current user: public

If you have questions about the server, please let us know.

Query: [J] COG0017 Aspartyl/asparaginyl-tRNA synthetases, from COG1018

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst MKTTIKQAKDHLNQDVTIGAWLTNKRSSGKIAFLQLRDGTGFMQGVVVKSEVDEEVFKLAKEIAQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAHDYPITPKNHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTASAPEGTSELFHTKYFDQDAFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFTNHAESLEIQEQYVTHVVKSVLENCKLELKILERDTSKLEKVATPFPRISYDDAIEFLKAEGFDDIEWGEDFGAPHETAIANHYDLPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQRVKEHGLDEEAYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLLNRLYPLast
1 -148.000[J] COG0017 Aspartyl/asparaginyl-tRNA synthetases  ali follow..  100  1MKTTIKQAKDHLNQDVTIGAWLTNKRSSGKIAFLQLRDGTGFMQGVVVKSEVDEEVFKLAKEIAQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAHDYPITPKNHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTASAPEGTSELFHTKYFDQDAFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFTNHAESLEIQEQYVTHVVKSVLENCKLELKILERDTSKLEKVATPFPRISYDDAIEFLKAEGFDDIEWGEDFGAPHETAIANHYDLPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQRVKEHGLDEEAYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLLNRLYP 430
2 -119.000[J] KOG0556 Aspartyl-tRNA synthetase  ali follow..  29  92.YTQISDIAKNDGQTVLLRARVYTSRLQGKMCFFSLRQKYDTIQALAVVNKISKQMVKWCGSISLESIVLVEGIVKKSPEIIQDAEIHISSIYVISPIKKNLPFLVEVNLDTRLDNRVLDLRTPTNQAIFDIQAGICQAFREFLLSNSFNEIHTPKMSGASSEGGSNVFKIQYFKTDGFLSQSPQLYKQMLIADRERVFEIGPVFRAEDSNTYRHMTEFTGLDLEMAFNEYHEVMEFIEKLFLYIFKTIREKYAKQVAVVRQQYPSEILPDADRIRFHFKDAVKLLKEAGYRKDPEFDDFSTPEERALEKYHTDFYVIDKYPSSVRPFYTMPDPEDPRYSNSYDFFM--KGQEIMSGAQRIHDPELLVERMKALGVSPDVLQQYIDAFAIGCPPHAGGGIGLERVVMFYLNLPNIRLASSFPRDPKRLLP 580
3 -116.000[J] KOG0554 Asparaginyl-tRNA synthetase (mitochondrial)  ali follow..  38  97VKGGADEGLSRVGQSLNIMGWVRTLRSQSSVTFIEINDGSCNLQCVMTSDAEGYDQ-VESGSILTGASVSVQGTIVASQGTKQKVELKVEKIIVVGECDSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNTLAYATHKFFQESGFVWVASPIITASDCEGAGEQFCVDFFGKPAFLTVSGQLNGETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDDDMACATAYLQYVVKYVLDNCKEDMEFFDTWIEKGIIAEKEFLQLGYTDAIEILLKANKKPVKWGLDLQSEHERYIEAFGGRPVIIRDYPKEIKAFYMREN-DDGKTVAAMDMLVP-RIGELIGGSQREERLEVLEARLDELKLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFVTGIDNIRDVIPFPRTPASAE. 566
4 -114.000[J] KOG0555 Asparaginyl-tRNA synthetase  ali follow..  34  110.VIKIGESVQHRDQRVSIKAWVHRLRRQGKLMFLVLRDGYGFLQCVLNDKLCQSYD---AVTLSTETSVQVYGIIKALPDGKDGHELTVDYWEVIGKAPAGGIDNESAGVDVMLDNRHLVIRGENASRILRIRAAATRAMRDHFFAAGYTEVAPPTLVQTQVEGGSTLFGLDYYGEPAYLTQSSQLYLETCNAALGDVYCISQSYRAEKSRTRRHLSEYQHVEAECAFITFDQLMDRIEALVCDTVDRLLADPVTKSLIEFVN-PGYKAPARPFKRMPYKEAIEWLQKNDVRKFVYGEDIAEAAERRMTDTIGVPILLNRFPHGIKAFYMPRCADDNELTESVDLLMP-GVGEIVGGSMRIWKEDQLLAAFEKGGLDSKNYYWYMDQRKYGSVPHGGYGLGLERFICWLTDTNHIRDVCLYPRFVGRCAP 545
5 -84.700[J] COG0173 Aspartyl-tRNA synthetase  ali follow..  23  11........EQYLDQTVTVKGWVHRRRDHGGVIFIDLRDREGIVQVVIDPDT--PEAFAAADSSRNEYVLSITGRVRNRPEGTGKIEILAKEIEVLNAAATPPFQIDDISENVRLTNRVIDLRRPVMQRNLRLRYQVAMGVRRYLDAQGFIDIETPMLTRSTPEGARDYLVPSRVHPGEFLPQSPQLFKQLLVAGFDRYYQITKCFRDEDLRADRQ-PEFTQIDLETSFLNEDEIMDITEGMAKQVFKDALNV-----------------DLGDFPRMPYSEAMFYYGSD-KPDMRINLKFTELTDNGYFTDEWKPLWVVDFPAVHHPFTAMVSDPANCLARAYDMVL--NGWEIGGGSIRIHRADVQEKVFAALKISPEEFGFLLDNLKFGAPPHGGLAFGLDRLVTLMTGAESIRDVIAFPKTQR.... 568
6 -80.900[J] COG1190 Lysyl-tRNA synthetase (class II)  ali follow..  22  58.....NEELEALNIDVTVAGRMMTRRIMGKASFVTLQDVGGRIQLYVSRDDLPEGVYNEEKKWDLGDILGARGKLFKTKTGE--LSIHCSELRLLTKALRPLPDKFHADQETRYRQRYLDLANDESRHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVIPGGASARPFVTHHLDIDMYLRIAPELYLKRLVGGFERVFEINRNFRNEGVSP-RHNPEFTMMELYMAYADYKDLIVLTEELFRTLTETILGSSVVQYGEQTFDFG------KPFAKLTMKEAIC-LGIKVEKSWGLGRIQCEIFEETAESHLIQPTFITEYPAEVSPL-ARRNDDNPFITDRFEFFI--GGREIGNGFSELNDAEDQAQRFADQVSAKEA-EDYITALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPV... 504
7 -77.700[J] KOG1885 Lysyl-tRNA synthetase (class II)  ali follow..  18  115....LQPGDHLTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKEEFIHINNKLRRGDIIGVQGNPGKTKKGE--LSIIPYEITLLSPCLHMLPHLHFKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHLDMNLYMRIAPELYHKMLVGGIDRVYEIGRQFRNEGIDL-THNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDDFTPPFRRINMVEELE-KAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPL-AKWHRSKEGLTERFELFV--MKKEICNAYTELNDPMRQRQLFEEQAKAKAA-ENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE... 576
8 -66.100[J] COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II)  ali follow..  13  3.....................................................................................QLSLAFCSERVQFVISVSCDEPPMTNS-------DWMPTASISQLKQRATLLRQIREFFAERNVLEVETPAMSHATVHTFKTEFVGPGYGSALHLMTSPEFHMKRLLAGSGCIYQLGKAFRNEENGR-YHNPEFTMLEWYRIGFDHHALMDEMDALLQLVLRCGSAE-RMTYQEAFLNVLGVCPLEEEMRELKQVAATLGLSDIAEPEEDRDTLLQLLFSIGIEPKIGTPAFVYDFPASQAAL-AKINPADPRVADRFEVYF--KGIELANGFHELDNPAEQLARFKADNAKRLE-YHLIAALEAGLPECAGVALGIDRLIMLALGEDHIDKVTAFPFPRA.... 349
9 -59.100[J] KOG2411 Aspartyl-tRNA synthetase, mitochondrial  ali follow..  19  1.............................................................................................................................MQYNLRLRSQMVMKMREYLNLHGFVDIETPTLFKRTPGG-AKEFLVPS-GKFCSLPQSPQQFKQLLVGGLDRYFQVARCYRDEGSRPDRQ-PEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDP-----------------VVVPFPTMTFAEVLATYGTDGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPPFTALYTEPKKARSQHYDLVL--NGNEIGGGSIRIHNAELQRYILATLLKEDVKLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFR.... 427
10 -57.100[E] COG2502 Asparagine synthetase A  ali follow..  13  7...........................................................................................................................LQQQEISFVKNTFTQNLIEQL---GIIEVQGPILSQVGNEKAVQVNVKCIPNAVFEVVHSLAKWKRHTLARFN-FVHMKALRPDEDSLDPTHSVYVDQWDWEKVIPEGRRNFAYLKETVNSIYRAIRLTELAVEARFDIPSILP-------KQITFVHSEDLVKRENAICKEYGAVFLIGIGGKLSDGKPHDGRAPDYDDWTTESENGYKGLNGDILVWNDQL--GKAFELSSMGIRVDESALRLQVGLTGDEDHLKMDWHQDLLNGKLPLTIGGGIGQSRLAMLLLRKKHIGEVSVWPKEMLEEFS 327
11 -13.800[J] COG0016 Phenylalanyl-tRNA synthetase alpha subunit  ali follow..  13  1MREQLEALRDDAIKKIE----AQEKKVVQEIRVKYLGKKGPVTEVLRGMGKLSPEERPVI------------GQLANDVREAIGKAIESKMEALEQAEIHRKLQEETIDVTLPGRPVLKGGAHP---------TATITEVEDLFIGLGFSVAEGPQIETDKDHPARDMQDSFYFTDELLLRTQTSPVQARTMEKYKKIICPGKVFRRDDDDAT-HSHQFMQIEGLYV-VRMSDLKGVLQAFAKSF-----------------------------------------------------------------------FGEERSIRLRPSFFPFTEPSVEVGDGCRVCKQTGWIEILGAGM------VHPRVLEMSGFNPNEYSGF------------AFGMGVERLSMLKYGIDDIRHF............ 330
12 -11.700[S] COG3111 Uncharacterized conserved protein  ali follow..  15  47..TTVESAKSLDDTWVTLRGNI--VERISDDLYV-FKDASGTINVDIDHKRWNG------VTVTPKDTVEIQGEV---DKDWNSVEIDVKQIRKVNP............................................................................................................................................................................................................................................................................................................................................. 130
13 -11.500[J] COG0124 Histidyl-tRNA synthetase  ali follow..  12  17.................................................................................................................................VETWQWIEQKAYDLCRRYNYQEIRVPMFEHTELFLRGVGDTTDIVQKEMYLTLRPEGTASVTRAYVSKLFYIGPMFRYERPQSGRM-RQFVQFGVEALGSA--EVLALVMRFYEELLGDTDSRLAHREALVNHFKPRIHEFCNDCQDRLEKNPLRILDCKKDRDHELMGTAPSIHDYLSTESKAYFEKVQSYLTALNIPFVV----DATLVRGLD-YYNHTAFEVMVDGEGFGAITTL--------CGGGRYNGLVEEIGGPETPGIGFALSIERAIMAL..................... 317
14 -10.700[J] KOG1936 Histidyl-tRNA synthetase  ali follow..  12  71.................................................................................................................................MVVREKILDLVISCFKRHGAKGMDTPAFELKEGEDSGLMYDLDQGGELLSLRYDLTVPFARYLAMNKKRYHVGKVWRRESPTIVQRYREFCQCDFDIPMIPDAECLKIMCEILSGL-RRIVDGMFAVCGVPESKFRAICSSIDKLDKMAWKDVRHEMVVKKGLAPEVADRIGDSQNKQALEGLGDLKLLFEYLTLFG--IADKISFDLSLARGLDYYTPLNVGSVAAGG----RYDGLVGMFDPKGHK---------------VPCVGLSIGVERIFYIVEQRMKTKG............. 402
15 -9.330[L] COG5235 Single-stranded DNA-binding replication protein A (RPA), medium (30 kD) subunit  ali follow..  10  67.............HHVCFVGVVRNITDHTANIFLTIEDGTGQIEVRKDDSSGKGYGSQVAQQFEIGGYVKVFGALKEFGGKKNIQYAVIKPIDSFNEVLTHHLEVIKCHSIASGMMKQPLESASNNNGQSLFVKDDNDTSSGSSPLQRILEFCKKQCEGKDANSFAVPIPL--------ISQSLNLDETTVRNCCTTLTDQGFIYPTFDDNNFFAL...................................................................................................................................................................................................................... 273

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.