current user: public

If you have questions about the server, please let us know.

Query: [P] COG0004 Ammonia permease, from COG1018

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470
# Score Template Links and tools%idFirst MFQKILIIGVSTLLLLTSPIMGNAWAQVPGTTPPADTGDTAFMLISAALVLLMTPGLAFFYGGFVRSRNILNTLMMSFVLMAIVGVTWVLWGYSLSFAPGLPFIGGLQWFGLNGVGLETTGYLQGSEPANVVSYAGTIPHQAYMIYQAMFAIITPALISGAIAERMSFRAYCLFVLLWSTFIYTPLAHMVWAKGGFLGLYGGLGALDFAGGTVVHISSGVSALVAAIVLGPRKTHPDRLSPPHNVTFILLGAGLLWFGWFGFNAGSALSVASSTSGSFITNPATTAFVATNTSAAAGALMWLILEGVLRGKPTAVGAATGAVAGLVGITPAAGFVTPLASILIGFITAFVCFYAVSFKHKLNVDDALDTYPVHGVGGTVGAILTAFFATAEVNSGGKNGVLKGNFGELGVELAAIVIAYVIAAVGTWIILKIIDATVGLRVKEEAEYQGLDISEHGEEAYNSEFSDRIVPLast
1 -136.000[P] COG0004 Ammonia permease  ali follow..  100  1MFQKILIIGVSTLLLLTSPIMGNAWAQVPGTTPPADTGDTAFMLISAALVLLMTPGLAFFYGGFVRSRNILNTLMMSFVLMAIVGVTWVLWGYSLSFAPGLPFIGGLQWFGLNGVGLETTGYLQGSEPANVVSYAGTIPHQAYMIYQAMFAIITPALISGAIAERMSFRAYCLFVLLWSTFIYTPLAHMVWAKGGFLGLYGGLGALDFAGGTVVHISSGVSALVAAIVLGPRKTHPDRLSPPHNVTFILLGAGLLWFGWFGFNAGSALSVASSTSGSFITNPATTAFVATNTSAAAGALMWLILEGVLRGKPTAVGAATGAVAGLVGITPAAGFVTPLASILIGFITAFVCFYAVSFKHKLNVDDALDTYPVHGVGGTVGAILTAFFATAEVNSGGKNGVLKGNFGELGVELAAIVIAYVIAAVGTWIILKIIDATVGLRVKEEAEYQGLDISEHGEEAYNSEFSDRIVP 470
2 -112.000[P] KOG0682 Ammonia permease  ali follow..  34  2.......................ARGDGHLWTETYDSSTVAFMILGAALVFFMVPGLGFLYSGLARRKSALALIWVVIMATLVGILQWYFWGYSLAFSKTATNNKFIGNLDS----------FGFRNVYGKISDDSTYPELIYAIFQMMFMCVALSIIAGATAERGKLFPHMVFLFVFATLVYCPITYWIWAPGGW---AYQWGVLDWAGGGNIEILSAVAGFVYSYFLGRRKENLLINFRPHNVSMVTLGTSILWFGWLLFNAASSLS---------PNMRSVYAFMNTCLSATTGGMTWCLLDYRSEKKWSTVGLCSGIICGLVAATPSSGCITLYGSLIQGIIAGVVCNFATKIKYYLKVDDSLDLLAEHGIAGVVGLIFNALFAADWVIGMDKGGWLTHNWKQMYIQIAYIGASAGYCAVVTAIICFVLGKIPGLRVTEEAEALGLDEDQIGEFAYDYVEVRRD.. 431
3 -68.900[UR] KOG3796 Ammonium transporter RHBG  ali follow..  11  1..................................MSSKYPRSVRRCPLWALTLEAALILLFYFFTHYDASLELVASYQVGQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALGVQ---WAILLDGFLSQFPSGKVVITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEVTALG--------------VISNIFNTDYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDTATIPSLSAMLGALFLWMFWPSFNSALLRSPIE----------RKNAVFNTYYAVAVSVVTAISGSSLPQGKISKTYVHSAVLAGGVAVTSCHLIPSPWLAMVLGLVAGLISVGGAKCNRVLGIPHSSIMGYNFSLLGLLGEIIYIVLLVLDTVGAGNG----MIGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHEAKY---FDDQVFWKFPHLAVG...... 416
4 -43.200[S] COG2839 Uncharacterized protein conserved in bacteria  ali follow..  22  4..............................................................................................................................................................................................................................LYWLLIALMLVGVVGAVVPAIPGTSLILIAIIIWGIVSSSFAAIKIPL------------IVTIIVLILSIGVDFLAGYLGAKQAGASKWGQIGAFVGLVLGFFGLLPALPFGGPLLGILFGPLLGAIVGYIYRREFWLAVKAGIGIV----VGTLVGNLIQGVLAIATVA............................................................................. 159
5 -7.600[U] KOG1278 Endosomal membrane proteins, EMP70  ali follow..  12  320....VILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLGHGLLSILVGSGMQLFLMGLVSPVSRGSLPTVMFVLYALFGF---VGSYASM-GPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCIAGIFSFGSIAVELYFIYSS--LWFNK----IFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWL--------------------WQ-WRSFIIGGL-------GCSIYTFIHSILFTKFKLGGVITVVLYLGYSL-------IISALCCVVTGAIGFFSSMFFIR-------------------KIYSAIKVE.......................................................................................................... 672
6 -7.210[P] KOG4505 Na+/H+ antiporter  ali follow..  10  8..................................ISKPHLAYAIIGGFTSLF-------LCSLIIKEKLFLG-----------EATMATATG--LIFGPYVAKLFVPTSWG----------------------------NTDYITEELARVLLVVEVFAAGAELPRAYFVMLLPVMIFGWLVSTGFMYALIPR------------LSFLESLAI-CITATDPVLASSIV---GKGKFARRVPGHLRNMLLAES-------GCNDGMAIPARHAGRDWVCIIILYECTFGCVLGAIIGVIARKMIKFSERRGLMDRESFLVFYFVLALFCGGIGTIIGVDDLLVSFCAGAAFSWDSWFSKKTEESHVSNVIDLLLNLSFF--VYVGAIMPWPQFHMPH------DLSVWRLVVLAICILIARRIPAVLLFKSFVPDIINWREALFAGHFGP----IGVGAL.......... 375
7 -6.640[C] KOG4664 Cytochrome oxidase subunit III and related proteins  ali follow..  11  15.......................................SPWPLTGAIGAMTTVSGMVKWFHQ-----YDISLFVLGNIITILTVYQWW-WGMILFILSEVLFFVSFFWAFFHSSLSPAIELGASWPPMGIISFNPFQIPLLNTAILLASGVTVTWAHHSLMENNHSQTTQGLFFTVLLGIYFTILQAYEYIEAPFTIADSIYGSTFFTGFHGIHVLIGTTFLLVCLLRHLNNHFSKNHHFGFEAAAWY--VDVVWLFLY-YWWGG............................................................................................................................................................................................................ 262
8 -6.480[S] KOG2632 Rhomboid family proteins  ali follow..  11  32............................................................................................................................................VCGVIYLICLLTGYDTFYEVCFLPSAIISRFQVYRFYTAIIFHGSLLHVLFNMMALVPMGSELGSVRLL---YLTVLLATTNAVLHLLIASLAGYNPFYQYDHLMNECAIGFSGILFSMIVI------------ETSLSGVTSRSVFGLFNVPAKLYPWILLIVFQLLMTNVSLLGHLCGILSGFS................................................................................................................................................ 206
9 -6.440[T] KOG2980 Integral membrane protease of the rhomboid family involved in different forms of regulated intramembrane proteolysis  ali follow..  19  145........................................................................................................................................................LVYALLGINVA---------VFGLWQLPKCWRFLQKYMLLQKDYVTSKISIIGSAFSHQEFWHLGMNMLAL---WSFGTSLAT-------------MLGASNFFSLYM-------------------------------NSAIAGSLFSLWYPKLARLAIVGPSLASGALFGVLGLFPHAKILLFVFPVPGGAWVAFLASVAWNAAGCALRWGSFDYAA-HLGGSMMGVLYGWYISKA................................................................................ 330
10 -6.410[P] KOG2349 Na+:iodide/myo-inositol/multivitamin symporters  ali follow..  13  19.........................................YVAFVSMFLLCIGIGIYFGFMNKSVSEDAFSLVASFVSGITLLGLPTEVYSYGIQYLYVSCGVI-MGVFYLPVFHDLNITSTYEYLEVRFDRRLRLYGSVMFAIMNVAYLPIVIYVPALAFNQVTGIGVHTITPIVIICVFYTSLG--VWTD---------QAISMLGALCLVAIIGGAGVVLERAWSSDRLEAPDLSIDPHTFWCLFFGGIVYWTQTNAVSQNMIQRYLSLPSLGDARKALCIFCVGVLILMALCGYNGLLIYATYQN-MKTLGELPG-MTGLFIAGVFSAALSSLST-CLNSMSAVVLEDFVKPYVKKPLSSSAINWIMRLVVVGVGVLCVCLVYVVEHM---------GTVLQLTMSLEAITNGPLFGIFTIGLFLPWINGNSAL............................... 447

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.