFGPNG--------GLVFCMEYFANNFDWLENCLGHVEDD---YILFD--------CPGQIELYTHLPVMKQLVQQLEQ-WEFRVCGVFLVDSQFMVESFKFISLAALSAMISL......... 165
10 -5.690sp|Q07002|CDK18_HUMAN Cell division protein kinase 18 OS=Homo sapiens GN=CDK18 PE=1 SV=3  ali follow..  13  149...............GEGTYATVFKGRSKLTENL-VALKEIRLEHEEGA--------TAIREVSL------------LKNLKHANIVTLHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMSMHNVKIFMFQLLRGLAYCHHRKIL-----HRDLKPQNLLINERGEL-KLADFGLARSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGC------HYEMATGRPLF-STVKEELHLIFR--LGTPTEETWPGVTAFSEFRTYSFPCYLPQPLINHAPRLDTD------GIHLLSSLLLYESKSR. 411

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Harder T, Godzik A. JAFA: a protein function annotation meta-server. Nucleic Acids Res. 2006 Jul 1;34(Web Server issue):W379-81.