current user: public

If you have questions about the server, please let us know.

Query: [W] KOG1574 Predicted cell growth/differentiation regulator, contains RA domain, from COG1018

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MELKINIDGLERSVSGVTDTTTCSQIIYALAHATSQRGRFVMVEKYRNVERRLAPTDRPLETLRKWREHAANVTFQMLRVDQNDEICDLVDESVPLEPAKPYFHPKQTSTSSMVTSLPGRSAAGQQQLENGQRSTSSLPTYASAGGVTGTLGRNTRRPPPPDYMSVMEKKNITMGAATIPQKDDFDCFKRADVKKLSETMNQQEVAEYLVQEEELRQLLKQQKNLRAILKPMIAANWPQQYQLELKKSHKLKASLAATKEAINKTRSDILRVEETEKDLMKKLAEFKKQDENGDENSEVLETSFDLGCSGTSTPLTVIALast
1 -93.100[W] KOG1574 Predicted cell growth/differentiation regulator, contains RA domain  ali follow..  100  1MELKINIDGLERSVSGVTDTTTCSQIIYALAHATSQRGRFVMVEKYRNVERRLAPTDRPLETLRKWREHAANVTFQMLRVDQNDEICDLVDESVPLEPAKPYFHPKQTSTSSMVTSLPGRSAAGQQQLENGQRSTSSLPTYASAGGVTGTLGRNTRRPPPPDYMSVMEKKNITMGAATIPQKDDFDCFKRADVKKLSETMNQQEVAEYLVQEEELRQLLKQQKNLRAILKPMIAANWPQQYQLELKKSHKLKASLAATKEAINKTRSDILRVEETEKDLMKKLAEFKKQDENGDENSEVLETSFDLGCSGTSTPLTVIA 319
2 -12.500[T] KOG4239 Ras GTPase effector RASSF2  ali follow..  18  195................INSTMTTPQVLKLLLNKENSAEEFALYVV-SGEKQKLKATDYPLIARILQGPCEQISKVFLMEKDQVEE.......................................................................................................................................................................................................................................... 267
3 -10.600[U] KOG0946 ER-Golgi vesicle-tethering protein p115  ali follow..  534...EQLVQGLCALLLGILESYMKEKLKQLIEKRIGKE-DHEFTKLVKELEGVIQHDNIVTHYKNMIREQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLA 914
4 -9.040[S] COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain  ali follow..  82........................................................................................................................................................................LAQLRVAKTELEQASQAKEEIESELTAVREEQQLVQ-ERSRELNRNYTKALQLLRRVSEQSRNLRQE--SAERAQLNEQKDSLLAESSELQSQVKLRDQELSKRQERIAQQEKVLARQREQVQSLEKRFASLEAQRQQLQAEINQRDTKID 233
5 -7.880[R] KOG4398 Predicted coiled-coil protein  ali follow..  12  101.............................................................................................................................................................................................................ESLTEKQQRYINLQAGLKTFSTRYERLIGQ--HRSNEDRLMAIKAKRKQLELLQQLISGTGQRLRVLGERRDELRRANAEKRKNLPKYPDKVKMLENYVLDRVEKIEKLRETHL 212
6 -7.870[E] COG4177 ABC-type branched-chain amino acid transport system, permease component  ali follow..  16  1..MAVTVSRESDSVATPTQRALKEAFYAGAIA-----GLFVLFIGLKTGQNM----SNELVLTQRWGLLAAVVRFLY.................................................................................................................................................................................................................................................. 73
7 -7.850[OR] KOG0010 Ubiquitin-like protein  ali follow..  37MKVTVKTPKEKEEFA-VPENSSVQQFKEEISKRFKHTDQLVLI--FAG--KILKDQD----TLSQHGHDGLTVHLVIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNST.................................................................................................................................................................................................................. 138
8 -7.730[V] KOG1962 B-cell receptor-associated protein and related proteins  ali follow..  11  122.............................................................................................................................................................................................................CTQANLMAQSEASFKQAQSATAAARSLLEN--KNTEKAKEAGEDTTLIELNKLRERVQELTSDLNREKKDKEAVKSQAESINREYDRLTEEYSKLQKKITIGGGGNKDD..... 228
9 -7.610[O] COG5131 Ubiquitin-like protein  ali follow..  13  1MAIKVELLGGLDLLFNNLGSTKLGSLIDYMAQIIEKPSQKDLWELLEKEEYNLEEGDEVVFVSTLHGKTIFSIFFIIFKTN.............................................................................................................................................................................................................................................. 110
10 -7.610[O] KOG4146 Ubiquitin-like protein  ali follow..  13  1MAIKVELLGGLDLLFNNLGSTKLGSLIDYMAQIIEKPSQKDLWELLEKEEYNLEEGDEVVFVSTLHGKTIFSIFFIIFKTN.............................................................................................................................................................................................................................................. 110

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.