current user: public

If you have questions about the server, please let us know.

Query: [P] COG0004 Ammonia permease, from COG1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470
# E-value Template Links and tools%idFirst MFQKILIIGVSTLLLLTSPIMGNAWAQVPGTTPPADTGDTAFMLISAALVLLMTPGLAFFYGGFVRSRNILNTLMMSFVLMAIVGVTWVLWGYSLSFAPGLPFIGGLQWFGLNGVGLETTGYLQGSEPANVVSYAGTIPHQAYMIYQAMFAIITPALISGAIAERMSFRAYCLFVLLWSTFIYTPLAHMVWAKGGFLGLYGGLGALDFAGGTVVHISSGVSALVAAIVLGPRKTHPDRLSPPHNVTFILLGAGLLWFGWFGFNAGSALSVASSTSGSFITNPATTAFVATNTSAAAGALMWLILEGVLRGKPTAVGAATGAVAGLVGITPAAGFVTPLASILIGFITAFVCFYAVSFKHKLNVDDALDTYPVHGVGGTVGAILTAFFATAEVNSGGKNGVLKGNFGELGVELAAIVIAYVIAAVGTWIILKIIDATVGLRVKEEAEYQGLDISEHGEEAYNSEFSDRIVPLast
1 8.000e-72UniRef50_D2R6C6 Multi-sensor hybrid histidine kinase n=1 Tax=Pirellula staleyi (strain ATCC 27377 / DSM 6068 / ICPB 4128) TaxID=530564 RepID=D2R6C6_P  ali  30  8.....................................ANLIWVLVCAALVMFMQAGFCMLETGFSRAKNSINVAIKNLIDFCLSGLIYWAFGFAIMFGSSYFGFFGKSMFLLDG--------------------SQTPWLLAIFLFQMMFCSTATTIISGAVAERIRFSAYLLVAMFVSGLIYPVFGHWAWGGGVETGWLAKLGFIDFAGSTVVHSIGGWCALAITLILGPRFGRFTDPMHGHSLALSTLGALTLWFGWFGFNGG---------STLAINSSVPIILVNTNLAAAAGGVAALLLAWRCEKLPSVSQGINGVIAGLVGITASCHLVEPMGAVTIGAVSGMIAVLGTYLLERYKIDDVVGAVPVHGMSGAWGTLAVALFVSVDKFPLG-----NSRIDQIGIQGIGVLCCFAWAFAVPWCVFSVVNYFRPLRTDLHHELQGLNVTEHG.............. 398
2 1.000e-70UniRef50_A3ZR98 Ammonium/methylammonium permease n=2 Tax=Blastopirellula marina TaxID=124 RepID=A3ZR98_9PLAN  ali  33  7....................................SLDIAWMLICAALVMLMQGGFCLLESGMARAKNSFNVALKNLIDFCVSSVIFWAFGFALMFGASYHGLFGTTNFLLED--------------------SASPWLMAFLFFQLVFCGTATTIISGAVAERIRFQGYXXXXXXXXXXXXXXXXXXXXGGGTPTGWLAQLGFIDFAGSTVVHSVGGWVALAAVVVIGPRIGRFDRPISGHNLTLATFGALVLWFGWFGFNGGSTLSMNS---------DVPKILVNTNLAGAMGALTCLVLSKWVHKRPDVGQVMNGAIAGLVGVTASCHILAPWAAALVGAGSGLICSGVTYLLPKMKIDDVIGAVPAHACAGCFGTVALALLADP-----VHFGEGVTRWQQLGVQLLGVGTCFVWAFGGGYAFISLANLVMPFRVPRDHELRGLNISEHG.............. 399
3 4.000e-70UniRef50_F0SQ35 Multi-sensor hybrid histidine kinase n=2 Tax=Planctomycetaceae TaxID=126 RepID=F0SQ35_RUBBR  ali  30  1.......................MSSAGKKMALSLELANVAWMLGAAALVMLMQGGFCFLESGLSRAKNSINVAMKNILDFCISAIVFWVVGFGIMFGMDWNGWIGTSLFLFEDLDNSWLCA--------------------FLLFQLVFCGTATTIVSGAVAERMRFSGYXXXXXXXXXXXXXXXXXGGVVPGTGSGWLAERGFIDFAGSTVVHSVGGWVALIAAMLVGPRTGRFGPNIRGHNYPMATMGTLLLWFGWFGFNGG---------STLAIDGSVPRILINTNLAAAAGGVAGMLVSYAVHRRPDVGDIINGVIAGLVAVTASCHILSPSAACVVGATAALVCKAATLLLERFEIDDVIGAFPAHACCGAWGTLLLAVLADPERFGTGLN-----NWEQFKVQLLGVVVCASWSCATAALALGVMRLFTPLRVSELAEQQGLNMSEHG.............. 405
4 5.000e-69UniRef50_A0A182PF20 Uncharacterized protein n=2 Tax=Anopheles TaxID=44484 RepID=A0A182PF20_9DIPT  ali  24  851.MNSRRCMMMWALKAANATMGESAGAATSTTPSPLNVEDTNWVLTSSFIIFTMQTGFGMLESGCVSVKNEVNIMMKNIIDIVLGGFTYWLFGYAMAFG--------------RGELNNPFVALGDFLIDPGVSDPLFGPIFAAFLFQLSFSTTATTIVSGAMAERCNFKAYCIFSFFNTIVYCIPAGWV----WGEHGFLKNLGVVDIAGSGPVHLIGGASAFASAAILGPRLGRYAKGTDPGNPVNACMGLFVLWWGWLAFNSGSTYGVSGAKWAYAARAAVM----TMMGSFGGGSFSIIYSMINNDGRMDVVDLINGILASLVSVTAGCYLYHAWEAILIGAIGSALCCFGMPLFDRMGVDDPVGASSVHGIAGIWGVLAVGLFADNETTSGRSGLFKGGGWYMLGVQSLSALCLACWGVCSTFVLLWLINKVVPIRMDPNEELLGADLMEH............... 1308
5 2.000e-68UniRef50_UPI000C03D377 uncharacterized protein LOC111277532 n=1 Tax=Durio zibethinus TaxID=66656 RepID=UPI000C03D377  ali  26  608............ATALASFLCTRFSTISNQLSDTTHAIDNTFLLFSAYLVFAMQLGFAMLCAGSVRAKNTMNIMLTNVLDAAAGALSYYLFGFAFAFGTPSNGFVGRHFFGLKSYPSPSSDYS-------------------FFLYQWAFAIAAAGITSGSIAERTQFVAYLIYSSFLTGFVYPIVSHWFWSGYGWASATFGSGVIDFAGSGVVHMVGGIAGLWGALIEGPRIGRFDRAGRGHSASLVVLGSFLLWFGWYGFNPGSFLTIMKGYGSGGGWSAIGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVIDVCNGLLGGFAAITSGCSXXXXXXXXXXXXXXXXXXXXXXXXXSKLKYDDPLEAAQLHGGCGAWGLLFTGLFATKAYVNEVYPGFMGGGGKLFAAQIIQILVITGWVTATMGPLFYVLHKMKLLRISREDETAGMDFTRHGGFAYVYHDEED... 1066
6 3.000e-68UniRef50_A0A139WEF3 Uncharacterized protein n=2 Tax=Tribolium castaneum TaxID=7070 RepID=A0A139WEF3_TRICA  ali  25 3713...SSTIVALKASKSSKVRVQSRNTTAPIPWLYDIDPEDTNWIITSSFMIFTMQTGFGMLESGCVSIKNEVNIMMKNVVDIVLGGLTYWIFGFGLSFGRS--------------PLSNGFIALGDFFTDPLLKDPLKGAIYAAFIFQLSFATTATTIVSGAMAERCNFKAYCIFSFLNTAIYCIPAGWM----WGDQGFLKKLGAVDIAGSGAVHLIGGSSAMASALMLGPRLGRYDNGIKSGNPVNAVMGLFVLWWGWLAFNSGSTYGLSGEKWHYAARAAVM-----TMMSSFGGGTASLLYSLIRQGRIDAIDIINGILGSLVAVTAGCFLYEAWEALIIGVVGALLACGFMPLFDLMGIDDPVGASAVHGVGGIWGVLAVGFFADNETTNGRRGLFKGGGWYLLGVQSLACVCLSCWGIVSSMILLWCINKIVTIRMEVHVELLGADLTEH............... 4149
7 4.000e-68UniRef50_A0A2E2B792 Uncharacterized protein n=1 Tax=Phycisphaeraceae bacterium TaxID=2026777 RepID=A0A2E2B792_9BACT  ali  29  12..................................ASSLDMIWVLLCSALVMLMQAGFCCLESGLCRTKNNINVALKNLMDYCITGMVFWAVGFWLMFGSSEHGLIGL--------------------IRAPIGDDASPALLTFFLFQVTFAGTSATIISGAVAERVRFSAYAFTTLVIGALVYPIIGHWCWGGGTNVGWLQKMGFVDFAGSTVVHSVGGWVSLAALIIIGPRKGRFGAGAKPIQASNXXXXXXXXXXX------XXXXXXXXXGSTLGVSDQIPRIMVNTSLAAAAGSCAMLAIAFMSRAQPTVDRLINGVVAGLVAITAGCHVVSPFSAVIIGAVGGMVCSFVTQLLIRCRIDDVIGAVPAHAGAGVWGTLAVALFGNPELIGTGL-----SWTQQLLVQFTGVTSAFVWAFGVGMVVLYSVDRITPLRVQAEDEIKGLNVAEHG.............. 405
8 7.000e-68UniRef50_F9X1I0 Ammonium transporter n=6 Tax=Dikarya TaxID=451864 RepID=F9X1I0_ZYMTI  ali  36  27.........................SLTQDLNVFYNAGDIAWMLTATALVCLMVPGVGFFYSGLARRKSALSLIWLSVMSTAVVSFQWFFWGYSLAF----------SHTATNGFIGDLDSFGLKGVLGAPSLGSAKIPDLMYAVYQGMFACMTMALLTGAVSERGKLLPCVIFMFIWTTIVYDPIACWTWNPNGWSY---KLGGLDLAGGTPVHIASGTAALAYSYMLGPRTGHGTPNYRPHNVTHIVIGTVFLWVGWFGFNAG---------SALGANLRAIMAAVVTNLAAGVGGITWCLVDYRLEAKWSTVGFCSGVISGLVCITPGSGYVPAWAAVIYGICAGIGCNFATQLKFWMNADDALDIFAVHGVGGFIGNLLTGIFAADDGFTEIQGGWLNRHWIQLAIQLADSVTGMVYSFTMTIAILFLMNLLGRLRASAEEELAGIDDVEIGEFAYDYVELTRDV. 461
9 1.000e-67UniRef50_A0A2M8NA57 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8NA57_9CHLR  ali  29  4.................................DQQTLDYLWILVSSGLVFLMQAGFLCLESGLTRSKNSINVAIKNLIDFGLTTILFWAFGFALMFGATRGGWIGTSNFMPNFQLNNP----------------ENTRILIFLVFQVMFCGTAVTIISGAVAERMKFSSYXXXXXXXXXXXXXXXXXXXXSNLQNTGLLGGRGFVDFAGSSVVHSVGGWASLAILIIIGARTGRFAPDGTPRNLPLSALGVLLLYVGWFGFNGGSTLQMN---------TQVVHVIANTVIAGSAGMIAATFVGWSLRKRAEVDLVMNGILAGLVAITANAHAVSTLDAVIIGAIGGLVMLAVHHLLLRFKIDDAVGAVPVHLGGGIWGTLAVGIFGQAEYLGTGL-----SRIDQIGIQLTGVIICGLWTFLTVYIVMRFINRIHPLRVTTEQEQLGLNVSEHG.............. 410
10 3.000e-67UniRef50_A0A2S8FIS4 Histidine kinase n=3 Tax=Blastopirellula marina TaxID=124 RepID=A0A2S8FIS4_9PLAN  ali  32  1..............................MPSALPQLDIAWMLICAALVMLMQGGFCLLESGLVRAKNSFNVALKNLIDFCISSAVFWAFGFAIMFGASYHGWFGTTGFFL--------------------DETADPWLLAFFLFQLVFCGTATTIISGAVAERIRFRGYXXXXXXXXXXXXXXXXXXXXGGGEATGWLAKSGFIDFAGSTVVHSVGGWVALAAILVLGPRLGRFDKEIHGHNLTLAMFGVLLLWFGWFGFNGG---------STLAMNDQVPMIIVNTNLAGAFGGLAGLIVSWIIHRRPDVGHTMNGAIAGLVGITASCHXXXXXXXXXXXXXXXXXXXXXTELLPRLKIDDVIGAFPAHACAGVFGTLVLAFLAD-----TRHFGEGMTHWSQFLVQLQGVTACCVLSFGGGFAFIYLVNKVFPFRTIAEHEMAGLNISEHG.............. 398
11 9.000e-67UniRef50_UPI000BAF5EF4 putative ammonium transporter 3 n=2 Tax=Crassostrea virginica TaxID=6565 RepID=UPI000BAF5EF4  ali  27  16......................................DSVWILSSTFIIFTMQSGFGLLESGSVTVKNEVNIMMKNAVDVMFGGLTFWMFGYGLGFGDEPG----------------SNPFCGWGDFFVHANSSELGWTYSKFFFQSSFATTATTIVSGSMAERTRLDAYIVFSML-NTFIFCIPAHWVWAPGGWLY---EMGVIDIAGAGPVHVVGGVTGLVATLMLKPRHGRFSEQPPMASPTNAILGMFMLWWGWLGFNCGSTFGISGLKWKLAARSAV-----TTAMASVAGGIVGIMTSYICKKRFDVVYTINGILGSLVGITASCALAKPWEAMVIGVCSSLLTNGICELLSKLKIDDPVGCVGTHAASGIFSLLASGFLTEKDELADATGLVYSGDFRQLGIQALAVVSICAWATITSLVFLKVIQLTVGLRVSLEEEIIGSDIVEH............... 419
12 2.000e-66UniRef50_UPI000B9B58A9 ammonium transporter n=1 Tax=Hydrocoleum sp. CS-953 TaxID=1671698 RepID=UPI000B9B58A9  ali  32  92..........................STSQSQPTYEAIDILWLLLCSGLVFLMQPGFMCLESGLTRSKNNINVAIKNLTDFGISVACFWGFGFAFMFGASATGIIGHSNFFLA--------------------TDLQPFDAAFFLFQAMFCGTATTIVSGAVAERMKFSAYLFVSFIVSGFIYPIFGHWVWNGGLLTGWLGQRGFIDFAGSTVVHSIGGWVSLAALLVIGPRTGRFPGDRPPENLPLSVLGAMLIWFGWFGFNGG---------STLALNGQVAGIIVNTVLASVAGMVTALGIGWYIREIPGVELLINGTLAGLVAITAACHXXXXXXXXXXXXXXXXXXXXXEQALEKIRVDDAVGAIPVHLGAGIWGTLAVALFGKAEILGTGLSLS-----QQFTVQLLGVCAGFILGFCVVYPILLITNKFFLLRVSREDEYIGLNVSEHN.............. 495
13 3.000e-66UniRef50_A0A182I898 Uncharacterized protein n=4 Tax=Cellia TaxID=44534 RepID=A0A182I898_ANOAR  ali  24  427.MNSRRCMMMWALKAANTTMGSPGAASTTPSPGAFQSLDTNWVLTSSFIIFTMQTGFGMLESGCVSVKNEVNIMMKNIIDIVLGGFTYWLFGYAMAFG--------------RGELNNPFVALGDFLIDPGVSDPLFGPIFAAFLFQLSFSTTATTIVSGAMAERCNFKAYCIFSFFNTIVYCIPAGWV----WGEHGFLKNLGVVDIAGSGPVHLIGGASAFASAAILGPRLGRYAKGTDPGNPVNACMGLFVLWWGWLAFNSGSTYGVSGAKWAYAARAAVM----TMMGSFGGGSFSIIYSMINNDGRMDVVDLINGILASLVSVTAGCYLYHAWEAILIGAIGSALCCFGMPLFDRMGVDDPVGASSVHGIAGIWGVLAVGFFADNDTTSGRSGLFKGGGWYMLGVQSLSALCLACWGVCTTFVLLWLINKVVPIRMDPNEELLGADLMEH............... 882
14 1.000e-65UniRef50_A0A255QQP9 Uncharacterized protein n=1 Tax=Rhodopirellula sp. MGV TaxID=2023130 RepID=A0A255QQP9_9PLAN  ali  29  4...................................EQLDLVWVLICTGQVLMMQAGFCLLESGFSRAKNSINVAAKNLADVCVAMLCFWLVGFGLMFGSSHAGLFGTSEFCFEATNSKLT---------------------CFFLFQAAFCGTATTIISGAVAERMRFRAYLFISVFVSAIVYPVCGHWAWGGGQAIGWLAERGFVDFAGSTMVHSVGAWTSLAAVLVIGPRLGRFSKPIRGSSLPSAVLGAVLLWFGWLGFNGGSVLGLSEG---------VPAILLNTCLAAASGGCLPLLLSIFFGKTFELSDSINGVIAGLVSITAGCHAVSPLAAIGIGAAGGLVCIAATQLLTQLKIDDSINAIPAHGAAGVWGTVAFAIFADPAYFAEGLN-----RWQQLEIQVVGASSVFVWTFGVSLAVFAVVNHFWPMRVDRKTEYCGLNTAEH............... 394
15 3.000e-65UniRef50_A0A1G6YRS7 Ammonium transporter, Amt family n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1G6YRS7_9PROT  ali  28  104....IAVLLATGAPSHAETLADLRAEMEVALASQQASMDHMWTMTAAALVFLMQAGFLLLEAGMVRSKNSINVAQKNIADFVIATAGFYVIGFGVMFGPS-------------------XXXXXXXXXXXXTFGQLDDWSYTFFVFQVVFCGTAATIVSGAVAERMSFTAYLAVTCFISILIYPVFGHWAWGNGDNPAILADMGFIDFAGSTVVHSVGGWVALAGVIVIGPRIGRFDPPIHGHSAVLSTAGAILLWVGWIGFNGGSTTTGDP---------AFAHIISNTILAGAFGSIASMLIGRQVDGLFRPDRAINGVLGGLVGITAGCDAVSTYGAVFIGLSSGVVVVLAAHVIEWLRLDDCIGAVPVHGVCGAWGTIMAGALAVPEALAASD------RLTQVGVQMLGVGMGFLWAFGTAYIFFRLLDATIGIRVSAEEELQGLNVAEHG.............. 531
16 5.000e-65UniRef50_W9RHX1 Ammonium transporter n=9 Tax=Pentapetalae TaxID=1437201 RepID=W9RHX1_9ROSA  ali  26  28...................LCSRFNAVSDKLTATTYAVDNTYLLFSAYLVFSMQLGFAMLCAGSVRAKNSMNIMLTNVLDAAAGGLSYYLFGFAFAFGSPPNGFIGRHFFGLKTFPSHS-------------------ADYSFFLYQWAFAIAAAGITSGSIAERTQFVAYLIYSSFLTGFVYPIVSHWFWSPDGWASPSFGSGVIDFAGSGVVHMVGGIAGLWGAFIEGPRLGRFDHTGRGHSASLVVLGSFLLWFGWYGFNPGSFITIDGERVYYGQWSGVGRTAVTTTLAGCTAALTTLFGKRLLVGHWNVTDVCNGLLGGFAAITSGCSVVEPWAAIVCGFVAAWVLITSNKLAELVKYDDPLEAAQLHGGCGAWGLLFTGLFATKEYVGEVYGGFMGGGGRLVAAQVVQILVVAGWVTATMGPLFYGLNKLRLLRISKDDEMAGLDLTRHGGFAYLYHDED.... 479
17 6.000e-65UniRef50_U9VVR5 Ammonium transporter n=3 Tax=Leptolyngbya TaxID=47251 RepID=U9VVR5_9CYAN  ali  31  4....................................SLDALWVIVSASLVFLMQAGFLCVEAGSTRRKNNINVAIKNIADVGLSILMFWAFGYGLMFGTSLHGWLGVSNFL-------------------PDFNQTDSWPIIFFLFQAMFCSTAVTIVSGAVAERMTFKGYLFSAVLISGFVYPIFGHWVWGGAETIGWLTHKGFIDFAGSTIVHSLGGWVALAAVLVIGPRLGRFSRQNPSSDLPLAFLGALLMWFGWFGFNGGSALAFNDQ---------VPKILVNTLLAGAAGLTAPLTWSLMVQKHLPFKAVMNGSLAGLVSITASCHAVSSSSAVLIGGIGGLVMLGVDALLDKLRIDDAVGVIPVHLGPGIWGTLAVALFSDLERLETGLD-----RWGQFAAQVSGVLACGLWSFTVTLLILWQLNRYVSLRVSHKQEYIGLNVSEHG.............. 399
18 1.000e-64UniRef50_A0A2P6VIU4 Ammonium transporter n=1 Tax=Micractinium conductrix TaxID=554055 RepID=A0A2P6VIU4_9CHLO  ali  29  669........................................LWILQCAFLVFFMQCGFALLEAGTVRLKNTKNILLKNVIDACVGTIAWWAVGYAFAFGCEENGFIGYHNFFTSDVPANPGLF------------------WATWLFGWAFASTSSTIVSGAMAERTKFRAYLLYTMCISAFIYPCVAHWVWSSSGWLSISGTMGLLDFAGSGVVHMVGGGAALVGAVMLGPRLGRFSQDGHNSSPANMALGVFILWLGWYGFNAGSTQCFYGCMP------IAAQVAVNTTLATGAGGLTCLFLAVFNGNPGDIGPLLNGILAGAVSITASCAMVQSYCAVIIGGIGALIYMSAARLLVRLRIDDPVDAAPVHFCCGAWGLLATGLFATKTSTEAAYGVIYGGSGKQLGMQVLGIVVIGGWSCTLSALLFGLLKKLNWLRVPKDDELQGLDYAQ................ 1085
19 2.000e-64UniRef50_F6HI11 Ammonium transporter n=8 Tax=Pentapetalae TaxID=1437201 RepID=F6HI11_VITVI  ali  26  18........AATNTTAVADYLCSRFDTIAARLSDTTYAVDSTYLLFSAYLVFAMQLGFAMLCAGSVRAKNTMNIMLTNVLDAAAGAISYYLFGFAFAFGSPSNGFIGRHFFGLKDFPSSSFYYTF---------------DYSYFLYQWAFAIAAAGITSGSIAERTQFVAYLIYSSFLTGFVYPVVSHWFWSPDGWACPTFGSGAIDFAGSGVVHMVGGVAGLWGAFIEGPRIGRFDRTGRGHSASLVVLGSFLLWFGWYGFNPGSFITIGESRGYYGQWSAVGRTAVTTTLAGCTAALTTLFGKRLLAGHWNVTDVCNGLLGGFAAITSGCSVVEPWAAIVCGFVAAWVLIGCNKLAERVEYDDPLEAAQLHGGCGAWGLLFTGLFATKKYVREVYAGPSDRPYKLLAAQFIQIIVVSGWVTVTMGPLFYALHKLKLLRISSEDEMAGMDLTRHGGFAYVYNEDDE... 485
20 3.000e-64UniRef50_A0A210QRI3 Ammonium transporter n=2 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210QRI3_MIZYE  ali  29  7................................GPITWDDATWILTSSFIIFTMQSGFGLLEVGCVSGRNEVNIMMKNAVDVIFGGLSYWAVGFGLSFGMDYG----------------SNPFCGVGSFFVDSSDERMGLLFATFVFQLSFATTATTIVSGAMAERTKMTAYILFSIT-NTVVYCIPAHWEWATNGFLR---TMGCVDIAGSGAVHLTGGMSAMVAAIILKPRLGRYDKQKTPPNPVSALVGMFMLWWGWLAFNCGSTFGISGGKWKLAAKSAV-----TTLIGSMGGGATGVIISYIISRKYAVDYLVNCVLCALVSITAGCAVIRPWEALLIGAIGGVICIGSTKLMDKMRIDDPVGATAVHGAGGIWGMLAVGLFAENEPLENTTQGFHGGGFYLMGIQMLXXXXXXXXXXXXXXXXXXXXKYTVGLRLSEEEERLGADIVEHNIGA........... 415
21 3.000e-64UniRef50_A0A2H3DLH2 Ammonium transporter n=42 Tax=Dikarya TaxID=451864 RepID=A0A2H3DLH2_ARMGA  ali  36  13.......................TATDTDGVVSVYNNGDITWTLTCTALVWLMIPGLGYMYSGLLRRKNALSQIYLSLVCLAVVSFQWFFWGYSLAFSETGSAYI-----------EDLKYFGLKGVLDAPSMGTARLPALVFCLYQLMFAAATPMIALGALAERGRLAPVPIFIFAWSMLVYDPVACWTWS---ANGWSFVMGGLDFAGGTPVHITSGTAALAISIYLGKRKGTGRLMYKPHNTTYVILGVVFLWFGWFGFNGG---------SALSANLRAAHACIVTNLAASMGGLTWMLWDYRLEKKWSAIGFCSGAISGLVAITPACGFVGAPAAVLFGVMAGTCCNFATQLKYTFGYDDTLDIWASHGIGGVLGNVLTALFAQADGISVIDGGWIDHHYIQLGYQLADSVSGVAYTFVMTTIILWTMRFIPGLRGSEEAEVDGLDEHDMGEFSYDYVGLEQDV. 444
22 6.000e-64UniRef50_A0A061RAT2 Ammonium transporter n=1 Tax=Tetraselmis sp. GSL018 TaxID=582737 RepID=A0A061RAT2_9CHLO  ali  28  14........................TSTEDPLVRLELSGFMFWKLFGAALVFFMQCGFALLESGCVQAKNAKNILTKNIMDACLGALLWYFVGHAFAFGDDFGHFIGTTWNDFSGCG-----------------------DYAKLMFQWAFAATSATIVSGAVAERCQFPAYLIYSAVMTGLVYPLVAHWSWTNGWLVSKLPAAGFFDYAGSGVVHITGGSAALVGAAVIGPRHGRFVN---GSAVLMRGHSTXXXXXXXXXXXXXXXXXXXXSRGGFLDMYRATRVSACTTLAAASGGCGALLLHLVHFGAPDVMPALNGILAGLVSISAGCSVVEPYIAAMIGLLSSPVYYYSSALLERFLIDDPLDASAVHLSCGLWGVISVGLFANQDYMAEQGGLIYSKDFTQLGSQLAGAAAICGWSLACSSILFLLLKRANLLRVPLEDECNGLDKSYHGGEAY.......... 428
23 1.000e-63UniRef50_K1QFY1 Ammonium transporter n=1 Tax=Crassostrea gigas TaxID=29159 RepID=K1QFY1_CRAGI  ali  27  16......................................DSIWILSSTFIIFTMQSGFGLLESGSVTVKNEVNIMMKNAVDVMFGGLTFWMVGYGLGFGDEPG----------------ANPFCGWGDFFVHANSSELGWTYSKFFFQSSFATTATTIVSGSMAERTRLDAYIVFSML-NTFIFCIPAHWVWAPGGWLY---EMGVIDIAGAGPVHLVGGVTGLVATLMLKPRHGRFNEQPAMGSPTNAILGMFMLWWGWLGFNCGSTFGISGLKWKLAARSAV----TTTLASVAGGIVGTMTSYIFKQRRFDVGYTINGILGSLVGITASCALAKPWEALVIGVCSSLITNGVCELLSKLKIDDPVGCVGTHAASGMFSLLASGFLTEKDELTDAPGLVYSGDFRQLGIQALAVVSICGWTVVTSVVFLKLIQVTVGLRVSLEEEIIGADIVEH............... 419
24 8.000e-63UniRef50_A0A1S4FGF9 Ammonium transporter n=22 Tax=Neoptera TaxID=33340 RepID=A0A1S4FGF9_AEDAE  ali  27  36......................................DTNWVLTSSFIIFTMQTGFGMLESGCVSVKNEVNIMMKNIIDIVLGGFTYWLFGYAMSFG--------------RGELNNPFVALGDFLIDPSVTDPLFGPIFAAFLFQLSFSTTATTIVSGAMAERCNFKAYCLFSFLNTIVYCIPAGWV----WGEHGFLSNLGVVDIAGSGPVHLIGGSSAFASAMMLGPRLGRYAKGTDPGNPVNACMGLFVLWWGWLAFNSGSTYGVSGAKWIYAARAAVM----TMMGSFGGGSFSIIYSMVRNEGRLDIVDLINGILASLVSVTAGCFLYHAWEAIVIGIIGSALCCLSMPLFDRMGVDDPVGASAVHGVAGIWGVLAVGLFADNDTTNGRSGLFKGGGWYLLGVQSLSALCLICWGICVTLALLWIINKIVPIRMDPNEELLGADLMEH............... 437
25 3.000e-62UniRef50_A0A1Q9CKZ3 Ammonium transporter 2 n=1 Tax=Symbiodinium microadriaticum TaxID=2951 RepID=A0A1Q9CKZ3_SYMMI  ali  28  686......RRLQAVGNVTATAWATEKAALEATDGSMGAAMDTLWLCLCGALVMFMHAGFAMLETGCCRSKNASNVLMKNLVNVCVGTLGWWVLGYAFAYGGGINRFIGTTNFLGEGFY---TKDASGNILAPGCANNACQSTALAWFFQWAFCTAGATIVSGAVAERVQGPTYASYAFVMTSLIYPVVVHWGWSGSGFLGDILDVGVMDFAGSGIVHLTGGVSGLAGTIVLGPRKGRFPEEFEPHNLPLVVFGTFALWFGWYGFNPGSTLGMSDGATGALAAQVAM----NTTIAAATGGITVFLLRYIILRKYDVGGLCNGILAGLVSITAPCGNIECGSAFAVGFIGALVYQGSSMLLQKLKIDDPVDASPVHGFCGIWGVLAAGLFDWGKGFDHFHGWSGWG................................................................... 1077
26 4.000e-62UniRef50_D2R466 Histidine kinase n=1 Tax=Pirellula staleyi (strain ATCC 27377 / DSM 6068 / ICPB 4128) TaxID=530564 RepID=D2R466_PIRSD  ali  28  2.............................QFATAQDAMNTVWMLICAALVFFLQAGFCCMECGLSRSKNSINAAIKNVADFCLAGALFWLTGYAFMFGKSFYGLFGITEFFFEETYDSNWLT-------------------VFFIYQVMFCGTCSTIASGAVSERMRFKAYACMSVLVGGIIYPVFGHWVWTRPNMPGWLANLGFIDFAGSTVVHSLAGWVALAAVIHVGPRMGKFL----PDGRITRFHGXXXXXXXXXXXXXXXXXXXXXXXRAMELAGNVPKIWINTLLAGIFGGAGNLLWQIVTRKRIDICSFMNGIIAGLVAICATCNVAWDFGAVFIGISAGLIMELASDILERFKLDDVVNAISVHGVAGAWGTLLVAFITPPEFMPQG-----WSRLDLLLVQMLGISVCFCWSFGITWVALSILKRYMPLRVTIEEEEAGLNVAEH............... 402
27 4.000e-62UniRef50_B3V618 Ammonium transporter n=2 Tax=environmental samples TaxID=2231195 RepID=B3V618_9EURY  ali  28  8.FKRLMLFSLGFVILLN--MLYSVKAEDSTPDSNAANIDLLWMLMCAVLVFMMQAGFMCLESGIIRNKNNINVALKNVSDFGISIVCYWMIGYGFMFGASKSGFIG-----------------FDDFFFDPSGTITSGPAMTFFIFQSMFCATAASIISGAVAERLKFNSYXXXXXXXXXXXXXXXSDDNFGGDGTTGWLYDLGFIDFAGSTVVHSTGGWIGLAIILLIGPRSGRFIEKFAPSNLPLSVLGVLLLGFGWHGFNGG---------SNLVLDEEVPGILLNTFLAGAAGIVACLLYWGFQNSTAPAGDLINGLLAGLVAVTASANWVTPQGAVIIGAGGGIVALYATRLLEKWELDDPVGAIPVHLAGGMFGTLALPFFAVEEHIIENNNLNNYTRINQFIAQSIGIISVGLYTFLVSYVLLKTINNYNPLRVSQEAEDIGLNIAEH............... 447
28 4.000e-62UniRef50_A0A0H3KAX9 Ammonium transporter n=20 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0H3KAX9_SYNP6  ali  53  75.............................................................GGFGRAQNVLNXXXXXXXXXXXXXXXXXXXXYSLAFDTSLPFIGGFSNLFFNGVGGKF-----GIDPV----WAGDMSASSFALFQGMFAIITPALISGALVERVNFKAWFWFGLLWSTLVYIPMAHMVWGSNGFI--YGQIGALDFAGSTVVHIASGVGALVSVAMIGPRRVFPNRLSPPHNVPFILLGAGLLWFGWFGFNGAS----------YFAAQGAGFAFLTTNTAAATAMLTWLLLEQIDLGKPTAVGAATGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVKSRIRLDDSLDAFGVHGVGGTVGAILTGIFAQKDVEKAFPTQFKVISQGPLAMTWAXXXXXXXXXXXXXXXXXXXXKSVMRVRATEEQELEGLDFALHGEDAYSKE....... 469
29 5.000e-62UniRef50_A0A2D4VIA0 Ammonium transporter n=1 Tax=Parvibaculum sp. TaxID=2024848 RepID=A0A2D4VIA0_9RHIZ  ali  33  1..........................................MLVCTVLVLLMQAGFTCLESGLVRAKNSINVAVKNVVDFCVSGLGFWAIGFGLMFGASQSGLIGASEFAMVGQAGSSDVL---------------PWTMVFFFFQLAFCSTSTTVVSGAVAERMNFRGYIITAAILSTLIYPVFGHWAWGGGESAGWLEKLGFIDFAGSTVVHSVGGWIALAAIIVMGPRIGRFGKDGRPHDMPIATLGMFLLWIGWFGFNGG---------STLALNASVPFILVHTMLAAAAGGFAVVMVTWWRNGLPPVDQTINGVLAGLVAITANCHLVNTPXXXXXXXXXXXXXXXXXXXXEAHKIDDAVDAVPVHLAAGVWGTLAVAIFGDQAQFLDG-----HTRLEQFGVQLLGVSVAGVFAFGAGFVVLKIVNRFLPLRVSEEAERMGLNVAEHG.............. 391
30 5.000e-62UniRef50_P54144 Ammonium transporter 1 member 1 n=365 Tax=Eukaryota TaxID=2759 RepID=AMT11_ARATH  ali  27  8....LAVLLGPNATAAANYICGQLGDVNNKFIDTAFAIDNTYLLFSAYLVFSMQLGFAMLCAGSVRAKNTMNIMLTNVLDAAAGGLFYYLFGYAFAFGSPSNGFIGKHYFGLKDIPTAS-------------------ADYSNFLYQWAFAIAAAGITSGSIAERTQFVAYLIYSSFLTGFVYPVVSHWFWSVDGWASPFFSTGAIDFAGSGVVHMVGGIAGLWGALIEGPRLGRFDNGGRGHSASLVVLGTFLLWFGWYGFNPGSFNKIYETGTYNGQWSAVGRTAVTTTLAGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITGGCSVVEPWAAIICGFVAALVLLGCNKLAEKLKYDDPLEAAQLHGGCGAWGLIFTALFAQEKYLNQIYGLFMGGGGKLLGAQLXXXXXXXXXXXXXXXXXXXXLKKMKLLRISSEDEMAGMDMTRHGGFAYMYFDDDESH. 476
31 7.000e-62UniRef50_U9VYP1 Ammonium transporter n=4 Tax=Bacteria TaxID=2 RepID=U9VYP1_9CYAN  ali  29  3...................................SSFDVLWVILCAILVSTMQAGFCCLESGLVRAKNSINVAIKNLVDFCIASLIFSLIAFRLMFGETAWGLIGTQ---------------------LPTPNSWSAEDYTFFLFELAFCGTATTIVSGAVAERMRFSGYFFTSXXXXXXXXXXXXXXXXXXXXXSGWLRELQFHDFAGATVVHSVGGWMAFSSILILGPRLGRFNPNPRPHNLPTAVLGVFLLWFGWFGFNGG---------SGLAFDDQVPRILVNTAEGGAAGGFTALVTTWILHKRPKVPVIMNGVIGGLVSVTAGCDVLWSFGAISAGSIGGLLCTFSTQWLNHFQIDDAVGVVPAHLVCGIWGTLTVALFGDPQLWAANYTFLEK-----LGIQALGISVTGLYAFVSSYALLKLIDYFYPLRVTPEQEYVGLNISEHN.............. 394
32 1.000e-61UniRef50_Q294C0 Ammonium transporter n=4 Tax=obscura group TaxID=32355 RepID=Q294C0_DROPS  ali  26  31......................................DTNWVLTSSFIIFTMQTGFGMLESGCVSIKNEVNIMMKNVIDIVLGGFTYWLFGYGMSFG--------------RGPLSNPFIAIGDFLLDPPVGDALMGQIFAAFLFQLSFATTATTIVSGAMAERCNFKAYCLFSFLNTAVYCIPAGWV----WGEHGFLNKLGAVDIAGSGPVHLIGGASAFASAAMLGPRLGRYSEGYDPGNPVNACMGLFVLWWGWLAFNSGSTYGVSGAKWQYAARAAVM----TMMGSFGGGFTSSIFSFWRHDGGMDIMDLINGVLGSLVSITAGCFLYRAWEALVIGAIGSLLCVLAMPLFDRLGVDDPVGASAVHGVCGIWGVIAVGLFADNDTTNGRMGLFKGGGWYLLGIQTLSALCLASWGICSTFLLLYVINKIIPIRMDPHEELLGADLTEH............... 432
33 4.000e-61UniRef50_A0A2N5VV84 Ammonium transporter n=1 Tax=Puccinia coronata var. avenae f. sp. avenae TaxID=200324 RepID=A0A2N5VV84_9BASI  ali  39  52.............................................................SGLLRRKNALSMIFLSMAVYGVVSFQWFFWGYSLSFAPEASRFIGT-----------LSQFGFINVDMQPSIGSPKIPALGYAIYQMMFATITPMIALGAIAERGRVAPALVFAFVWSTLVYDPIACWTWNP---SGWTAKMGTLDFAGGGPVHMSSGTAALAYSIWLGKRRGYGTQKYRPHNVSHVVLGTAFLWFGWFGFNGG---------SALAANLRAFQAIMVTNTAAAVGGLTWLLLDYWQERKWSPVGFCSGAIAGLVGITPASGYVGTPASVAIGMITAVVCNYSTKLKIILQCDDALDIFASHGIGGFVGSILTGIFADHDGTTVIPGGWINHHYMQILYQLGSSCAIMGYAFAATMIILVCMDYIPGLRATPEAEVIGIDEHELGECAYDYALLERDL. 445
34 4.000e-61UniRef50_A0A100IKH7 Nucleoside diphosphatase n=1 Tax=Aspergillus niger TaxID=5061 RepID=A0A100IKH7_ASPNG  ali  33  9................STPEGGDPTQVDVNAQYTGSEYNYVYITTCTFIVFLILPGIGMLYSGLSRRKSALALLFQAFMVLAVSTFQWLFWGYSLAYSRDGGPFIGT-----------LKNFGLMDVLVAPSPGSAVLPEVVFCLFQLLFCACTVMIVVGGAFERGGIVPSLIFSFFWATIVYCPLARWTWSSNGWLY---NLPAIDFAGGGPVHIASGCTALAYALVLGKRRDHGDPSIKPHNTTLVFLGTVMIWTGWLGFNGG---------SSLNASMRAMVAVFNTNTAGCTGILGWVLVDMIRYGKFTVVGACEGAIAGLVGITPAAGCVSLWLAACIGFITAIVCSSLKNVNEWINVDEGMDVFKLHGLGGMVGAFLTGLFASEKISATLSPGAIDGNGVQVGKQLAEICAISSYSFVVSYLMLLILKYIPGLRVSDEDEMLGLDRTQ................ 431
35 6.000e-61UniRef50_A0A1V5KVA2 Ammonium transporter n=31 Tax=Bacteria TaxID=2 RepID=A0A1V5KVA2_9BACT  ali  43  3......LTACKRMLPLTLPILSPVYAQSP--APGADSGATXXXXXXXXXXXXXXXXXXXXXGGLVRTKNVLGTMMHSXXXXXXXXXXXXXXXXXXXXGPNA--LGG--WIGWK----KEYFFLSGIDTTILNAH---VPEYVFAMFQGKFAMITPALIAGAFAERVSFRGYCLFITLWSLLVYNPLCHWVWASDGFLF---KLGTIDFAGGTVVHIAAGVSGLTAALYLGARRGYPKTAMNPSNLVMTLMGAGLLWVGWFGFNAGSSVSSGMDTA---------RALAVTQVAAATGAAMWMVIEALQHGKATXXXXXXXXXXXXXXXXXXXXXXXPAGAMALAALASLICYASIQIKNRMGYDDSLDVFGIHGVAGLLGALFLSFFAEAAAKAGGSWTAWQ----QLTVQSXXXXXXXXXXXXXXXXXXXXXEKTVGFRLEGKLESAGMDSSLHGEHGY.......... 437
36 7.000e-61UniRef50_A0A173TUR6 Ammonia transporter n=53 Tax=Bacteria TaxID=2 RepID=A0A173TUR6_9FIRM  ali  27  4.......................................SVWYLLGAVLVFFMQCGFAMVETGFTRAKNAGNIIMKNLMDFCIGTVVFFVLGYGIM--NSENYFFGLIGRPEYQMFTDFANF-----------------DWSNFFFQLVFCATAATIVSGAMAERTKFSTYCIYSAVISAIVYPIEAGWVWNSAGWL---AKLGYVDFAGSSVIHMVGGIASVIGAAMLGPRIGKYTKGKDGKTVVNAFPGHSLTLGALGCFILWFAWYGFNGAAASDPTQLA-QILGTTTIAPAVATFVCMMFTWIRNGAPDVSMCLNASLAGLVGITAGCANVDAVGATIIGLVDGILVVIVVEFIDKLKIDDPVGAVAVHGCNGLWGTVAVGLF------DYNNGVFYGGGFHQLGVQVLGVVCIAAYTAVAMTIVFTILKHTIGLRVSAEEEIMGLDIAEHDASAYADF....... 400
37 7.000e-61UniRef50_UPI00077DC44B uncharacterized protein LOC662093 isoform X2 n=1 Tax=Tribolium castaneum TaxID=7070 RepID=UPI00077DC44B  ali  26  608.....................SRNTTAPIPWLYDIDPEDTNWIITSSFMIFTMQTGFGMLESGCVSIKNEVNIMMKNVVDIVLGGLTYWIFGFGLSFGRS--------------PLSNGFIALGDFFTDPLLKDPLKGAIYAAFIFQLSFATTATTIVSGAMAERCNFKAYCIFSFLNTAIYCIPAGWM----WGDQGFLKKLGAVDIAGSGAVHLIGGSSAMASALMLGPRLGRYDNGIKSGNPVNAVMGLFVLWWGWLAFNSGSTYGLSGEKWHYAARAAVM-----TMMSSFGGGTASLLYSLIRQGRIDAIDIINGILGSLVAVTAGCFLYEAWEALIIGVVGALLACGFMPLFDLMGIDDPVGASAVHGVGGIWGVLAVGFFADNETTNGRRGLFKGGGWYLLGVQSLACVCLSCWGIVSSMILLWCINKIVTIRMEVHVELLGADLTEH............... 1026
38 9.000e-61UniRef50_A0A2B4RPW4 Ammonium transporter n=5 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4RPW4_STYPI  ali  28  1..............MSRETSTTSPPTIQAGNGESIDSDDATWILTSAFIIFTMQSGFGLLESGMVSRKNEANIMVKNAVDVIYGGLSYWLFGFALSFGKQQIGNG----------------FSGLGYFLTDANESEMGQVFSKYFFQLSFSTTATTIVSGAMAERTNLKAYTLYSFLNTLTYTLP-AHWIWAENGWLR---RMGAVDIAGCGAVHLVGGMSGLVATMILKPRTGRFDTNSPPASPTNVLLGTFMLWWGWLGFNCGSTFGISGMKWKLASRSAV----VTINGSIGGGILGMLYSYVFFKKKIDIPTFVTGILAGLVSITAICSLARPWEALLIGAIGAMLACPGCALLEWLKIDDPVSCVPTHGLAGIWGLVAVGLFAEKDILSNEFGVFKGGPWRFLGIQLLMSVVIATWAGVTTLLELLLVDRLLGLRMSVEEELLGADKVEHGI............. 426
39 1.000e-60UniRef50_A0A2N2SN88 Ammonium transporter n=1 Tax=Betaproteobacteria bacterium HGW-Betaproteobacteria-21 TaxID=2013713 RepID=A0A2N2SN88_9PROT  ali  30  6.....................................IDVMWVVVCAGLVFLMQAGFLCLESGLTRSRNAINVAIKNVVDFAIAVALYWGFGFALMFGSSAFGLVGAD------------------RFMVPVGHGSVNSLAAFFLFQAMFCSTAATIVSGAVAERMRXXXXXXXXXXXXXXXXXXXXXXXXGGGGERGWLGELGFVDFAGSTVVHGVGGWVALAGVLMIGPRSGRFDQPISGGNLPLAMLGVMLLLFGWLGFNGG---------STLALDERVPGILVNTVLAAVGGILSGLALGWYVRGYADVIQTLNGAIAGLVAVTAGAHVLGAGSAMVVGGGGALVMVLCHEWLLKLRIDDAVGAVPAHLAAGIWGTLAVALLGDLDALGTGL-----GRGEQLLVQLLGVACCGLWSFGVAWLLLRGLNRILPLRVSADEEQVGLNVSEHG.............. 399
40 1.000e-60UniRef50_A0A1G1KW73 Ammonium transporter n=2 Tax=PVC group TaxID=1783257 RepID=A0A1G1KW73_9BACT  ali  27  7.....................................LDCLWVVFCAILVFMMQAGFLCLEAGLTRSKNAINVAIKNITDFGISSLLYWAFGFAWMFGQTYRGWIGTSYFFITP---------------------DNPWVASFLLFQIMFCGTAVTIISGAVAERMRYRXXXXXXXXXXXXXXXXXXXXXXNLIGARGWLSQLGFIDFAGSSVVHSVGGWASLAVLLVLGPRLGYFPSKDAPRTFXXXXXXXXXXXXX----XXXXXXXXXXXXXTFELGPAFPGIIVNTVLAGSGGMLTALAVGWIWQGYPKVLFLMNGSLAGLVAITAGCFAVDPLFAIVIGSVGGVVMAAAQHLMDRFRIDDVVGAVPVHAAAGIWGTLAVALFGKPELLATGL-----SRWEQFQVQCLGVGVCFIFAFGVTFVLTYLINRIFPMRVTLADELQGLNITEHRET............ 399
41 2.000e-60UniRef50_Q9VFA9 Ammonium transporter n=88 Tax=Neoptera TaxID=33340 RepID=Q9VFA9_DROME  ali  26  27......................................DTNWVLTSSFIIFTMQTGFGMLESGCVSIKNEVNIMMKNVIDIVLGGFTYWLFGYGMSFG--------------RGPLSNPFIAIGDFLLDPPVGDALMGQIFAAFLFQLSFATTATTIVSGAMAERCNFKAYCLFSFLNTAVYCIPAGWV----WGEHGFLNKLGAVDIAGSGPVHLIGGASAFASAAMLGPRLGRYSEGYDPGNPVNACMGLFVLWWGWLAFNSGSTYGVSGAKWQYAARAAVM----TMMGSFGGGFTSSIYSFWRHGGGMDIMDLINGVLGSLVSITAGCFLYRAWEALVIGAIGSLFCVLAMPLFDRMGVDDPVGASAVHGVCGIWGVIAVGLFADNDTTNGRSGLFKGGGWYLLGIQTLSALCLACWGVCSTFLLLYVINKIIPIRMDPHEELLGADLTEH............... 428
42 2.000e-60UniRef50_C3YB73 Ammonium transporter n=3 Tax=Deuterostomia TaxID=33511 RepID=C3YB73_BRAFL  ali  26  24...............................DENQYSDDATWILTSAFIIFTMQSGFGLLESGTVSPKNEVNIMVKNASDVLYGGLAYWMFGYAFSFGES----------------PWSNAFCGLGQFFVDAEEAKMGWVFSKFFFQMSFATTATTIVSGAMAERTKLQAYMAFCVLNTLVFCFPSHWA----WDSKGWLNKLGYVDVGGAGPVHLLGGVCSLVATLILGPRHGRWDRDPPMGSPTNALLGMFMLWWGWLGFNCGSTFGITGGKWKLAARSAVSTITA----SMGGGIVAVVLSYVTKNQKFDISYLINGILGALVGVTGICALAHPWEGLVIGAVGSFLSCVGTEMMVKLRIDDPVGCFPVHGLCSVWAILAVGIFGHVDALEGISGLLKGGGFYLLGVQALGAVTFISWACAMSFILLKGIDKIIGLRVSLEEELIGADICEHG.............. 429
43 3.000e-60UniRef50_M6DJ49 Ammonium transporter n=9 Tax=Leptospira TaxID=171 RepID=M6DJ49_9LEPT  ali  33  38............................................................ESGLVRSKNSINVAIKNLLDYVFGTICFFLIGYGFMYGTSLDGWIGKDLFFLEGL--------------------NTGKEFAFFLFQVTFMGTAATIVSGAVAERIRFQAYLVCSIFVSLLIYPVFGHWAWGGGWLS----KSGFHDFAGSSVVHSVGAWVALAGVIVLGPRKDRFDSEGKPHNLPFSVLGTFILWFGWFGFNGGSTLSLTDE---------VPKIIVNTSLAACSGCSAAILFDYITKGVPHVSGAINGVLGGLVAITAGCDVMSPGXXXXXXXXXXXXXXXXXXXXENLKVDDVVSAFPVHGVGGIWGTLAVSVFAQEEAL---------RSWNQWQAQLTGVAVCAVWSFSMGLILFFLMKFTISIRVTSEEEERGLNESEHG.............. 397
44 5.000e-60UniRef50_D5SR57 Ammonium transporter n=2 Tax=Planctopirus TaxID=1649480 RepID=D5SR57_PLAL2  ali  26  3................................DAFQSVSLLWVMCAAILVFMMQGGFCLLEAGVTRTKNSINVALKNLTDFCISAMIFWLFGYGIMFGHSAYGWIGTS----------RFMPDEQFFSIGSTPTAASAIALGFFLFQMMFCGTSTTIVSGAVAERIRFAGYLVLTVVLSGLIYPLFGHWAWGGGSPTGWLAKLGFVDFAGSXXXXXXXXXXXXXXXXXXXXRLGRFDPRIRGHNLVLATCGVMLLWVGWFGFNGG---------STLALNSQVPRILVATNLAAIASCLTALFMAWWIEKRAIVEMTLNGALGGLVAVTASCXXXXXXXXXXXXXXXXXXXXXXXXXXDDFKIDDVVSAVPVHAACGLFGTVFWPLFTPEQSFQHG-----MSCLQQFGVQLLGSGVAFVWAFGVGGVCIYLINKVMPLRVRARDEIVGLNFVEHG.............. 408
45 5.000e-60UniRef50_C3YBU0 Uncharacterized protein n=2 Tax=Branchiostoma TaxID=7737 RepID=C3YBU0_BRAFL  ali  27  31....................................SDDATWILTSAFITFTMQSGFGLLESGSVSTKNEVNIMVKNASDVLFGGLTYWIFGYAFSFGES----------------PLSNSFCGIGQFFVDADEANMGWIFSRFFFQMSFATTATTIVSGAMAERTNLMAYILFCML-NTLIFCFPAHWVWDSRGWLR---KLGSVDIAGAGPVHLVGGTVSLVATLMLGPRYRRFDKKDPMACPTNALLGMFMLWWGWLGFNCGSTFGITGGKWKLSARSCIKDVAVATITSSMAGGIVGLLLSYTTTRMFEIPYLLNGVLGSLVSVTGICALAHPWEGLFIGAVGALIACGSTELLERWQIDDPVGAVPVHFSCAVWSLISIGIFGRIDTLSQFNGLIAGGGFYLLGIQVLAATSQIAWTIITSYLILKVVDVTVGLRVPLDKEILGADYCEHGVGG----PDDRDMP 454
46 6.000e-60UniRef50_A0A2E9IPQ0 Ammonium transporter n=1 Tax=Puniceicoccaceae bacterium TaxID=2026784 RepID=A0A2E9IPQ0_9BACT  ali  29  3..................................KESLDIAWMIIAAAFVMSMQLGFCFLESGMVRAKNSINVAIKNLADFCVSAAIFWLVGFGIMFGSSQWGLFGSGFFFFQTDRDXXXXXXXXXXXXXXXXXXXXX--------------------SGAVAERMRFNAYLVITVFTSGLVYPFFGHWAWGGGTESGWLAKLGFLDFAGSTVVHSTGGWVALAAVIIIGPRVG------QLDSPERKIQGHNXXXXXXXXXXXXXXXXXXXXGSTLEFNNDVPKVIANTIISGAFGGVTAMLTAYFYYKQTRAAALMNGIIGGLVSITSCCNVVSAPSAALIGVAAGIICFYGMHLLEKMKIDDAVGAVSAHAFCGAWGTIAVALLGEPERWSTGL-----SRSDQLTAQLLGIATCFVWSFGTAYVFFKLLNKFTKLRVTEEEELAGLNVSEHG.............. 396
47 8.000e-60UniRef50_UPI000B91140F putative ammonium transporter 2 isoform X1 n=2 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B91140F  ali  27  35.................................PNDWDDPIWILTSAFVIFTMQSGFGLLESGTATSKNEVNIMVKNAVDVIFGGITYWMVGYAFSFGDQ------------EHENKNAFSGYGNFFLDVEADDTGIGQRYSHFIFQLAFATTATTIVSGAMVERTRLEAYIIFSLLNTLISSFPSHWV----WAKDGFLFKMGVVDVAGGGPVHIAGGVTGLVATLMLKPRHRRYKTSDPPPSPTNAILGMFMLWWGWLGFNCGSTQGITKDKWALAARSAVATICS----SMAGGIGGITLSYLTKRRKFDIGYLIDGVLGALVSITAMCTLCPPKFSLVIGLIGGCIACGGVELLNKLKIDDPVGVVPVHFFCGAWSLVAAGLFVKHDSIEETNNGFMGGGPALLGIQLLTVVCITAWCGIIACIILKIISLTIGLRFPFHEELLGADMVEH............... 445
48 2.000e-59UniRef50_A0A2D6R274 Ammonium transporter n=2 Tax=Bacteria TaxID=2 RepID=A0A2D6R274_9BACT  ali  30  53.................................LQANLDTFWLLMCSVLVFLMQAGFMCLESGLTRRKSSINVALKNIADFGIAVVTFWAFGFGLMYGASYSGLVGTKYFLFFTNVAGYQ---------------------TYFVFQAMFVATAATIISGAVAERLKFFSYXXXXXXXXXXXXXXXXFDFSNPIRKFGWLGKLGFIDFAXXXXXXXXXXXXXXXXXXXXXPRTGRFNKIFQGSNTPMAALGSLILWFGWFGFNGG---------ANLAMDIRIPLILINTFMAASAGLISSSIMGVIVMRKPEPMFMITGPIAGLVSITASCAFVSPSXXXXXXXXXXXXXXXXXXXXEKLKIDDVVNAIPVHLICGIWGTLAIAIFGDIE-----KMGIEITRAQQLYVQLIGVVSIGAFCFFTSYIIFKIINYFYPLRVSKINEELGLNIAEHN.............. 452
49 2.000e-59UniRef50_A0A1I8IJK6 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8IJK6_9PLAT  ali  26  490.................TELARQIHQLEAQVNATNDSLNDYFRCIASILIWFMQCGFAFLEAGAVRSKNVTNILIKNMMDSFVGGIAYYLFGYALAFGEPGSFFCGTRYWAL---------------------HNLSSSEYSHVFLNYVFASTSATIVSGAVAERCEFAAYMFYTVLIAGFAYPIATHWAWSDSGWLGESGVSGFQDHAGSGVVHLLGGTSAFVAACILKPRLHRFDPAKPRDIRGHSVPVVSLGAFILFFGFFAFNGGSLNHITGKGDGVVVATAMLNTCISGCVAAFITLILVRLHSKTWSLLSAVNGALAGMVSICAGCNSYQPWAAVIVGFLAPYFYLAVARLVLKFRVDDPLEAVGVHFGGGLLGLLAVPFLKDGDGL---VFGAHPRGGMDLLWQLIGACAISGWSAAASFIIFGVLHLLGMFRVPAEVEEKGLDIPKHGEPAYPLMAYGH... 927
50 4.000e-59UniRef50_D4H5F9 Ammonium transporter n=10 Tax=Bacteria TaxID=2 RepID=D4H5F9_DENA2  ali  30  7......................................NIMWVLVCSFLVALMQAGFACLETGFVRSKNNVNVAVKNLVDFCISASLFTLIGYGLMFGDSFFGIVG--------------------EFSYISISKTSIEEITFYVFQLMFAGTAATIISGAVAERMKFSGYIIVTIFMSVLIYPICGHWAWSSGSLTGWLGKFGFMDFAGSTVVHSVAGWCALAAVIIIGPRLGRFGRNGRAIDGQNXXXXXXXXXXX------XXXXXXXXXGSTLAINDNVPIIIANTTLAGAAGGISAMFFSWYKYGMPKVEHIINGVVAGLVAICAGCNLFNEXXXXXXXXXXXXXXXXXXXXXEKRLIDDVIGAVPAHLVAGVWGTLSIALFAPVTSFSVAS-----GRFEQFGIQLVGVAAIGFYSFNVMYFVIMGLKKWVKFRVTEDDERIGLNISEHG.............. 396
51 5.000e-59UniRef50_A0A136HWF0 Ammonium transporter n=1 Tax=Alteromonas sp. Nap_26 TaxID=1795869 RepID=A0A136HWF0_9ALTE  ali  30  1.MRLLNRLNAVAIVTPLLPF-KAMANTSKDLDALFGNVDIIWLAICSALVFIMQAGFCFLETGCVRKKNTLNVAIKNVSDMMIAVLGFAFVGYALMFGDSWNGFIGTSGFSLKGVIE--------------------PYDIMFFLFQAMFAGTIATIVSGAVAERMQFSSYLVVAFVCATFIYPLVGHWTWNSDGWL---AQMGFIDFAGSTVVHSVGAWVALAGVIVLGPRMGRFNKDGYGHDLLLTAMGVFLLWFGWFGFNGG---------SLLEASDQIPLVLMNTVIAACAGGMINLMFSRVSSDQIRIERILNGVLGGLVAVTASAHIVELTSAVIIGAVGGLVAHYASEFMLHLKLDDPVSAVPVHGFAGAWGTLAAAFYSHDS----------GSMLSHMTTQXXXXXXXXXXXXXXXXXXXXXXRLFGQLRVSEDHEISGLNVAEHG.............. 418
52 8.000e-59UniRef50_A0A1G7LQW9 Ammonium transporter n=3 Tax=Thalassobaculum TaxID=526215 RepID=A0A1G7LQW9_9PROT  ali  32  2....................................SVDVIWLVFCAGLVFVMQPGFACLESGLARSKNSINVATKNVADFIVCTFFYLVIGFGLMFGDSQYGLFGGSLLFFNAQSADLV---------------------AFFMFQLMFCGTAATIISGAVAERMPFKAYXXXXXXXXXXXXXXXXXXXXXXXXXQGWLAEIGFVDFAGGTVVHSVAGWVSLAAVIIIGPRIGRMGPNFRSHSLPMATLGMFLIWFGWIGFNGG---------SLLTADERVPLIILNTMVAGSMGGLGAIVVGYWRGGRVEVADLINGCLAGLVAITPTAHCVGLASAALLSFIGGILCLFACEAIRKMGIDDAVNAFPVHGVSGVWGTLCVAIFGDLELIGTGL-----GRLEQFGVQCVGVTAAIVWAFGLGYVLLRLADRVVHLRVPEAWERIGLNVSEHGES............ 393
53 1.000e-58UniRef50_A0A232M472 Uncharacterized protein n=1 Tax=Elaphomyces granulatus TaxID=519963 RepID=A0A232M472_9EURO  ali  38  92.............................................................................................SLAFSHTAGKYIG-----------NLDNIGFRNVLAAPSVGSSKIPDLLFAIYQGMFSAITVALAVGAVAERGRMLPCVVFMFVWSTIIYDPIACWTWNP---SGWVSQLGGLDFAGGTPVHISSGSAALAYSLMLGKRRGHGTHNYRPHDVTHVVIGTVFLWVGWFGFNAG---------SALSANLRAVMAAVVTNLAASTGGVTWCLLDYRLEKKWSTVGFCSGVIAGLVAITPGSGFVPAWSAIVFGVVGAAACNYGTKLKYLLGIDDALDIFAVHAIGGLVGNLLTGLFAADDGYTVIPGGWINRNYIQLAYQLSDSVTGFAYSFVGSCIILFVMNFIPGLRSTEDDEIMGIDDAEIGEFAYDYVEITRDV. 453
54 2.000e-58UniRef50_A0A1S9RBD0 Uncharacterized protein n=7 Tax=Penicillium TaxID=5073 RepID=A0A1S9RBD0_9EURO  ali  39  55.............................................................SGLARRKSALXXXXXXXXXXXXXXXXXXXXXYSLAFSHTAGSFIG-----------DLANFGMKDVLAAPSVGSTKVPDXXXXXXXXXXXXXXXXXXXXXXXERGRMLPCIIFMFIWTTVIYDPIACWTWN---ASGWVFKLGGLDFAGGTPVHIASGSAALAYSLMLGKRRGHGTHNYRPHNVTHVVIGTVFLWVGWFGFNAG---------SALSANLRAVMAAVVTNLAASVGGVTWCLLDYRLERKWSTVGFCSGVIAGLVAITPGSGFVTPWAAFIFGVVGAVACNYATKLKFLLRVDDALDIFAVHAVGGLVGNLLTGLFAADDGVTEIAGGWINHNYIQLGYQLADSVTGFAYSFVGTCIILFIMNLIPGLRAPEEDEILGIDDAEIGEFAYDYVEVTRDI. 448
55 2.000e-58UniRef50_A0A286GMZ0 Ammonium transporter n=1 Tax=Caenispirillum bisanense TaxID=414052 RepID=A0A286GMZ0_9PROT  ali  26  12.......................................VTWVLLSSFLVALMQAGFACLESGMVRAKNSINVAIKNLVDFCISCALFTLIGYGLMYGPSIGGWIGLPD--------------------FPLDPDSPPADVTFFIFQAMFCGTAATIISGAVSERMRXXXXXXXXXXXXXXXXXXXXXXXXNGGVAGGWLAQMGFIDFAGSTVVHSVGGWVSLAAILVIGPRIGRFGQAGRPID------GHNLPMATLGVFLLWFGFFGFNGGSTLALNASVPIIIANTALAGACGGLAALAASWLTQGMPRVDRIINGVLAGLVASCAGCNVMGAEAAMVVGLVAGLLVVASMRLLERLEIDDVIGAVPSHLVAGAWGTLAVALLARPDVFPTA-----DSRLHQLVIQATGVAAVGLFSFGVPYVLLRLLDRVMPLRVSADDERIGLNIAEHG.............. 400
56 2.000e-58UniRef50_A0A2A5BGI7 Ammonium transporter (Fragment) n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2A5BGI7_9GAMM  ali  29  4........................................SWLLITSILVFVMQAGFLCLESGKIRSKNSINVAAKNIADFIVSANIFWIFGFALMFGYSNNGFIGTDGFFFGD--------------------NQSAFQVSFFIFQMMFCGTAATLVSGAVAERMSFNGYLYVTIILSAFIYPVCGHWAWASSFDSGWLEQLGFVDFAGSTMVHSVGGYVALAAVLIIGPRFGRFDKNMKGNNLTISVLGTLLIWVGWFGFNGG---------STLLLTDQVPKILLNTSLSATWGGLASTAIYYYFNRYVNITCIMNGVISGLVAITACCHVVSSVEAMLIGIMAGILLYISTQLLEKLKIDDXXXXXXXXXXXXXXXXXXXXXXXDLSLLDNGLD-----RWQQLKVQLLGIIAIGFYSFSVSYLLLHIVNRFVPLRVSHEDEMVGMNISEH............... 390
57 2.000e-58UniRef50_A0A2K3DQF8 Ammonium transporter n=1 Tax=Chlamydomonas reinhardtii TaxID=3055 RepID=A0A2K3DQF8_CHLRE  ali  28  2..........................DGTAKAEVALSLDVAFLLFSAYLVFGMQLGFALLCAGAIRSKNSMNVLMKNILDACTGAIGFYLFGYAFAFGHHANQ--TSNAFIGDHNFALSYTTQVSSLDSNVSYDGFATQGWHVFFFQWSFCAAATTIVSGAVAERCTFQAYLAYAFFISSFVYPVVVHWVWSASGWLSAFNQTGAIDFAGGGVVHLTGGMAALMGAWIIGPRIGRFDNEMKGHSATLVVMGTFLLWFGFYGFNPGSNLTIATTASAIVVSRVA----VTTTLSAGAAGLTGLFWRYMRTSTWDTVLVCNCCLAGLVGITCSCSVVEPWAALICGFVAAFVFIGFEYVLYKMKIDDPVSAVALHLFCGVWGLLFPGLLAQPTYVADVYGAYYGGHGQVLLCQVIEALSICAWVGVMMGAFFGLLKVAKRLRVPVDQELAGL.................... 451
58 2.000e-58UniRef50_I1LBS5 Ammonium transporter n=33 Tax=Mesangiospermae TaxID=1437183 RepID=I1LBS5_SOYBN  ali  24  17............DTAAANYLCAQFDSISRKLAETTYAVDNTYLLFSAYLVFAMQLGFAMLCAGSVRAKNTMNIMLTNVLDAAAGGLSYYLFGFAFAFGGPSNGFIGRHFFGLRDYPMGSSPSG----------------DYSFFLYQWAFAIAAAGITSGSIAERTQFVAYLIYSSFLTGFVYPIVSHWFWSSDGWGNVLFGSGVIDFAGSGVVHMVGGIAGLWGALIEGPRIGRFDRSGRGHSASLVVLGSFLLWFGWYGFNPGSFLTIAKGYGSGGYWSAIGRTAVTTTLAGSTAALTTLFSKRLLAGHWNVIDVCNGLLGGFAAITSGCXXXXXXXXXXXXXXXXXXXXGLNKLAAKVEYDDPLEAAQLHGGCGAWGVFFTGLFAKKVYVEEIYGVGMGGGGRLLAAQVIQILVVCGWVTATMAPLFYGLHKMKLLRISRDDETAGMDLTRHGGFAYAYHDDED... 476
59 3.000e-58UniRef50_A0A1U9JNQ9 Ammonium transporter n=2 Tax=Aquaspirillum sp. LM1 TaxID=1938604 RepID=A0A1U9JNQ9_9NEIS  ali  32  10..........GMALLWAALVSPPAQAALHTPPTTQENLNFIWIILRAALVFFMQAGFSALESGLVRAKNSINVSLKNFSDLIFSMVTFFAVGFAFMFGTSGNGIIGLEGFFLDGK--------------------SEPYDYAYFIFQAVFAGTAATIVSGAVAERMRFESYLISTVVISALIYPLYGHWAWNSEGWL---FQLNFVDFAGSAVVHSIGGWVGLAGALVLGPRLGKFNNDIPGSSIPSAVLGTFILWFGWFGFNGG---------STLIGDGSIAKIVVNTSIAGSVASITAFAVSKTLTGKFRAEHILNGALAGLVAVTAGCAVLEPMGAFLIGFGAGFVVYFAEVLLLKLKIDDPVGAVPVHGFCGTYGTLALALCAPESALPLKD------HWAQLGXXXXXXXXXXXXXXXXXXXXXXXXKWMRILRVPPEYEARGLNEAEHG.............. 422
60 4.000e-58UniRef50_K6YHJ7 Diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(S) n=61 Tax=root TaxID=1 RepID=K6YHJ7_9ALTE  ali  30  2.....................................LDHLWLLISTMFVFLMQVGFLCLESGRTRSKNNINVAAKNVTDFIISACX--------------------XXXXXXXXXXXXXXXXXXXSGEFLFGQNNTPYQILFFLFQMMFCSTAATLTSGAVAERMRFSGYXXXXXXXXXXXXXXXXXXXXXXXGNEGWLQQLGFIDFAGSTVVHSVGGWVALAAVLVIGPRLGRFQSAHSGSNIPMAALGTMLIWFGWFGFNGG---------SALIFDDLVPIIILNTCLAGIWGGLASTVLHQITQRYVDVGSSLNGIIAGLVGVTAGCHAVSPVEAAFIGILAGVIAHYGSELLDKLEIDDALKVIPTHLFAGVWGTLAVGFFGDPLILATGL-----TMIEQVAVQLLGIFTIGVFSFCVSYLFIVLINRSHPLRVSQEDEVRGLNISEH............... 391
61 5.000e-58UniRef50_A0A2E6HFM8 Ammonia channel protein (Fragment) n=3 Tax=Bacteria TaxID=2 RepID=A0A2E6HFM8_9BACT  ali  45  1....................................................................................................................................................................RMKFSAMLLFTSIWALVVYAPVCHWVWAGNGFM--YES-GTMDLAGGIVVHITAGIGALVVCIMVGPRKGYPTAQFQPHSLPLCVTGTGMLWVGWFGFNAGSQLAA---------NGDAAQTLVVTHLSAATATIVWSLAEKIRNGKASILGSVTGSIAGLAAITPASGEVGPIGALAIGAASGFVCWYAVILKAKLGYDDSLDVVGVHGVGGLVGTILVAFFAASTL--GGKRSVEKGYEGQLVTQLTSSGITVVYTVVLSFIILKVVGAICGLRVSDSEEEDGLDITAHGESGYN......... 292
62 6.000e-58UniRef50_A0A2D6AHR2 Ammonium transporter n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2D6AHR2_9CHLR  ali  29  33...........................EANAEENLENINLLWMLICAILVFMMQAGFMCLESGIIRNKNNINVALKNVSDFGISIVSYWIIGYGIMFGASQSGLFGTNNFFF-----------------DPSGTPTSGPAMTFFIFQSMFCATAASIISGSVAERLKFNSYXXXXXXXXXXXXXXXSDDKFGGDGTSGWLYDLGLLDFAGSTVVHSTGGWVGLAVILIIGPRTGRFVEKFSPSNLPLSVLGVLLLGFGWHGFNGG---------SQLVLDDAVPGXXXXXXXXXXXXXXXXXXXXAVQNGTAPAGDLINGLLAGLVAITASCNXXXXXXXXXXXXXXXXXXXXXTRLLERFELDDPVGAIPVHLAGGIFGTLALPFFATEEMLLGNSQLISYSGIDQFIAQLSGVFSVGLYAFVASYTIMKAINSYNPLRVSQEAEDIGLNIAEH............... 448
63 6.000e-58UniRef50_A0A139N8V6 Ammonium transporter n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A139N8V6_9STRE  ali  54  24.....................................................................................................................................................................................................GLLAQWGTIDFAGGDVVHITSGVSGLVLALVLGKRRDYNRLEYRPHNVPFVFLGAGLLWFGWFGFNAGSALAA---------DGLAVHAFVTTHISAAAAMLSWLLVEKVLTGKFSLVGASTGLVAGLVAITPGAGFVSTWSSLLIGLCVSPVCYFAISLKSKFGYDDALDAFGCHGIGGIFGGLVTGLFTTPELALDGNNGLIYGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTSIRVEDRAEAIGLDDSEHEETAY.......... 279
64 8.000e-58UniRef50_A0A163HQ88 Ammonium transmembrane transporter n=1 Tax=Didymella rabiei TaxID=5454 RepID=A0A163HQ88_DIDRA  ali  33  455..............................................................GLARRKSALSLIWACMFSASVITFQWYFWGYSLAFGPSTNGFIG-----------NLDKFGLKGVLGAPSPGSPLIPELLYSFYQMQFCAVTAAIVVGCVAERGRXXXXXXXXXXXXXXXXXXXXXXX---XXSNGWFFKWGGLDYAGGGPVEIVSGCSALAYSMILGRRQEKMMLNFRPHNVSLITLGTVFLWFGWLGFNGGSAFG---------ANLRAVMACWNSNLTAMFAAMTWVILDWRLARKWSMVGWCSGVISGLVAATPASGYLTPWGSVILGITTGIVANFATKIKFWIRIDDSLDVFAEHGVAGMWGLFLNGILGADGVNNGLTAGAITGSPEAIYKQIAYIAACTAYSFVVSAILAFVINKIPGLRASEEAELLGMDDDQLGEFAYDYVEVRRD.. 845
65 2.000e-57UniRef50_E3BK81 Ammonium transporter n=1 Tax=Vibrio caribbeanicus ATCC BAA-2122 TaxID=796620 RepID=E3BK81_9VIBR  ali  28  10..............LILIVACLSFSPTALANTDIQPTLDIIWVATATGLVFFMQAGFTMLESGMVRAKNSYNVALKNVSDLCAAIVTFWVLGFAIMFGSSSAGWFGTDGFFGEGMSSSK--------------------DLLFFAFQATFVGTAATIVAGAVAERMKFSAYXXXXXXXXXXXXXXXXXXXXGGSEVPGWLESDGFMDFAGSTVVHSVGAWVALAGVYMLGPRIGRFDKDGPGHNLLQTTLGVLILWFGWFGFNAG---------STLSADENVPKIIVNTMLAGSSGGLVCLLISAIPQGKIRVEKVLNGVLGGLVGVTAGCMYFEPTMAMIAGGIGGAVCYFADEFVLKLKLDDPVAAISVHGFSGIWGTLAVALLAPVDLLTN------DGRLSQFMIQLKXXXXXXXXXXXXXXXXXXXXKLFHDLRVDPEDEHIGLNVAEHG.............. 426
66 2.000e-57UniRef50_Q9FVN0 Ammonium transporter 1 member 3 n=44 Tax=root TaxID=1 RepID=AMT13_SOLLC  ali  29  7...............................ASVTDSINAIYLLFSAYLVFVMQLGFAMLCAGSVRAKNAMNIMLTNVVDAVVGSLSYYLFGFAFAFGDSNPFIG--------------------ASYFALKDIPSSSYDYSFFLYQWAFAIAVAGITSGSIAERTQFTAYLVFSFFLTGFVYPVVAHWLWSSNGWLSPNSTYGAIDFAGSGVVHLVGGIAGFWGSIVEGPRVGRFDAFGNPHNATLVVLGTLLLWFGWFGFNPGSFNKIYPHMADQGNWTSVGRTAVTTTLAGSTAGIVTLFGRRLLVGHWDAMDVCNGVLGGFVAITSGCSVVEPWAAILCGFCAAWVLIGLNILALKFKFDDPLEAAQLHGGCGAWGLIFTGLFAKEEFVLQAYNLILGGGWGLFGAQIVELLSIVVWVSLTMGPLFYLLQKLGILRISSDEEVAGLDISSHGGYAYDASQEES... 446
67 2.000e-57UniRef50_L1IYP4 Ammonium transporter n=75 Tax=root TaxID=1 RepID=L1IYP4_GUITH  ali  39  82..........................STSNSIPAFQSGDVSWILTSSALVFMMTPGLAMFYGGLVRVQNVLSTVMQSXXXXXXXXXXXXXXXXXXXXDTGGKVFGSHQKFWLQKVKLTGFHPLF-----------PSIPEPLFVVYSLTFAIITPALISGAFADRMRFGPMLVFIGLWHLLVYCPIAHSTWMTDGFLH---SAGVMDFAGGNVVHVAAGCAGLMSSIVVGKRAGYGREVFSHHNILISVLGASLLWVGWCGFNGGSALGERYPGQPTGVTSLAATSVLNTNLAAATASLTWMCTEWMIRKRPSVLGIISGMFSGLVTITAGAGYVNVTGAFCMGFLAGPVCYFAAQLKHRFGYDDALDAFGIHAPGGALGGILTGFFATEEITGKGSGGAFYGNPKQIYLQMYGVAFSAIWSLIVSYILLKLVDMTLGLRVAIEDELSGLDMVCHGESLVPFHLDPD... 512
68 2.000e-57UniRef50_A0A210PR83 Ammonium transporter n=4 Tax=Eumetazoa TaxID=6072 RepID=A0A210PR83_MIZYE  ali  26  9...................VTNTTTSVPVTGEVSITWDDATWILTSSFIIFTMQSGFGLLEAGAVTNKNEVNIMVKNAADVIFGGLTYWSFGFGLSFGKDQG----------------ANMFCGVGNFFVDADDDQMGVIFSTFVFQLSFATTATTIVSGAMAERTKLCSYIIFS-CVNTVVYCIPAHWLWDDIGFLR---KLGVVDIAGAGAVHLIGGGSALVAAVMLKPRSGRYDHGTPMGNPVNSLLGTFMLWWGWLGFNCGSTFGISGGKWKLAAKSAV----VTLCGSIGGGVIGITTSYITRKRKFEIEYIVNSILGGLVSITAACAIIRPWEALIAGAVGGFIAIHAPKFFNWLHVDDPVGAVSVHGVVGIWGLMVVGLFTENDLTLGRSGLIHGGGFYLLGVQMMAALILSTWSSLCTFILLFPIKMTIGIRLSPHEEFLGADYVEHNI............. 429
69 2.000e-57UniRef50_B7RHJ0 Adenylate/guanylate cyclase n=2 Tax=Rhodobacteraceae TaxID=31989 RepID=B7RHJ0_9RHOB  ali  28  3.....RILFVSAAMLWSGPALAQTER-----FALQTNLDHVWTMLAAGLVFMMQGGFLLLEAGSVRAKNSINVAQKNLLDFLLSTAVFGLVGFSFMFGHSICGFIGWSWDL-------------------ALFNTEGDWNLTFFVFQLTFCGTAATIVSGAIAERXXXXXXXXXXXXXXXXXXXXXXXXXXXSGSQEPFLARLGFIDFAGSTVVHSVGAWVALAAVIVLGPRHGKFDEHGKPHSPILSTFGALMIWAGWIGFNGGSTTAGTPEFAEIIA---------NTMIAGGFGGLTAFFVGRWIKGYNRPEFIVNGTLGGLVAITAGCDAVGLQSAILIGAIGSTTAFFLREWLEHQGLDDPLGAIAVHGGAGAMGTILAGVFARPEAI------LATGRMEQIGIQAFAVCLYFAFAFGITFTALKLAAFITGLRVPVEDEIEGLNISEH............... 428
70 3.000e-57UniRef50_Q7UK31 Putative ammonium transporter n=5 Tax=Rhodopirellula TaxID=265488 RepID=Q7UK31_RHOBA  ali  31  37.........................................WLILCAVIVLLMQAGFMCLESGLVREKNSINVAVKNLADLMISVASFWTIGFSVMFGATIFGLFG--------------------VGQLMPDFGVSDSLAAFFVFQAVFCGTATTIVSGAVAERMRFHGYLVSCVCVSALIYPVVGHWVWASGMSIGWLEGLGFRDFAGSTVVHSVGGWAALAGCIVLGPRLGRFRKDGRPSNLTLAYLGAFILFFGWFGFNCGSTFKATGEIALIAI---------NTLLGGCFGGLSSILVSSLRTGIPDPRSIANGLLGGLVGITASGSMIDPRAAALVGAIAGVVAVYSDEWLVRLRIDDAVGAISVHGFCGAWGTIAFALFIRTDELAPG-----MSRWEFLAVQVFGVVVTFGFVFGGVFVLLRGLGRFIQLRVDPETERLGLNVAEHN.............. 425
71 4.000e-57UniRef50_K8GKP7 Ammonium transporter n=3 Tax=Bacteria TaxID=2 RepID=K8GKP7_9CYAN  ali  30  3..................................KTTLDILWVITSTSLVFLMQAGFLCLESGLTRNKNNINVAIKNLTDFGVSALLFWAIGFGLMFGTSANGWMGTTHFFPDFSQSQSSKWFTA-----------------FFLFQLMFCGTSVTIVSGAVAERMRFSSYXXXXXXXXXXXXXXXXXXXXXGGKLAGWLGKQGFVDFAGSTAVHSVGGWVSLAALVLIGPRMGRFRKQHPGSNYPLATLGTLLLWFGWFGFNGG---------STLAMNAQIPVVLVNTILSGASGLLTAVVLSWVLEQRADVDWLMYGTLAGLVSITANCHAVSTGAAIAIGAIGSVLTICSTFLLIRFRIDDAXXXXXXXXXXXXXXXXXXXXFGKPEVLGTGLDFT-----AQLRVQVWGILFCGVWTFGVSYLVFQQIDRWFPLRVSIEHETIGLNISEHG.............. 400
72 4.000e-57UniRef50_B0C2M2 Two-component hybrid sensor and regulator histidine kinase n=3 Tax=Acaryochloris TaxID=155977 RepID=B0C2M2_ACAM1  ali  27  2..........................................................CLESGLTRSKNNINVAIKNFADFSLSTIIFWFFGYGLMFGASINTVIGTD--------------------QFLASPGTDSALAAFIVFQTMFCSTAATIVSGAVAERTKFGGYLVITAFMASVVYPVFGHWIWNGGQMNGWLGRMGFVDFAGSTVVHSVGGWVALAAILIIGPRQGRFSKTDAPKEXXXXXXXXXXXXXXXXXXXXXGFNGGSGLEFS----DRVPIILLNTVLGGAAGTLTAGALGWWRTKIPKIELMINGSLAGLVSVTASCHXXXXXXXXXXXXXXXXXXXXXKYWMTKLHIDDAVDAVPVHLGGGIWGTLAVGLYGRTDLLETGLD-----RGSQIGIQLLGIAVCGAWAFGLSWLLLKGVNRLLPLRVLAEDEQMGLNFAEH............... 372
73 7.000e-57UniRef50_A0A2A2KBJ4 Ammonium transporter n=2 Tax=Diploscapter pachys TaxID=2018661 RepID=A0A2A2KBJ4_9BILA  ali  21  8...........ISAVPIVQITHYAAQYNTPEVDKLYQDDAVWIITSSFIIFTMHSGFGLLESGSVSAKDEVNIMVKNVVDVVFGGLSYWSVGYGLSYGDYEPICNWFIGFGR----------FFYDPTRDQMNVNEEGWSYAAFLFELSLATTASTIVSGAVAERAKLKSYILLG-CIVILIQALPAHWVWD---KRGFFYKLGVVDFAGCSAVHMVGGIIGLIATVYLKPRRKRFDEDSVHQ---MSSPTNAXXXXXXXXXXXXXXXXXXXXXXXXGRWRLGARAAVATIMSSIGGGATSIVISFYKTKKLQVNLLINGILSSIVSITALCAVSRPWHALIIGSVSAAFSISVLPLLDRWQIDDPVGVVPIHLTSSIWGMIAVGIFCERDATNDNAGLLYSWSFNLLGIQLLCTLTILVYSATMGLLVLFCISKSPGLRVTDYEEQIGADVIEHG.............. 441
74 1.000e-56UniRef50_W4LNS1 Ammonium transporter (Fragment) n=8 Tax=Bacteria TaxID=2 RepID=W4LNS1_9BACT  ali  34  2.....................................LDAIWVLICAGLVFLMQAGFMCLESGSTRSKNSINVAFKNLTDXXXXXXX-------------------XXXXXXXXXXXXXQAGWIGTTGFLPTIGHTGVWSAAFFVFQTMFCGTAITIVSGAVAERMRXXXXXXXXXXXXXXXXXXXXXXXXNGGAKTGWLGMHGFVDFAGATVVHSVAGWVALAAVLCIGPREGRFPPGAPPHNLPVAMLGTVLLWFGWFGFNGGSALTVNEQVPELLA---------NTLLAGASGLVAALAVGWPLRGRPDVDLVIHGSLAGLVAITASCHVVSSSSAICIGSVGGLVMLAVDRLLNRWHIDDAVNAIPVHVGGGVWGSVAVAIFGQPERLGTGLDF-----AAQLGVQLAGVVVCCVWAFGLSYVLLRLINRKLPLRVTLEQERIGLNVAEHG.............. 395
75 1.000e-56UniRef50_F9T7K9 Ammonium transporter n=18 Tax=Gammaproteobacteria TaxID=1236 RepID=F9T7K9_9VIBR  ali  28  5...................................ETISITWILLCTALVLLMQPGFTCFESGLVRNKNNINVSLKNVADFCVSGLFYWLIGFGFMYGESWNGWIGTDLFVLSEQTVPL--------------------ILAFFLFQMMFCGTAATILSGAVAERMRFSGYLISSLITATLLFPVVGHWIWNGTHIMGWLAERGFMDFAGSXXXXXXXXXXXXXXXXXXXXRLGRFTEDGKPQNLPLSALGTFLLFIGWFGFNGGSVIHPDENLA---------KIFSNTAISACTGGFSALLLSWNIHSMRGTRYILNGLLAGLVSISASANIANLAXXXXXXXXXXXXXXXXXXXXEKLRLDDVVSAVPVHLGGGVWGTLAVALFAPVDQLNAASQ------MDQLLIQLMGIASTALWVVGVSYPLLKLINHFHPLRVSAQTETIGLNFGEHGM............. 400
76 1.000e-56UniRef50_A0A2C9L493 Ammonium transporter n=1 Tax=Biomphalaria glabrata TaxID=6526 RepID=A0A2C9L493_BIOGL  ali  24  1......MSNITAAPVTQAPVTRSLEELNYLFDNLSQNIDNFYQLTFGIMILLLTMGFAFIEAGAVRSKNTHNILLKNYLDGFVSGISYWCIGYAFAYGDGNRFIGWHGFASAYVEDK----------------------EMSNFFYQLMFASTSCTIVSGALAERCDFLAYLIYSFFLTAFVYPLCSRWGWSHHGVFGQTVHIKYEDFGGSGVVHLVGGTTAFFGALILGPRIGRFHKETGTCIPIHSXXXXXXXXXXXXXXXXXXXXASQGHLSHPGDGDAINMAVFNTIISASMGAFTSLFAHKIFGHHWSMLSVINGAFVGMVAICGGCNSMKPWGAVIVGFVGALIMNIIEVTLQKWQIDDPLNAVGVHFGGGSWGALSVAFVKYP---TGILMAWDKRSGYMLAWQLAGICSYFIWTAGMMSLLYLTLRYFGLFRVPPEIEMKGLDIPKHGEPAYPLEAYGH... 450
77 2.000e-56UniRef50_C1N5A7 Ammonium transporter n=2 Tax=Micromonas pusilla (strain CCMP1545) TaxID=564608 RepID=C1N5A7_MICPC  ali  27  39........................TEDDYTKMGIANATTTIFLLFATALVFFMQSGFAMLCAGSIRAKNVKNILLKNVLDXXXXXXX------------XXXXXXXXXXXXXXDGNSNRFMGEADFALGISAVGPSGGNDWIWFLFQWSFAAAAATITSGAMAERTQFAAYLGYSALLTGFVYPTVVHWAWGGGWLSSVPWKKAYHDFAGSGVVHMVGGFSGLMGAIMVGPRTGRFDAQGRPHNAALVVLGTFILWVGWYGFNCG----SQGSATSAADAVAIGRVGITTTLAASAGGVTSLFLNYALYKVWDLIAVCNGVLGGLVSITAGCAVLDIYMALFAGFIGAFVLFGSSKLLLKLRIDDPLEAFPVHGACGMWGVLAVGLFAKEKYLGDRYGALMGGNGRLFGVQLLGCVAIILWTCGILGPFFFVLKQAGLLRTSAEEEAAGLDESKHGGSAYN......... 475
78 2.000e-56UniRef50_L1JHK1 Ammonium transporter n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1JHK1_GUITH  ali  42  2...................................DSGDTXXXXXXXXXXXXXXXXXXXXEAGMLRSKHSLSIISQAFAGNALLSVMWLLFGYTLCFGPTMNGLIGLLWFN---VRYDQCG-----------PHAKNIPAALFALFQMMFASITPLLMTGSFAERLRWDCFLAFTVLWELFVYYPVCHWIWG-GGFLGTW---GVKDFAGGIVIHVSAGVGALVVAM----KDFHLYHGEPPSNLPLAGIGTALLWMGWFGFNGGSALQAG---------NLAVSAVVSTHIAACFSASVWLILS-MIHHRPAATGIFNGVLAGLAGITAASGWISTQATIFIGITCGFVSYYGIRLKARLHIDDALDVHMVHGATGAVGAVLLGVFGRRE............................................................................... 331
79 3.000e-56UniRef50_UPI00029B3561 ammonium transporter n=1 Tax=Schlesneria paludicola TaxID=360056 RepID=UPI00029B3561  ali  33  1..............................MPAVPQPVDLVWILICSALVMLMQGGFCLLETGFARAKNSINVAIKNLIDFCVSSLMYWAIGFGLMFGSSYSGLIGTS--------------------QFFPGSDAGTGQLSFFLFQLVFCGTATTIISGAVAERIRFSAYLSIALISSTLFYPVLGHWAWGGNLDPGWLQNRGFIDFAGSTVVHSLGGWLALAAAIVLGPRIGRFRTPIHGHDLAQATFGALLLWFGWFGFNGG---------STLAVTDNIPRILVNTNLAAAAGGLSALFLAWRLTKRADVGQAINGVLAGLVAMTASCHLAEPXXXXXXXXXXXXXXXXXXXXXERLQIDDVVGAVPVHAFGGTWGTLVVALVASPSVTGRTWQ-------EQLGXXXXXXXXXXXXXXXXXXXXXRLLDFVHPLRVDAASETSGLNVSEHG.............. 396
80 3.000e-56UniRef50_Q10XK8 Adenylate/guanylate cyclase n=1 Tax=Trichodesmium erythraeum (strain IMS101) TaxID=203124 RepID=Q10XK8_TRIEI  ali  32  90..........................STSKPHSTYKVTDILWLLISSGLVFLMQPGFMCLESGLTRSKNNINVAFKNLTDFGISVFCFWSIGFAFMFGTSASGIIGHSNFFFATNVQPLDAA--------------------FFLFQVMFCGTATTIVSGAVAERMKFGTYXXXXXXXXXXXXXXXXXXXXNGGVLRGWLGQRGFIDFAGSTVVHSIGGWVSLATLLVIGPRTGRFPRDRPPENLPLSILGVMLIWFGWFGFNGG---------STLALNEQVPGIIVNTIFSSVAGMITGLSIGWSIRGIPGVDLIINGTLGGLVAITASCHXXXXXXXXXXXXXXXXXXXXXEQILEKIRVDDAVGAIPVHLGAGIWGTLAVALFGKPEILGTGLSLS-----EQLTVQXXXXXXXXXXXXXXXXXXXXXTNKFFLLRVSTEDEHIGLNISEH............... 492
81 3.000e-56UniRef50_A0A0Q9NB98 Ammonium transporter n=62 Tax=Bacteria TaxID=2 RepID=A0A0Q9NB98_9BACL  ali  35  34............................................................EAGFVRQKNAVSIIMKVFVDISFGALIFYFFGFALMYGKDIGGILGTTGFFMGG---------------DLSHIALTISHDTYWLFQCAFVIAVISIVSGAVAERINFRAYILYTIAMTGLIYPIAGHWVWGVGGWLG---KLGMVDFAGSAVIHGLGGFSALAAAIIIGPRIGKFSADGPPSNLPLASVGAFILWFGWFGFNSGSTLSATN--------TSIGHIAVTTMLSAAAGCAACILFTMMRYRKADPPMVINGALAGLVGITAGCSFVSDAAAICIGAICGIAMVYATEMLEARQIDDPVGAFPVHGISGSIGTLAVGLCAKPDAIREGAGLFYGGGFHLLGVQALGLVTVCAWGFFITWVFLKLIKLIVPLRVSRDEELIGLDVGSHGVPAYSQEE...... 417
82 3.000e-56UniRef50_A0A2C9JVL5 Ammonium transporter n=2 Tax=Euthyneura TaxID=216307 RepID=A0A2C9JVL5_BIOGL  ali  27  2.......................TSNLTVSTQEPKARDDAIWLLTTAFIIFTMQSGFGLLESGCVSSKNEVNIMAKNVADVVFGGMSYWMVGYGLSYGDGEG----------------TNGFCGIGKFFIDPDNENMGEEFSRFVFQSSFATTATTIVSGAIAERTRYLAYMIFSFF-NTFVFCIAAHWVWSEHGWL---KKMGVVDIAGDGPVHLVGGAVSLIGAIMIKPRAKRFQDDHEMGSPSGTLLGLFVLWWGWLAFNCGSTYGISEGKWKLASRAAA-----TTLMAGTAGGIVGSFGSYIKKKKFLIPWIVNGVLGGLVSITASCAVTGVWEALVIGSSGAVFVLLTNELLIKLRIDDPVSAIPVHFTGGVWGLLATGIFVHKDTITNNPGIVQGGSXXXXXXXXXXXXXXXXXXXXXXXXXXKVIDLTVGLRLTPENEEIGADMSEHGIRSFN......... 421
83 3.000e-56UniRef50_UPI0009E39699 putative ammonium transporter 3 n=1 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E39699  ali  23  1.......MNQSNATTDFSDISSTSADGTHLQYDAIQSDDATWILTSAFIIFTMQSGFGLLEAGMVSKKNESNIMVKNAVDVIYGGFAYWLFGFGFSFGRDEG----------------TTAFNGFGKFFTDAEGDEMGDVFAKYFFHLSFSTTATTIVSGAMAERVELKAYILFSFVNTLTYCFPAHWI----WEPKGWLYEMDAIDVAGCGPVHVVGGFSGLVATLYLKPRLGKVDENNRPKPNPMASPTNFMLWWGWLGFNCGSTFGITGGKWKLASRSVFTWVWDNDATLTLFSSRKNRYYYLKHKNQLMIDVFVTGIISGLVSITAICPLVSPWESLLIGFIGGAIGCFGEIFLERMRIDDPVHCITTHGIAGLWGLVVVGLFVEKNLMSKNYGVFKGGSWRVLGVQVLTAVSIVLWTSLTTFVELYAIDKSIGLRVSREKELDGADKWEHGI............. 445
84 4.000e-56UniRef50_A0A2N3E7G8 Ammonium transporter (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A2N3E7G8_9PROT  ali  34  1..............................MGSVAQSIDTIWVLICTILVLLMQAGFACLETGLVRAKNSINVAIKNVLDFCVAGMGFWLVGFGLMFGASVSGFFGASDFAFQGAAGGPGGA----------------WVMVFFFFQLAFCSTSTTIVSGAVAERMSFRGYVITAAILSMMIYPVFGHWAWGGGEAAGWLERRGFVDFAGSTVVHSIGGWIALAAILVLGPRIGRFGHNGKPHDMPMATLGMFLLWIGWFGFNGG---------STLALNSSVPYILVHTMLAAAAGGIAVTGLSWLRNGLPEVQAALNGILAGLVAITANCHVVTTGNAVLIGAGGGLICYAASALLARLEIDDAVDAVPVHLAAGIWGTLAVALFGEPSLFPGG-----HTRLEQFGVQXXXXXXXXXXXXXXXXXXXXXXDRFLPLRVSSDAERTGLNIAEHG.............. 402
85 5.000e-56UniRef50_A0A2S8FYZ3 Histidine kinase n=2 Tax=Blastopirellula marina TaxID=124 RepID=A0A2S8FYZ3_9PLAN  ali  26  1..............................MEISANTINEAWLIACAALVILMQAGFCCLEAGLARSKNSTNVAAKNVADFGLSAVIFWLFGFSLIFGTSHYGLFGFD-------------------SIPFAGDGSDSYSLAFFLFELTFCGTATTIIGGAVSERLRFTGYLVVAAVMSSLFYPLYAHWVWSQGGWLR---NIGFVDFAGASVVHGVGAWVGLACCLLIGPRLNRFHKE-----KPVHYHGHNXXXXXXXXXXXXXXXXXXXXGSAFQLDDRMPRIVTTTIMAGIGGATVAILCTRLCRRKKELETFINGFLAGLVAITACCNXXXXXXXXXXXXXXXXXXXXXXKAMEFFEVDDPVSVVPVHGLAGVWGTLCVAIFGDLTLLGTGL-----TRWEQLESQFLGAVICFGWAFVGGYVVLTFVNFVYHLRVDAESETIGLNVAEHG.............. 394
86 5.000e-56UniRef50_A5BX87 Uncharacterized protein n=1 Tax=Vitis vinifera TaxID=29760 RepID=A5BX87_VITVI  ali  28 1384......................................................LGFAMLCAGSVRAKNAMNIMLTNVVDAVVGSISYY-----------------FFGFAFAFGSGXASNPFIGTDYFALKDIPNSTYDYSYFLYQWAFAIAVAGITSGSIAERTQFSAYLIFSFFLTGFVYPVVVHWLWSSNGWLSPSFGSGAIDFAGSGVVHLVGGIAGLWGAFIEGPRVGRFDAFGKPHNATLVVLGTFLLWFGWFGFNPGSFDKIYPTTTDQGNWTAVGRTAVTTTLAGSAAGIATLFGRRLIVGHWDALDVCNGVLGGFVAITSGCSVVEPXXXXXXXXXXXXXXXXXXXXXXKLGFDDPLEATQLHGGCGAWGLIFTGLFAKEEFVVQAYGLFMGGGWGLIGCQAVEVLAIICWVSITMGPLFYALHKLKILRISTEEEVAGLDISSHGGYAYVAHPDE.... 1802
87 6.000e-56UniRef50_K9YLK7 Integral membrane sensor hybrid histidine kinase n=7 Tax=Oscillatoriophycideae TaxID=1301283 RepID=K9YLK7_CYASC  ali  28  3......................................DLQWLLICAGLVFLMQPGFMCLESGLTRSKNNINVAVKNLADFGISVALFWCFGYAIMFGNSFLGFIGTENFFL--------------------NVDTDMELGAFFLFQAMFCSTATTIVSGAVAERLRFDSXXXXXXXXXXXXXXXXXXXXXNGDSMMGWLGRLGYVDFAGCSVVHGIGAWVGLATLLIIGPRTGRFNQDGKKNKIHXXXXXXXXXXXX----XXXXXXXXXXXXXXXXXNNQVALILVNTLMAGVSGMIVSCIFTWYREKIPQVESLMNGAIAGLVSITAACNIVSTSEAVIIGGVGGILMVLIKNYLEYHYIDDAVDAVAVHGAAGVWGVLAVAFFGQTELLNTGL-----SSFQQFFVQXXXXXXXXXXXXXXXXXXXXGVNRIFPLRVSVEEETIGLNVSEH............... 393
88 7.000e-56UniRef50_A0A1N7L8D9 Ammonium transporter n=1 Tax=Rhodobacter vinaykumarii TaxID=407234 RepID=A0A1N7L8D9_9RHOB  ali  28  1MRNRTLPILLAGLIALPVPALAEA-----DRFTLQNNLDHVWTTVAAGLVFFMQAGFLLLEAGSVRAKNSINVAQKNMLDFILSTLAFGCVGFAMMFGDSLGGFVGWD-------------------SRLAFLNTEGEWNLTFFVFQLVFCGTAATIVSGAIAERMSILGYVLCTLLIGCLIYPVAGHWAWGGGADAGFLAQMGFIDFAGSTVVHSVGGWVGLAAIMVIGARHGKFDENGRP----VELHGHSXXXXXXXXXXXXXXXXXXXXXSTTAGTPAFAHIIANTMVAGAFGGLAQFALGRLTEGYHKPEFMINGMLGGLVAITAGCDAVGPHSAALIGAAGGTVAYLARNALERRRLDDPLGAVAVHGVAGALGTILTGVFARDDALLAADRLTQXXXXXXXXXXXXXXXXXXXXXXXKTSVLMRGPDGRPGLRVPLEDEIEGLNIAEH............... 432
89 9.000e-56UniRef50_M2Y7S8 Ammonium transporter n=2 Tax=Galdieria sulphuraria TaxID=130081 RepID=M2Y7S8_GALSU  ali  29  5....................................GGDTCFILLAGFLVFFMHAGFAMLTAGSVRVKNVKNALFLLLIDWSVGSIAYYLFGYAFAFGDAARGFIGQHFFALSGIPSLRKDLEAIPDEASPYLQGS----YTYWLFEWSFAITAAAIVSGSVVERVSVEAYCIFSFFMTCWIYPIFEHWAWSRTGWLGALKQDGYIDFAGSGVVHMVGGIAALWGTIFVGPRIGRFDMEGKPHSASLATTGTFVLMFGWYGFNAGSMLGISSSDSYI----TASRAAVNTTLAPAASMLTAMAYTRLRSDCYDLGASLNAILSGLVAITAPCAVIEPWAALIVGMVACLIYLHGSKLIVRLGLDDPLDAVSVHCFCGTWGVFSTGLFAAEDTVSKDYGAFMGSGGNLLACXXXXXXXXXXXXXXXXXXXXXXXKFLGILRVPPEEELAGMDTSKHGGPAYHSENIDNTND 453
90 9.000e-56UniRef50_A0A285GGK6 Ammonium transporter n=4 Tax=Halobacteroidaceae TaxID=53434 RepID=A0A285GGK6_9FIRM  ali  32  36....................................AIDTMWTLLSAFLVFFMQAGFAMVEAGFTQAKNAGNIIMKNLMDFSVGSLIYWVLGFSIMFGVGNKFV----------------SFNGFFLNGDFSHLGLDXXXXXXXXXXXXXXXXXXXXVSGAIAGRTKFNAYXXXXXXXXXXXXXXXXXXX------XXXXXXXDMIDFAGSTVVHSVGGWAALAGAMVLGPRIGKYNEDGSANKIPGHNXXXXXXXXX---XXXXXXXXXXXXSTLAGTDLNIASIAMTTNLAAAAGASLALITSWFKSGKADVGMTLNGALAGLVGITAGTANVNDXXXXXXXXXXXXXXXXXXXXXEGLHVDDPVGAVSVHGVCGIFGTLMVGIFATEG------GLLYGGGIELFLVQLRGVVAVALWTFSLSYLLFKVIDLVIGLRVSNDEEIKGLDISEHGSSSYPDFG...... 432
91 1.000e-55UniRef50_W0U7T5 Ammonium transporter n=58 Tax=Firmicutes TaxID=1239 RepID=W0U7T5_9FIRM  ali  30  2..................................YSSLDTVWVLLCTALIFFMQAGFAMLETGFTRAKNAGNIIMKNLMDYCIGSVLFWVIGFSFLYGDSIGGFIGT----------------PSLFAAGKFAAAGDLPKRVFLMFATVFCSTATTIVSGAMAGRTKFKAYLTYSAVMSGIVYPITGHWIWNSAGWL---KSIGFHDFAGGTAVHVVGGTTALIGALLVGARIGKFDKNGKARAIPGHNXXXXXXXXXXXXXXXXXXXXXXXXTAGGNAAAKLGDIFFNTNISAAACAIAAMFITWVRYGKPDVTMTLNGALAGLVASTAGCDTVSAGGAFFIGITAGFVMVFGVELITKLKADDPVGAVSVHGLCGAWGTLMTGVFAKK------SGLIYSGSPKDXXXXXXXXXXXXXXXXXXXXXXXXXXKKTMGLRVSENTEIVGLDKCEHG.............. 399
92 2.000e-55UniRef50_E0RPD9 Probable ammonia permease with sensory box/GGDEF domains n=2 Tax=Spirochaeta thermophila TaxID=154 RepID=E0RPD9_SPITD  ali  28  29............................................................EAGFTRSKNSINVAIKNLADVGISSVGFWAVGFGLMFGTTWQGLTGRDHFLFL-----------------PNEGLAGVWEAAFFLFQLMFAATCTTIVSGAVAERMRXXXXXXXXXXXXXXXXXXXXHWAWGGGSPEGWLVRRGFVDFAGSTVVHSMGGWVALAAVLIIGPRKGRFEEGARMQXXXXXXXXXXXXXXX-------XXXXXXXXXSTLALDDQVPGIILRTSLAGAAGLMAAMAAGWVLTGRADVSHVINGSIAGLVAITANCHAVTEAEALIIGAVGGLVMLGSLRLLERLRIDDVVGAIPVHLAAGIWGTLAVGLFGDPALLGTGLSF-----WEQVGVQTLGVAVAGVWGFGVSYLLLRLIDRFFPLRVPPEAEEMGLNVAEHGTELYDLF....... 407
93 2.000e-55UniRef50_Q21565 Putative ammonium transporter 3 n=25 Tax=Chromadorea TaxID=119089 RepID=AMT3_CAEEL  ali  21  11...........ASAMQIVQIHHYAEGSVTPEVDKLYQDDAVWIISSSFIIFTMHSGFGLLESGSVSAKDEVNIMVKNVVDVVFGGLSYWSCGFGFSYGD-------IPEWRNPYVGFGKFFYDPTRDYGTRETINQEGWSYASFLFQLSLATTASTIVSGAVAERAKLKSYILLG-CIVILIQALPAHWVWD---KEGVFYKKGVVDFAGCSAVHLVGGIIGLIATVFLKPRRNRFNEDSVHQ---MSSPTNAXXXXXXXXXXXXXXXXXXXXXXXXGRWRLGARAAVATIMASIGGGATAITISFVKTKKLQVNFLINGILSSIVSITAICAVSRPWHALVIGSISSVFSIAVLPLLDRLHIDDPVGIVPIHLTSSIWGMIAVGIFCEEDATNNRSGLLYSWSFELLWVQLQCTAAILIYSATTGFLALFLISKSPGLRVTDYEEQIGADVIEHG.............. 447
94 2.000e-55UniRef50_L1IXR4 Ammonium transporter n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1IXR4_GUITH  ali  35  59LTNRVTALEQQIAAWNIGGIVKNITAIESIIKRPTNDGDISWKLISSGLVLMMTPGVALFYGGLVRVQNVLSTVMQSFSIACLVTILWAAFGYSLCFDTGSPVFGGAKKFWLQNVYGNHRH-----------PLSPTVPEPLFCMFELTFAIITPALISGSFADRMRFGPTLVFIAFWHILVYCPIAHSMWMTDGFLH---EAGILDFAGGNVVHISAGCSGLMSSIVVGKRTGYGREQFQPHNILISVLGASLMWVGWFGFNGGSAEYANGQATMAVLNSQAREDC-------SGYGLSVVDVDGVEDKEATEAEHPPASLGSLVERSLGWSPSPQEQGIARSLALCAILTLPLQLKSRFGYDDALDAFGIHGPGGFLGGILTGFFANANVILSPVNGAFYGNPKQLY----GIAIAAVWSCAISFLLLKLVDYTIGLRVAIDEELLGLDMVCHGESMFP......... 496
95 3.000e-55UniRef50_A0A2S8FE64 Ammonium transporter n=1 Tax=Blastopirellula marina TaxID=124 RepID=A0A2S8FE64_9PLAN  ali  27  55.TRAVALLLLCPAAVFADGAATSTPIVAETLTDGHSMVDYAWVIFAAALVMLMQAGFMCLESGLARAKNSINVAVKNMADXXXXXXX--------------------XXXXXXXXXXXXXXXXXXXTSDFCVSFENAPWLAVFFVFQATFCGTAATIDSGAVAERARFSTYLFISFVTSVVIYPIFGHWAWGSLYHSGWLENLGFIDFAGSTVVHSVGGWVALASAILIGPRLGKFNNHFHAHNLPLMYLGTFILMFGWFGFNCG---------STLQATTDVGPIAMTTMLAAGFGGISSTFVSWMFSKLPRPEDVANGILGGLVGITAGCACXXXXXXXXXXXXXXXXXXXXXXXXEKWFVDDVVGAVPVHGFCGVWGTIAVGLFIRPELLAEAG----TTRFDQIQIQSLGAIACFAWSFGTAFIVVGLLKMFTPVRVSEEDEIQGLNISEHG.............. 487
96 3.000e-55UniRef50_A0A0M4D344 Ammonium transporter n=61 Tax=Bacteria TaxID=2 RepID=A0A0M4D344_9DELT  ali  54  114....................................................................................................................................SLTGTIPTYXXXXXXXXXXXXXXXXXXXXXXERMKFSTYCVFILLWGTLVYDPIAHWVWGEGGWLLE---AGALDFAGGTVVHFSSGITALVLAIVLGRRKGYPQERMPPHNLPMTLLGAGLLWFGWFGFNAGSALSAGPSAALAFTTTQAAAAAGALSWLAA---------EWIHSGRPSALGAASXXXXXXXXXXXXXXXXXXXXXXXXXXTAGPICFAGVLLKHRLGYDDSLDAFGVHGVGGAWGALATGLFATV-----GASGLIAGNLHQXXXXXXXXXXXXXXXXXXXXXXXXXXKVTLGLRVEPDEERMGLDQAAHSESGYN......... 425
97 5.000e-55UniRef50_A0A1A6APC0 Ammonium transporter n=51 Tax=cellular organisms TaxID=131567 RepID=A0A1A6APC0_9CLOT  ali  23  41.......IGNSYDITAKQQGKPTKQEVLDQIGKNKIGINFVWVILTGCLIFFFQAGFAMVETGFCRAKNAMHTMTMNYMVFLVGAIGYFISGFALQFGGSWASLGAGTSTLSHEVTVGGWGLFGTHGFFLNSGGTYDAGVYALFFFQMVFMDTTCTVPTGAMAERVKYSAIVINSFFVSLLYYPIFGNWMWGGGWLSQLGVKHGALDFAGSSVVHAMGGVMALAGAIVIGPRIGKFRKDGTAVAFPGHDXXXXXXXXXXXXXXXXXXXXXS---TTNGDDLRLAVVATNTMIAGAIGGLAGMFYMWIKYGKPDPGMTCNGALAGLVAITAPCAXXXXXXXXXXXXXXXXXXXXSVKVVEKFKIDDPVGAVSVHGVNGMWGILSLGLFADNGVAGTVRGLFYGGGFSQLAAQCVDILTLIVWGFGMSFLFFKILNKVMGIRVSEEVEIKGLDIPEMGMLAYPDFTLTSD.. 514
98 6.000e-55UniRef50_A0A2P2E0H1 Ammonium transporter n=9 Tax=Leptospira TaxID=171 RepID=A0A2P2E0H1_9LEPT  ali  26  7......................................DILWIIICSGLVFFMQAGFLCLESGLTRTKNSINVAIKNITDFGIATILFYTVGYGLMYGNSIEGWYGADHFLPEFSLSNPKLP-------------------VFFLFQLMFCGTAATIVSGAVAERMKFGAYXXXXXXXXXXXXXXXXXXXXGRSIKTGWLAKLGFVDFAGSTVVHSVGGWVGLSAMMIIGNRMGKFDTDGK----VNQITGNNXXXXXXXXXXXXXXXXXXXXGSTLAFSKSIPGILANTMLAASGGMAAALIYGWLRLSYAEATLPLNGALAGLVSITASCHAVRSEEALFIGFVSGILMFETRKLLERFQLDDAVGAIPVHLTGGIWGTLAVGLFANLETLHSNL-----TRWGQIQVQALGIIACGLIAFSLSYLLLSLINRFYPLRVSESAEKQGLNFTEHRTELYDLFSEME... 414
99 6.000e-55UniRef50_A0A286UIB8 Ammonium transporter n=47 Tax=Dikarya TaxID=451864 RepID=A0A286UIB8_9HOMO  ali  38  56.................................................................RRKNALSXXXXXXXXXXXXXXXXXXXXYSLAFSETASPFIG-----------DLKYFALKGVLEKPSIGSNRIPALLFCVYQLMFAAITPMLAVGAFAEHSRFAPILVFVFCWSTLVYDPIACWTWN---TKGWSNVLGGLDFAGGTPVHISSGTAALAISVYLGKRRGYGTERYKPHNTSYVVLGTVFLWFGWFGFNGG---------SALSANLRAVQACIVTNLAASVGGLTWMFWDWRLERKWSAVGFCSGAIAGLVAITPGSGFVGSPAAVAFGFLAGTICNFATQLKFIFGYDDCLDIFASHGIGGIVGNIATALFAQSDGTTSIAGGWFDHHWVQLGYQLADSVSGFAYSFVMTTIILWIMHFIPGLRCDEETEILGVDDAELGEFAYDYVGLDAEL. 445
100 6.000e-55UniRef50_A0A2H6AKF8 Ammonium transporter n=73 Tax=Bacteria TaxID=2 RepID=A0A2H6AKF8_9BACT  ali  54  54............................................................YGGLVRAKNTLGTIMQSFTIVALVSIQWVLFGYSLAFGPDKGGIIGSLEWF----------ALRGVGIEPNPDYASTIPHQAFMVFQMMFAIITPALITGAFAERAKFGTFMLFILLWTTFIYDPIAHWVWG---INGWMREMGALDFAGGTVVHISSGVSALAAALIFGKRIGYGKEAMPPHNLPFTIVGASLLWVGWFGFNAG---------SALASGTLATSAFVVTHVATASAILGWMFTEWIIRRKPTVLGAATGAVAGLVAITPASGFVSPLSAIAIGIGAGILCYAAVNLKVKLGLDDSLDVVGVHGIGGTWGAIATGLFASKAINPAGADGLFFGNPSQLKXXXXXXXXXXXXXXXXXXXXXXXXKAIMGLRVSIEKELEGLDLSEHGEVAY.......... 431
101 7.000e-55UniRef50_A0A1I7ERP2 Ammonium transporter, Amt family (Fragment) n=7 Tax=Bacteria TaxID=2 RepID=A0A1I7ERP2_9BURK  ali  53  62...................................NSGDTAWMLTSTALVLFMTPGLALFYGGMVRKKNVLATLMQSFAITCVVTIVWTVIGYSLAFTPGGSFIGGFSRVLMAGMN-----YVKGDKATTVSHLAPTIPETVYFVYQMTFAIITPALITGAFADRMKXXXXXXXXXXXXXXXXXXXXHMVWEPTGWLA---SAGILDFAGGTVVHINAGIAGLVCCLVLGKRVGYGKEAMAPHNLTLTLVGGAMLWVGWFGFNAGSAVA......................................................................................................................................................................................................... 290
102 8.000e-55UniRef50_F4LLV5 Multi-sensor signal transduction histidine kinase n=1 Tax=Treponema brennaborense (strain DSM 12168 / CIP 105900 / DD5/3) TaxID=90696  ali  27  1..............................MEQLSELLNYLWIIVSAALVFFMQPGFQMLESGMTREKNSINVAIKNLTDMGISFLLYWAIGFAFMFGNDPGVFGFSRFC-------------------PDFWGAGSKQLAIFLLFQAMFCSTSATIVSGAVAERMKFSAYIIVTCLISGIIYPVFGHWAWGGFQATGWLQQIGFVDFAGSSVVHSVGGYVGLAGIIVMGARNGRFAADGTARKIQGXXXXXXXXXXX----XXXXXXXXXXXXSTLAMNYDVAPVILNTCXXXXXXXXXXXXXXXXXXXXXDVDFVINGTLAGLVAVTANCHCVTPLEAIIIGAAGGVIMLGASFLLEKLRLDDAVGAVPVHLAAGIWGTLAVGIFGDPEILGTEPLF-----GSQLLAQXXXXXXXXXXXXXXXXXXXXXXNRISPLRVSESDEHKGLNIAEHG.............. 406
103 1.000e-54UniRef50_U9SVC9 Ammonium transporter n=14 Tax=Fungi incertae sedis TaxID=112252 RepID=U9SVC9_RHIID  ali  40  9..........................................................FFYSGMARSKNALSLILLCVLCGAVVTVQWFIIGYSLTFSTNGNGFIG-----------NVDHAFFRNLKGNPSFASQRIPDILYAVYQGMFASVTPALAIGAAAERARXXXXXXXXXXXXXXXXXXXXSWSWS---EKGWYAQLGGLDFAGGTPVHITSGAAALAYCIKLGKRHGHGTDEFKPHNVANVILGTTMLWFGWFGFNGGSAN---------AANIRAIMALTSSNLAASVGGITWMLIDYRLERKLSALGFCSGAVAGLVCVTPGSGYINVPSAIAFGIVGGTSCNFAVKLKHLLDFDDALDVFAVHGVGGICGNILTGIFAQKEVAALGGGGWLDGHWVQILYQLADSCAGLAYSFCVTYMILFIMDKIPGLRVDIEAEEQGIDDTELGELAYYHVD...... 397
104 1.000e-54UniRef50_A0A0S8JTR6 Ammonia channel protein (Fragment) n=5 Tax=root TaxID=1 RepID=A0A0S8JTR6_9BACE  ali  52  1.........................................................................................................................................................TPALIAGAFAERVTFKGYIAFIAIWGLLVYNPLCHWVWAEDGFLFNLGANGAIDFAGGTVVHISAGISGLVAALFLGARKGYPRTTMPPSNMAMTMIGAGLLWVGWFGFNAGSSVSSGLST---------AQALTATQAAAASGAITWIIIEGFHQGKATALGFASGILAGLVAVTPAAGVVEPXXXXXXXXXXXXXXXXXXXXKNRVGYDDSLDAFGIHGIGGIVGAISLSFFEEAAQAAGGSWSVMQQXXXXXXXXXXXXXXXXXXXXXXXXXXXKLI----GLRASNAQEMQGLDFSLHGEHGY.......... 300
105 2.000e-54UniRef50_M4BZY5 Ammonium transporter n=4 Tax=Peronosporaceae TaxID=4777 RepID=M4BZY5_HYAAE  ali  42  1....................................................MTPGVAFFYAGLAGEEMASNTIMMSFVSMALVSIQFWAFGYSVAFSSNGVF---------------GWIGYNNVGQTPSGTYGTKIPHILFAFFQTQFAMISPALLSGGIVGRMKYGSYLLFILLWTSLVYDPLAHWMWSTITAMGWEARMGSLDFAGGTVIHISSGFGALAAALMVGKRYNHDEPV-KPHNVPLVMIGATLLWFGWFGFNAG---------SQGAADGIAATAAINTHLASSAGFLTWVGLEFAMYKKFDPCGAASGAVAGLVAITPACGYVYPWASVIFGAAGAATGFGAIQMKKYLRYDDTLDSFAIHGCVGVLGGLMTGLFATSDVNPNIKGGAFYGNGAQFVHQLVSQCVAAAYSFIVTMIILYMLKITIGLRVDEDKEVNGIDLTYHGGAAYDYRPQD.... 396
106 2.000e-54UniRef50_A0A1Z8MRS2 Ammonium transporter n=2 Tax=Bacteria TaxID=2 RepID=A0A1Z8MRS2_9PLAN  ali  45  38..............LDASGLQKQVEAAHETAESAALAGHNAWMLTCCALVLFMTPGLALFYGGLVRKKNVLGVMMQCFFLMGLMTVLWALYGYSLAFGGDGAYIGNLDHVFMEGIERVWDE----ETNSPHTPMNGAIPALTFMLFQGMFFIITPALICGAYAERMKFSTMVVFTILWGTLVYCPLAHWVWGGGFGSDHSIAGGALDFAGGTVVHISSGVSALVCALVLGRRLGWGTEDMRPHNLTYTVIGAAMLWVGWFGFNAGSELASDDLTSSAFATTHFAAAAG---------AIAWAFMEWLARGKPSVLGTASGAIAGLVCITPGAGFVNVMPALIMGAAAGIVCYFACAFKAAFKYDDSLDAFGIHGVGGTLGAILTGVFATRATWDIAEGKPLGEGGDVLWGQIVAAGITIGYCAVATFIXLKILDAVMGLRVSQEGEVRGLDMNEHGEEGY.......... 477
107 2.000e-54UniRef50_S3X6V1 Ammonium transporter n=6 Tax=Actinobacteria TaxID=201174 RepID=S3X6V1_9ACTN  ali  52  1..........................................MLASASLVLFVTPMLAFFYGGMVRAKGVLNMLMMNVVAMGTIGVLWVVCGYSMAF--GDPQWGGLQYFGLHGV--------MGTE-------VGTIPGFVFVAFQSAFAIIATALISGAVADRMKXXXXXXXXXXXXXXXXXXXXXXXFGTGWILNT---MHAVDFAGGTAIHINAGAAALALALILGPRVGFGSRPVRPHNTTLVMLGAGGLWFGWFGFNAGSALGA---------NDTXXXXXXXXXXXXXXXXXXXXXXERIRDGQPTMLGAASGIVAGLVGITPACASVSPXXXXXXXXXXXXXXXXXXXXKYRFGYDDSLDVVGVHMVGGFLGTVLVGFLADPHAMTEGASASLEAN.................................................................. 338
108 3.000e-54UniRef50_V4TST8 Ammonium transporter n=6 Tax=Pentapetalae TaxID=1437201 RepID=V4TST8_9ROSI  ali  27  24...............AASYLCSRFDSISKTLSDTSFAVNTTYLLFSAYLVFAMQLGFAMLCAGSVRAKNTMNIMLTNVLDAAAGALSYYLFGFAFAFGSPSNGFIGRHFFGLRDVPSP-------------------LTDYSFFLYQWAFAIAAAGITSGSIAERTQFVAYLIYSSFLTGFVYPIVSHWFWSSDGWASPTFGSGVIDFAGSGVVHMVGGIAGLWGALIEGPRIGRFDQSGRGHSASLVVLGSFLLWFGWYGFNPGSFLTIGESGGYYGQWTAIGRTAVTTTLAGCTAALTTLFSKRLLVGHWNVIDVCNGLLGGFAAITSGCSXXXXXXXXXXXXXXXXXXXXCNKLAEKLKYDDPLEAAQLHGGCGTWGILFTGLFAREAYVGEVYPGFMGGGGRXXXXXXXXXXXXXXXXXXXXXXXXXGLKKINLLRISRDDEMAGMDLTRHGGFAYAYHDEDD... 479
109 3.000e-54UniRef50_Q5VHU5 Ammonium transporter n=8 Tax=Ciona TaxID=7718 RepID=Q5VHU5_CIOIN  ali  25  23.....................................LDQFFMIINGMFIFFMQCGFAFLEAGSVRSSNTVNILMKNTLDVFVGSLSFFAFGYPFAYGRPGNSFIGHNNFFGANVQYFEKSVIANNQTLGGYETSSSY--FANFFFQYVFAATAATVVSGAVAERADFSCYIIYSFTITGFIYPVGAHWVWSPDGWLNTGAGTGMQDYAGSCVVHVCGGMAALAGAKILGPRLGRFDKPIPGHSVPLVSLGAFILLVGFLCFNGGSIQRISKNGDGLEVSLSVTNTILSGSAAGLSSMLTHRVHSMVKGKYWSLLMTTNGGLTGMVASCAGCNDXXXXXXXXXXXXXXXXXXXXRQFVLWLKIDDPLDAISVHLFGGTVGTLAAPILAGQTINGVSVGGPIYGGWRGVGWSLVGLFSIGLWSGLCCFTLFTTLDMVGLMRIPKSVEESGIDMQKHGEHAYPETFVR.... 464
110 5.000e-54UniRef50_A0A286TZT6 Ammonium transporter n=1 Tax=Candidatus Scalindua sp. husup-a2 TaxID=1284222 RepID=A0A286TZT6_9BACT  ali  30  7......................................DIFWVLICAGLVFFMQAGFTCLESGLTRSKNSINVAIKNITDFGITTILFWSSGFAIMFGASGSGLAGSTDFFLSLDNGPERNSL--------------------FLFEIMFCATSVTIVSGATAERLRFRXXXXXXXXXXXXXXXXXXXXXXXGGILSGWLGKAGFIDFAGSTVVHSVGGWVSLAALLVIGPRTGRFHMKIHGSNLPLSVLGALLLWVGWFGFNGG---------STLALNDQVAAIITNTFLAGASGTMVTLTIGWIIRKRADAELVIFGSIAGLVAITASAHAVNTVYALIIGGIGGTVMLGVEYLLDYLHIDDAXXXXXXXXXXXXXXXXXXXXFGNAEVLDTGL-----TRGEQLLIQASGIGVCFMWTFGTSYGFFLLINRFFPLRVSLDDEYIGLNVSEHG.............. 398
111 6.000e-54UniRef50_A0A1Y1U920 Ammonium transporter n=12 Tax=Fungi TaxID=4751 RepID=A0A1Y1U920_9TREE  ali  37  59.................................................................RRKNALSMLFLSMAGTAVGSFHWWFWGYSLAFSDTAGPFIG-----------NLKYFALNNAVSQPSVGSSRIPTLVFVIYQCMFAVITGVLAIGGFAERSKXXXXXXXXXXXXXXXXXXXXCWTWN---FNGWVYKMGGLDFAGGTPVHISSGTAALAISVYLGKRRGYGTERYKPHNTSYVILGTVFLWFGWFGFNGG---------SALSANIRAASACVVTNLAASVAGLTWMLWDYRLERKWSAVGFCSGAISGLVGITPASGYVGSPAAIAIGVVAGTGCNFATKLKFLINVDDTLDIFASHGIGGMIGDLMTGLFAQADGASEISGGWLDRHYIQLGYQCADAVTGFTWSFVVTTIILWVMHFIPGLRASEEAEIVGIDDAYLGEFAYDYVGIDPEL. 448
112 6.000e-54UniRef50_Q6QBS6 Ammonium transporter, splicing variant n=7 Tax=Chlorophyceae TaxID=3166 RepID=Q6QBS6_CHLRE  ali  24  34.......LNDSADNSSRSLLQESGQASGTSQPYTYSSSD--FVLLNGFLIFFMQIGFVSAESGQGRAKNVRNILLKNSVNIMLCAICWWAVGYAFAYGNSGGGFIGTSRFFSDGESFGSKP----------------------WFFTWTFCLSCVTIASGCLAERTHLFVYPVYTAVVSIAVHPVIAHWVWAPDSWLNSMSPCRFLDFAGGAVVHTVGGLTGLIGAMLCGPRLGRFEKDIPGHDVSSVSLGSLMLWFGWYGFNCGSTY-IYMAQGGSEASAAVSRVALNMTLCASVAGMTSLVVSSIQTGTFDLAVCCNGLMAGLSASTSNVGFLTPWAACITGALAGLLYVGISRLLVRMGVDDPLDSSAIHCGSGILGVLVSGFLARPSYVMQMVGCNCGGGGMQLGMQLLGLSCSMVWTAMWALLTFGILKKLQLLRVDQQTELAGIDNMEHGGPAYPEFLQR.... 479
113 6.000e-54UniRef50_A0A0U1Q0B7 Ammonium transporter n=50 Tax=Proteobacteria TaxID=1224 RepID=A0A0U1Q0B7_9BURK  ali  48  77.................................................................RAKNVLSVLMQVFATTSVISILWVLYGYSLAFTDG----GSLQAFGLDKVFLRRV---------NTESLVGEIPEXXXXXXXXXXXXXXXXXXXXXXXERMKFSAVMLFTVIWFTINYIPMAHMGWG-GGWVFEWG---PQDFAGGNVVHINIGVAALVAAWMVGPR------LEPPHNMTMNMTGASLLWVGWLGFCGGCAL-VANGYSMLVVFN--------TMLGSAGGATAWMLIEWLHRGKPSMLGIASGAITGLVAITPACGFVGPVGAILVGVLSTPVCILAVKLKPMLGQDDALDVFGIHXXXXXXXXXXXXXXXXXXXXXQGPEG--RGLGAQMXXXXXXXXXXXXXXXXXXXXALKIASACGGLRVSDEQQEIGLDPSEHGEVGYK......... 446
114 7.000e-54UniRef50_E3LGL3 Ammonium transporter n=6 Tax=Rhabditida TaxID=6236 RepID=E3LGL3_CAERE  ali  21  11...........ASAMQIVQIHHYAENAHSPEVDKLYQDDAVWIISSSFIIFTMHPGFGLLESGSVSAKDEVNIMVKNVVDVVFGGLSYWSCGFGLSYGDWRNPYIGFGKFFYDPTRDYGTR----------ESINQEGWSYASFLFQLSLATTASTIVSGAVAERAKLKSYILLG-CIVILIQALPAHWVWD---KEGVFYKKGVVDFAGCSAVHMVGGIIGLIATVYLKPRRNRFNEDSVHQ---MSSPTNAXXXXXXXXXXXXXXXXXXXXXXXXGRWRLGARAAVATIMASIGGGATAITISFVKTKKLQVNFLINGILSSIVSITAICAVSRPWHALVIGSISSVFSIAVLPLLDRLHIDDPVGIVPIHLTSSIWGMIAVGIFCEEDATNNMSGLLYSWSFELLGVQLLCTVTILIYSATTGFLALFLISKSPGLRVTDYEEQIGADVIEHG.............. 462
115 8.000e-54UniRef50_I2CRA2 Ammonium transporter n=1 Tax=Nannochloropsis gaditana (strain CCMP526) TaxID=1093141 RepID=I2CRA2_NANGC  ali  38  118.......................PSPENLDVNPDIDSGDTAWMLTCTALVLLMTPGLAFFYGGMVDKKNILYTMFQSISAIAMVTCLWTFVGFSLAYGETVGHVIG---------NPSTFFLYRGVGAQPLKNFGDTIPLGLFSLFELKFAIITPPIISGAFTERISYLPYMCFVVLFSIFVYCPIVHAVWHPEGFLR---QWGVLDFAGGLAVETASGYAALAGSIVFNMTGGGHELKNNAPHIPFIILGMSLLWFGWFGFNSGSAFQANG---------LAMQSFLNTNCAASAAMLTWLLVDKIRGLKPSVTSACVGAVVGLVTITPACGYVNTGGAFVVGVVGGLLCNICCQIKDSRHVDDQLDVFPAHGLGGTIGVIMTGMLADKNINGDGAWGLFYGGVELFLKNTAAAVGVAVYTFVVSYLIFRFLGSVMDLHIHPEVRRLGLDASFHGES............ 532
116 1.000e-53UniRef50_A0A0F2NB79 Diguanylate cyclase n=2 Tax=Desulfobulbaceae TaxID=213121 RepID=A0A0F2NB79_9DELT  ali  29  6.....................................IDTFWVVIAATLVFLMQPGFMCLESGLTRSKNSINVAVKNLADXXXXXXX--------------------XXXXXXXXXXXXXHAGIVGTTHFSTDFGEDYRLATFFFFQMMFCGTATTIFSGAVAERMKFSSYXXXXXXXXXXXXXXXXXXXXNGGTPSGWLGSNGFVDFAGSTVVHSVGGWVALAVLLIIGPRMHRFGKDFSGSNLPLSVLGTLLLWIGWIGFNGGSTLAMNGNVPRIIAYTTLAGAAG---------ALANLSIGYFINRVPRVPFLINGSLGGLVAITAGCHCVDAMGAVTIGAVAGVICFATEILLIRVKIDDAVGAVPVHLACGIWGTLAVALFGAPELIGTGLSLP-----DQIFAQLKGILAAFLIAFLLPFTVFRQINRFFPFRVSAEDEHNGLNYSEHG.............. 398
117 1.000e-53UniRef50_A0A095V217 Ammonium transporter n=21 Tax=Bacteroidetes TaxID=976 RepID=A0A095V217_9FLAO  ali  42  27......................QAPTTDFNDASTINFADVAWLLTASCLVLLMTPGLSFFYGGMVGKKNVISTMLKSFICLGVVSLLWVTVGFSLSFGSPIGLTIDGTHYGIIGNPCN-YAFFDQVELLPHKSLGSSIPFILFALFQMKFAVITPAIITGALAERIRFISFLLFICLFTVCIYAPLCHMIWHPHGLLGSYF--GVKDFAGGTVVHMSAGFAALAGVIVLGKRK---NSEHIPTNIPFVLLGTGLLWFGWFGFNAGSALAANATAAMAFATTTIA---------SASAMMTWVFFDRLNGRKVSALGACIGAVVGLVVITPSAGFVTVPQSIFFGFIGAIVSNKMVYWKKLKQIDDTLDVFACHGVGGIMGMILTAIFAQGENAS-----LLHGGWSVFGHHMMALVLVSAFTFGGAYLLFKITNFIIPIRVTEESEDLGLDLSQHGE............. 441
118 1.000e-53UniRef50_A0A026WVJ4 Ammonium transporter n=5 Tax=Hexapoda TaxID=6960 RepID=A0A026WVJ4_OOCBI  ali  27  30......................................DSNWIVTSSFMILTMQTGFGMLESGCVSLKNEVNIMMKNVVDIVLGGLTYWIFGFGFSFGMYEP--------------NNPLIGIGGLLLDPPIDDEYMGSICAAFLFQLSFATTSTTIVSGAMAERCNFKAYCLFSFLNTIVYCLPAGWV----WGDHGFLNRMGVVDIAGSGPVHLVGGVSALACAIMLGPRVGRYDNGIDPGCPVNAIMGLFVLWWGWLAFNSGSTYGVTGDRWKYAARAAVS-----TMMGSMGGGLVGLGFSLTNPNGIDILSQINGILGALVAITGGCFLYSAWEAMVIGMIGGFITCISMPALDKIRIDDPVGAAATHGASGIWGVVAIGLFADNDTTSGRKGLFKGGGWYLLGVQSLXXXXXXXXXXXXXXXXXXXXDKVIPIRMSVYEEVLGADLVEH............... 430
119 1.000e-53UniRef50_A0A146H7A8 Ammonium transporter n=1 Tax=Mycena chlorophos TaxID=658473 RepID=A0A146H7A8_9AGAR  ali  37  97.............................................................................................SLAFSETGGRFIG-----------DLKYFALRNVLEQPSIGSTRIPSIVFCIYQLMFAAITPILAVGAVAERSRLWPTIVFVFAWSTLVYDPIACWTWNSNGWS---FVLGGLDFAGGSPVHISSGSAALAISVYLGKRTGWGTARYKPHNTSYVVLGTVFLWFGWFGFNGG---------SALSANMRAANACIITNLAASVGGLVWMFWDWRLERKWSAVGFCSGAIAGLVAITPASGFVGIPASVLFGFMAGTCCNFATQLKFLFGYDDTLDIFASHAIGGIVGNLLTGLFAQSDGATVIPGGWLDHHYIQLAYQLADSCASLSYSFTMTTIILWIMHFIPTLRMTEESELLGIDDAEMGEFAYDYVGLETEI. 458
120 1.000e-53UniRef50_F6GUS3 Ammonium transporter n=4 Tax=rosids TaxID=71275 RepID=F6GUS3_VITVI  ali  28  7...............................ASVTDSINTVYLLFSAYLVFVMQLGFAMLCAGSVRAKNAMNIMLTNVVDAVVGSISYY-----------------FFGFAFAFGSGSASNPFIGTDYFALKDIPNSTYDYSYFLYQWAFAIAVAGITSGSIAERTQFSAYLIFSFFLTGFVYPVVVHWLWSSNGWLSPSFGSGAIDFAGSGVVHLVGGIAGLWGAFIEGPRVGRFDAFGKPHNATLVVLGTFLLWFGWFGFNPGSFDKIYPTTTDQGNWTAVGRTAVTTTLAGSAAGIATLFGRRLIVGHWDALDVCNGVLGGFVAITSGCSVVEPXXXXXXXXXXXXXXXXXXXXXXKLGFDDPLEATQLHGGCGAWGLIFTGLFAKEEFVVQAYGLFMGGGWGLIGCQAVEVLAIICWVSITMGPLFYALHKLKILRISTEEEVAGLDISSHGGYAYVAHPDE.... 448
121 2.000e-53UniRef50_A0A1B4Z996 Ammonium transporter n=3 Tax=Rhodophyta TaxID=2763 RepID=A0A1B4Z996_PYRYE  ali  29  6......MTAMAASPVGRQAVSEALAALTDQVSRNSDSMDVFFILVSGYLVFLMQTGFAMLTAGSVRSKNTKNVLLKNVLDACVGAIAYYLFGFAFAYGTEANSFLGHSDFALSGDRTDFHFFFF----------------------QWTFAATAATIVSGSVAERTSFYAYLGYAFFLSGFVYPIVSHWVWGGGW-LSTIFTVGAKDFAGDAVVHMVGGFAGLAGATIVGPRLGRFDQPMPGHSATLCTLGTFILWFGWYGFNPGSTLGISNTGPDADYTVTAARCAVTTTIAAASAGVTTLIVIKLRDHIFDLLACLNGILAGLVAITASCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIDDPLEAFPIHGAVGVWGAFAVGLFARIELLTLSGYGFYGGGGRLLAANXXXXXXXXXXXXXXXXXXXXXXXXXXXXRISPEMELIGNDVSKHGGAAYPDDVITTE.. 457
122 2.000e-53UniRef50_A0A257WJ57 Ammonium transporter (Fragment) n=1 Tax=Planctomycetales bacterium 12-60-4 TaxID=1970541 RepID=A0A257WJ57_9BACT  ali  32  3................................SQIEALDVTWVLVSAALVFIMQAGFCMLETGFVRAKNSINVAIKNLVDFCIASLIFWMVGFGLMFGQSSGGWIGT--------------------TEFFVESTNSATFAAFFLFQLVFCGTATTIVSGAVAERVRFSSYXXXXXXXXXXXXXXXXXXXXGGIVGDGWLKSLGFIDFAGSTVVHSVGGWFALAAVMILGPRIGRFRPTIRGHQLPMATLGAFLLWFGWFGFNGG---------SALAPDTIAVKXXXXXXXXXXXXXXXXXXXXXHVGGRPQIEAMINGVLAGLVGITAGCHVLSPGAAIVTGLVAGLLAFYSAQWLERWKIDDSVSAIPVHGFAGAWGTFATGLFLAPDQLAEG-----MTYLQQLGVQSXXXXXXXXXXXXXXXXXXXXXNYLIPMRVSAEEELDGLNVSEHG.............. 395
123 3.000e-53UniRef50_M5WH52 Ammonium transporter n=13 Tax=Embryophyta TaxID=3193 RepID=M5WH52_PRUPE  ali  27  28...............IAEFLCSRFNTISIKFNDTTHAIDNTYLLFSAYLVFAMQLGFAMLCAGSVRAKNTMNIMLTNVLDAAAGALSYYLFGFAFAFGAPSNAFIGRHFFGLHNIP------------------SLSGGDYSFFLYQWAFAIAAAGITSGSIAERTQFVAYLIYSSFLTGFVYPVVSHWFWSADGWASPIFGSGSIDFAGSGVVHMVGGIAGLWGAVIEGPRIGRFDRTGRGHSASLVVLGTFLLWFGWYGFNPGSFLTIGEGGTYYGQWSAIGRTAVTTTLAGCTAALTTLFSKRLLAGHWNVLDVCNGLLGGFAAITSGCSVVEPWAAIVCGFVAAWVLIGCNKVAEKLKYDDPLEAAQLHGGCGAWGLIFTGLFATEAYVNEVYAGKPGRPFKXXXXXXXXXXXXXXXXXXXXXXXXXGLHKLKLLRISREDETQGMDMTRHGGFAYVYHDEDD... 484
124 3.000e-53UniRef50_A0A163KFP1 Ammonium transporter n=4 Tax=Fungi TaxID=4751 RepID=A0A163KFP1_ABSGL  ali  42  1...............................................................MARSKNALSLIMCSVLSLVVVTVQWFIWGYSLTFSRNASPFIG-----------NLDNAFLRGVLGDPSIGSKSIPDIVFMIFQCMFAALTPALAIGSAAERGRLLPMVIFMFIWSTLVYDVIACWTWNPNGWS---AKLGGLDFAGGTPVHISSGFASLAYALVLGKRQGHHAHDFKPHNMSNVILGTALLWFGWFGFNGGSALSGNM---------RAAMACVVTNLAAAVGAITWMCLDYRIERKFTALGFCSGAVAGLVAITPASGFVGPGPSVAIGFLGAIACNLAVHLKHMFNYDDALDVFAVHGVGGYVGSILTGIFAESDGSTDILGGWMNQHWVQIGYQFADATAGASWSFFITLLILLIMDRIPGLRVDPEMELQGLDAAEIGEMAYYHVD...... 389
125 3.000e-53UniRef50_A0A2I7KFI5 Diguanylate cyclase domain-containing transport protein n=3 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A2I7KFI5_9RHOB  ali  26  54............................................................EAGMARSKNSINVAQKNITDFLVSVSAFYLVGFGLMFGTSWGGFLGTDG---------------------FAFAEADDWQYTFFVFQAVFAGTAATILSGAVAERMQFSAYLLAALFIGLLVYPVSGHWSWGNSENPAYLADKGFIDFAGSTVVHSVGGWVALAGIVVLGARHGKFNADGSANEIQGXXXXXXXXXXX----XXXXXXXXXXXXSTTTADPAFAHIILNTILAACFGGVAGLLTGRVFDSVNIPHRPINGSLGGLVAITAGCDVVTVYGAVIIGLCAGACVVLSERVIERLKLDDVVGAVSVHGVCGALGTVMLAFFALPGKLAAASPG------AQAIVQLEGVVLSFVWAFGASLIFFKLLDMTIGVRVPKHDEMVGLNTTEHG.............. 422
126 4.000e-53UniRef50_Q9BLG3 Ammonium transporter 2 n=6 Tax=Dictyostelids TaxID=33083 RepID=AMT2_DICDI  ali  27  11...............................EGLSAAVDDMWVLNATYLVFYMQAGFCMLEAGVVRAKNAKSIIMKSIIDTAIGSLLFWALGFGLAFGNADNPVIGTSHFFLI-----------------------NYQNLSFFAFQWAFCATSITIVSGSLAERVHVTSCLVYTIVMSAFIYPLSAHWVWSYNGWLRMIGFNGIIDFSGSIVVHIVGGCIGLVGTYLVGPRIGRFPKPLPGHSITIYTLGAFIIWYGFYGFNTGSTLGISGGGIAIASRSAVTMTII-----ACASCATTLLAIKIKSGKYDVVKSVNSLLGGLVSSAAVCSLIDPWAAFIIGCVTSFVYLGCSHLLIKLRIDDPLDSSAIHLGCGIWGALSVGLFSTQENLTNVYGLFFGGGFEQLGIQXXXXXXXXXXXXXXXXXXXXXXKKFHLLRIEPTKELMGIDIDSAGGPAY.......... 427
127 4.000e-53UniRef50_A0A1Y2GFK1 Ammonium transporter n=3 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A1Y2GFK1_9FUNG  ali  39  51...........................................................FYSGMARSKNALSLIMLSCCSVAVVTFQWFLFGYSLAFSKTGSKFIG-----------NFENAFLRGVLDQPSVGSAKIPDLVFMIFQCMFAALTPALAVGAAAERGRILPTLVFIFLWTTFVYDFIACWTWS---ANGWSFVMGGLDFAGGTPVHISSGGAALAYALVLGRRSGNHND-FRPHSMSNVVIGTCFLWFGWFGFNGG---------SALSANLRGAMACVVTNLSASVGGITWVLLDYRHERKLSVLGFCSGAVSGLVAITPGSGYVSPASSVAIGFLGAVACNLAVRLKHNLKYDDAFDVFAVHGVGGVVGNILTGIFAQSDGVTVIPGGGLDGHWIQVAHQLADSCAGLGWSFGVTYLILFIMNKIPGLRVDPDHEHRGLDLAELGEMAY.......... 434
128 4.000e-53UniRef50_UPI000BBEF1F0 ammonium transporter 1 member 2-like n=1 Tax=Brassica napus TaxID=3708 RepID=UPI000BBEF1F0  ali  24  25...........SSAAAANFLCSHLSAISHKFSDTNFAVDTTYLLFSTYIVFTMQIGFAMLSAGSIRAKNTKNIMLCSILDAASGSVTYYLFGFAFAFGTPSNGFIG----------------GPRNFFALNSFPEGSGYDFSFFLFQWTYAITASGITSGSMAERTQFTAYLISSFFLTGFVYPIVSHWFWSNDGWASPTRPNGAIDFAGSGVVHMVGGITGLWGSLILGPRIGRFNHKENTSSEIRGHSXXXXXXXXXXXXXXXXXXXXNRSPQYYGQWSAIGRTTVTTTLSGCTAALTSMFTSRFLVGHWSVTHVCTGLLSGLVAISSGCAVVEPWAAIVCGFVASWVTIGLNWLAKICKYDDPLQAAQVHGGCGAWGLLFTGLFATKNYMSEVYGGFMGGGLKLLGAQXXXXXXXXXXXXXXXXXXXXGLHKMNLLRVSVKEEKCGIDMTRHGGFAYGAHVEDAD.. 490
129 4.000e-53UniRef50_I1T0D9 Ammonium transporter n=1 Tax=Asterochloris sp. Armaleo 7/29/2003 TaxID=1050235 RepID=I1T0D9_9CHLO  ali  28  7..................................LSDGDITAVLLCSFIVFFQNIGFAALENGNVRAKNARAILLKNCIDKLVGGLCYWAVGFAFAYGSSSNGFIGTSHFFLSQ---------------------LNGPVAALWVLSATFLMTATTIVSGCLAERAQFEAYLAYTPLMAVLVYPLVVHWV-TQGWLTTFATHCTYLDFAGGSMVHLVGGVAGLVAAWQVGPRLGRFDKPIPGHNVESTVLGTLMLWFGWYGFNIGELLHIVSVQAGDERGTVAARAAVNTTICGCAGALTALLLAWLRTRTYEVRTCCNGVLGGMVAITALAPFVDPWAAFVLGCIAGGVYIGCSRALLCLRIDDPLDASAVHAGCSLVGLLGVGVFGEPTYIAQNHEGYDRRGGEQLGVQLLGIITISAFTAACSLALFGTLRYFNKLRVDTATEIAGLDFVDHGGSAYPDFLLR.... 433
130 4.000e-53UniRef50_A0A1B0FPG8 Uncharacterized protein n=2 Tax=Neoptera TaxID=33340 RepID=A0A1B0FPG8_GLOMM  ali  26  3MNNSSELTNDSTTLLLGLKVTSRNSSYVIPGLYDLSTEDTNWVLTSSFIIFTMQTGFGMLESGCVSLKNEVNIMMKNVIDIVLGGFTYWLFGYGMSYG--------------RGPLSNSFIGIGDFLLDPPVNDPLMGQIFAAFLFQLSFATTATTIVSGAMAERCNFKAYCLFSFLNTIIYCIPSGWV----WGEQGFLNQLGAVDIAGSGPVHLIGGTAAFASAYMLGPRMGRYADGYDPGNPVNACMGLFVLWWGWLAFNSGSTYGVSGAKWQYAARAAVM-----TMMGSFGGGIISC---------------------------------GAWEALVIGSIGALLCVLTMPLFDRLHVDDPVGASSVHGVCGVWGVIAVGLFADNDTTNGRSGLFKGGDWYLLAIQTLSAFCLTGWGIGSTLLLLYFVNKIVPIRMDANEELLGADLMEH............... 408
131 4.000e-53UniRef50_UPI000411A94F ammonium transporter n=1 Tax=Desulfovibrio inopinatus TaxID=102109 RepID=UPI000411A94F  ali  29  2.....................................LDILWILMASGLVFIMQAGFMCLESGLTRSKNSINVAVKNLADFAFSVCGFWAVGFGLMFGASWNGLVGTTNFFL--------------------PLNDNAFLVAFFVFQAMFCGTATTIFSGAVAERMRXXXXXXXXXXXXXXXXXXXXXXXXXGGKPTGFLGEMGFIDFAGSTVVHSVGGWVALAALLVIGPRKGRFPENGPSREXXXXXXXXXXXXXX----XXXXXXXGFNGGSTLAMNDSVPMIIANTTLAGGAGAVCCLFVGWWLTKLPKVGYLINGSLGGLVAITANCHVVNASSAVIIGAVAGPVCLAVEILLEHKKIDDAVGAVPVHLGCGIWGTLAVALFGDPNLIGTGLGFV-----DQXXXXXXXXXXXXXXXXXXXXXXXRNINRFWPMRVTEEEEHIGLNVSEHG.............. 394
132 4.000e-53UniRef50_A0A1V9YEA9 Ammonium Transporter (Amt) Family (Fragment) n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1V9YEA9_9STRA  ali  49  57...................................DNGNTAWMLASSALVMIMTPGVAFFYAGLAGEDMASNTMMMSFMSMALVSIQFWIFGYSAAFGS----TGVFSWAFYNHVEKLPSGYSQGT------------PHIVYAFFQTQFAMITPALLSGGIVGRMKFGSYLLFILLWTSVVYDPLAHWMWSAATAYGWEAKMGSLDFAGGTVIHISSGFGALAAALVVGKRYNHGEPVK-PHNVPLVMIGTTLLWFGWFGFNAGS............................................................................................................................................................................................................ 278
133 5.000e-53UniRef50_A0A2H2HVL3 Ammonium transporter n=3 Tax=Rhabditoidea TaxID=55879 RepID=A0A2H2HVL3_CAEJA  ali  25  1.........MATAANSSAEIDKLHAEISRLETDFYENVNSFFLCSMALIIFFMQCGFAYLEAGAVRSKNTTNILIKNLLDSCICIIGYWAIGWALAYGESGDGVNLFIGHSQFFL--------------------SGFSDYPKFFFQYVFSATAATIVSGAVAERCEFVTYVTYCSVISTFVYPVLTHWAWSDNGWMAKGITSGGIDFAGSGVVHLCGGSISFLAAWCMGPRIGKFPDEILGHSVPFTALGGFILMFGFLAFNGGSVASISNAGDG----HTVALAMINTILSGSFAALIYLAAHYYQHGKWTLLLTINACLSGMVAACAGCNKMEPWGCMWVGVGAGLLYLALSKLMIKLKIDDPLDAFAVHAGGGFWGLVSASVISRGGVAYALVGVV--GGAENSGDHLTQAFA------------------IGKLRVSEEIEINGLDVFKHGEMAYPLRAYGH... 426
134 5.000e-53UniRef50_A0A1E3PQH0 Ammonium transporter n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PQH0_9ASCO  ali  31  1.........MATLDLISRALTLAVTAVENDSDSDYDTTSIGFMLLCSSLIMLMSPGIGLFYAGFTRRKNALNXXXXXXXXXXXXXXXXXXXXYSLAFSSTSS----SHYMGDFHNAGLRHLVSASTWANVDTTNSVHIPELVNFVFQGTFAVITATIFVGSIAERGRPLPALVFTFVWTTVVYNAIVYWSWNPNG---WISRLGTLDFAGGTAVHVSSGFAALAYSWFLGKREGFGTLSLNPIPHNXXXXXXXXX-------XXXXXXXXXXXXASYQPTLRAVYVAVNTLLAGSIGGITWCILDYRLEYKWSIIGFCSGIICXXXXXXXXXXXXXXXXXXXXXXXTTLCCNFATKLKYYVGIDDCLDIFAVHGVGGIIGMFLTGIFASADGHTVIKGGWVNQNYIQLGYQLAECITGAAFSFTLSCAILVIMNWIPGLRVSKKDEEDGLDISQHGDYAYDYVEDE.... 450
135 7.000e-53UniRef50_A0A139ATW2 Ammonium transporter n=1 Tax=Gonapodya prolifera JEL478 TaxID=1344416 RepID=A0A139ATW2_GONPR  ali  38  12.........................APIDPATYQYTGADNTFIMMCAALVMIMTPGLGYYYSGMARSKNALTLIMLCFLAYAVVTVQWYLIGFSLTFSDKGGKLWG-----------DCTYCFLRNIGQNVLTNIPSVPTVTFAFYELMFAALTPALIFGSTAERVRXXXXXXXXXXXXXXXXXXXXXXXXSANGWANQ--VLGYLDFAGGTPVHTSSGFAGLAFAVVIGRRKH--TDDFVASSMANVFLGTALLWFGWFGFNGG---------SEVASNARSANAMMVTNIAAATGGLVWMLVDYLGHRKVSGLGFCSGAVAGLVGITPASGFVSGGSAFAIGAITALVCNTMVRLKAYFLFDDTLDAFNVHGIGGVTGAILTGVFAQRSIASLPPLGWLDGNWAQVGKQLASASAGAGWSFFATCIIVAVMQRIPGLRVPEEAEVIGSDQTEMGEVSYDYVEALSAGP 451
136 7.000e-53UniRef50_UPI000D6D7EE9 ammonium transporter n=1 Tax=Gemmata obscuriglobus TaxID=114 RepID=UPI000D6D7EE9  ali  52  265.........................................................................................................................FLKGIEPAKLPGY--DIPVYLHVMFQGMFAIITPALISGAVAERIRFWPFCLFMLLWVTFVYCPLAHMVWARGGQIGLLGKMGALDFAGGTVVHIAAGVAGLACCLVLGKRAGYPKQIAHPNSMVLTLLGAGLLWFGWFGFNGGSSVNS---------TGLSVSAFAATQVAAAAAGFAWMLVEWVHKGKPTALGLASGIVAGLVAVTPXXXXXXXXXXXXXXXXXXXXXXXXXXXKNVLGYDDSLDAFGVHGVGGFVGAVLTGVFCSQLIQPGSADGLL..................................................................... 547
137 7.000e-53UniRef50_UPI00082F07CC ammonium transporter n=1 Tax=Acinetobacter sp. SFC TaxID=1805632 RepID=UPI00082F07CC  ali  49  80...........................................................................................................................................................................................HMVW--GGNGAIMHNWGVLDFAGGTAVHINAGVAALVGALVLGKRRGWPTPPIPPHNLVHTMIGAAFLWAGWFGFNVGSAFGV---------NNVSTVAMMATMVATCGGIVGWMFIEKIKTGHVTSLGLASGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCYYAVTLKHKIGIDDALDVFALHGIGGIVGCILTGIFCIPEL--GGKEGILPQFFAQLG----SIILTVIYCGVITWVIMKVIDKTMGLRANPEQEENGLDISDHNERAYNN........ 341
138 8.000e-53UniRef50_A0A285M5N8 Ammonium transporter, Amt family n=1 Tax=Cohaesibacter sp. ES.047 TaxID=1798205 RepID=A0A285M5N8_9RHIZ  ali  26  1.MKKSSIFITVAGAAALFPSSVWAASDLRGLSA---NLDLTWIMAASALVMFMQAGFLLLEAGMVRSKNSINVAQKNXXXXXXXXXX-------------------XXXXXXXXXXXXXXSLMVGFDWDYFGLSNITSYEAGFFVFQVMFCGTAATIVSGAVAERMRLSAYIIGSIFLSSLIYPVFAHWAWGDPNEGAFLANMGFIDFAGSTVVHATGGWVALAACIALGPRMGRFDEAGNPHSPVLATTGVLLLFIGWLGFNGG---------STLKAGEDVAFIILNTILAGGFGTVAGHIIGYYHDGYYLPEKAMAGMLGGLVAVTAGCAVLSPGGAIMIGILGGCISIIANHILEKFKIDDAVGAIGAHAFAGVAGTIGLALLAPADQ-------FEFGRLHQLYVQGIGSGLNFCLSFGLGFLFFSILRRVSRFRATLDEEKLGLNISEH............... 425
139 8.000e-53UniRef50_M1V7W3 Probable ammonium transporter n=1 Tax=Cyanidioschyzon merolae (strain 10D) TaxID=280699 RepID=M1V7W3_CYAM1  ali  25  9...........GLNADAPKLSAANQSLYFALANIVDGVNSAFLLLTAALVFCMQAGFAMLTVGSVRNKNAKNALVLNLCDACVGGVAYYVLGFGFAFAPSNGFIAFQHFALAHMQSPLTKDAFTYLSGLSVPSGTNNGATLFLWWFQFTFCLTAASIVAGAICERVRVFAYIGFVSLMMGFVYPVISHAMWDVNGWFGIYGSAGSIDFAGSGVVHITGGAGAFVGALIIGPRIGRFDENGKIRPIPGHNXXXXXXXXXXXXXXXXXGFNLNGVPTVYSTAGQVALAAVNTLVLPAAAGITTLMITRFFYHCFDCASMVNGFILGTVAITSPCSTIPTYSALCCGIIGGFIWVFGDKLVQRLRIDDPLGAIAVHGFGGTWGIIIPGFFAKPDYVANGSGGVFYGYGKQLAAQLTEILYIWSFVCTVIGGYFLILKFLGLLRVSPEEEILGNDTSHHGGPAYPEDDVG.... 536
140 2.000e-52UniRef50_A0A1Q3E2C5 Ammonium transporter n=1 Tax=Lentinula edodes TaxID=5353 RepID=A0A1Q3E2C5_LENED  ali  35  467............................................................................................YSLAFSSS----------ATNGYIGNLRNFGLMKVLGDPSPGSPLIPEILYSFFQMEFACVTIGILMGGIAERGRVLPAMVLTFTWMTLVYCPLACWVWG---VNGWAFSWGVLDFAGGGPVEIGSGVSGLALAWVIGRRQEKELLNFRPHNVSLVCLGTFLLWFGWLGFNGGSAFG---------ANLRAIVAIWNSMLAAAFGGMVWCIMDFRYEKHWSMVGFCSGTIAGLVAATPSSGFVHPWASVIIGIVSGASCNLATKLKFHFQIDDALDLFAEHAVGGIVGLFLNGFFGTDGVNTSIPGGFMDHNWKQLYIQFAYICATCSYSFFVTAALAKIIDMIPGLRSTPEDECLGMDEVEIGEFATDYIEIRRDV. 829
141 2.000e-52UniRef50_D4ZBZ7 Ammonium transporter n=3 Tax=Shewanella TaxID=22 RepID=D4ZBZ7_SHEVD  ali  31  1..........................MDAELAKVVELQNIMWILIATGSVLFMQAGFCFLEAGSVRSKNSINVAVKNFCDFCLSSGVFWLAGFGIMYSSA---------------------GQMFNPDYFFIAITDSPKLLAFFVFQLVFCGTASTIMSGAVAERTTXXXXXXXXXXXXXXXXXXXXRWAWNGGLNLGWLNQLGFVDFAGSSVVHSLGGWASLAAVMVIGPRLGRFSEANQPHNIPMATVGTIILWFGWFGFNGG---------SSLKFDDTIPMIILNTNLAASFGAISVLILTWLKQQKPDVLHVLNGALAGLVSITASCNAVLPQQAVLIGISGGAIYLASTKVLEHFKIDDVVKAAPVHGVCGAWGTLCVALFGNAEVLNTGLSFT-----GQLGXXXXXXXXXXXXXXXXXXXXXXXXQRFIPIRVKAEDEIIGLNTSEHN.............. 401
142 2.000e-52UniRef50_A0A1I8GAW9 Ammonium transporter n=2 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8GAW9_9PLAT  ali  29  205......................ASMAYNSATENQDLNDDAVWILACSFIIFTMQTGFGLLEAGNVQVKNEVNIMVKNVVDVVFGGMSYWMFGYAL---------------SFGQSGGGGFCGWGEFFMDRSPGDQDMGVGFATFVFQLSFATTATTIVSGAMAERTRLDAYILFSFL-NTLVYCIPAHWVW---DRRGFLKQLGAVDIAGSGCVHFIGAVSAAVAALLLGPRLGRYDENPRGGNPTNALIGMFMLWWGWLAFNCGSTFGISNGKWKLAAKAAATTL----NASMGGGLSGIVITYIINKGKFEVCDIVNAILASLVSITAGCSXXXXXXXXXXXXXXXXXXXXXXXXXXKIHLDDPVGAVAVHGFAGVWGMLACGIFVDVDMNNGQKGLFHGGGFYLLGVQLLACVCLGAWSAGVTFVTLGTLKLTIGIRLSPEEELLGSDFVEHNIP--NEEHVASEVP 634
143 2.000e-52UniRef50_G2DZW8 Diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(S) n=4 Tax=Chromatiaceae TaxID=1046 RepID=G2DZW8_9GAMM  ali  33  3...................................DGLDIAWLLLCSFLVFMMQAGFLCLETGLVRTKNSINVAIKNIVDLCLSGLVFWLFGYGLMFGASHAGWIGTDDFLF--------------------GEGASAHSICVFFFQCMFCSTSATIVCGAVAERMRFLAYVFSTLMMVAFIYPVTGHWAWGGGEATGWLARMGFIDFAGSTVVHGVGGWVALAAVLRLGARRGRFDVEGQGGNVPLASLGVILLWFGWFGFNGG---------SASKLDETVPLILLNTFIAAGCGGLAAMFFGYVRLGYPAALDLLNGVIGGLVAITASCHLQSPPXXXXXXXXXXXXXXXXXXXXERLRIDDAVGXXXX-----XXXXXXXXXXXXXXXXXXXXXXQTGGRLEQLWVQXXXXXXXXXXXXXXXXXXXXXXXRFYRLRVDAESEQAGLNVAEHG.............. 395
144 2.000e-52UniRef50_C9Y722 Ammonium transporter n=2 Tax=root TaxID=1 RepID=C9Y722_9BURK  ali  47  164..................................................................................................................................................................AERIKFSAVLAFCVLWFTFSYLPMAHMVWAAAGYLW---AKGALDFAGGTVVHINAAVAGLVGAYVVGKRIGYGKEPMAPHSLTLTMVGAAMLWFGWFGFNAGSNLEANGLTA---------LAFINTLLATAAATLAWITGEALSRGKASMLGAASGAVAGLVAITPACGFVGPMGSIAIGLIGGFACLWGVNLKRLLGADDSLDVFGVHGVGGIVGALLTGVFAAPSL---GGTGVYDYVANAVGAEYSXXXXXXXXXXXXXXXXFKLVDLVIGLRVSEEEEREGLDISSHGETAYNR........ 477
145 3.000e-52UniRef50_UPI000CD7D6DD putative ammonium transporter 1 isoform X1 n=1 Tax=Cryptotermes secundus TaxID=105785 RepID=UPI000CD7D6DD  ali  25  14..............VIDGTPLSETAGNSTEMEHLKSSIDDIFVISNGIIVCFMQCGFACLEAGAVRSKNTTNIMMKNLMDIFISSVAYWLFGFALAYGEGNSVIGYTHW----------------------AGIGIDYGKMANWFFQCIFAATAATIVSGAVAERCNYIAYITYSFVISGFVYPPVTHWVW---TEEGWLYKLGYVDFSGCGPIHLIGGVCSFFGALFLGPRLGRFENKFNGHSVPLTGIGGMILIAGFLAFNGGSIGSMSKP----GDQFVIARVIINTILGGSGGSIVMLGMCKLGFGGWSFSLTLNAALAGMVSVCAGADVMAMWASFVSGALMAPLYLGIHYAVLWIKLDDPLDAVAVHFGGGFWGLLSASLF----GNGGIVFGASYESGLLLWHRXXXXXXXXXXXXXXXXXXXXLLKRSGKLRVTEEEELKGLDIAMHNEPGYPL........ 439
146 3.000e-52UniRef50_A0A0L0HJD2 Ammonium transporter n=1 Tax=Spizellomyces punctatus DAOM BR117 TaxID=645134 RepID=A0A0L0HJD2_SPIPN  ali  38  1....................MSSNTLSPRQAPATADGAANVFVMLCSALVLIMIPGLGYFYSGLSHHKNALVFLHLCMLSLAIVSIQWFLWGFSISFSPSGGPFIGNGHYA------------GLKNGGEELYPGTVLSTDVFAMFQAMFAALTAALPFGSAADRTRILPSXXXXXXXXXXXXXXXXXXX---XXXNGWLRARGYLDFAGGCPVEVVSGFAGLAFAIYMGPRRTRIADE-KPHNVGYVILGTALLWFGWLGFNGGSALTATRRAGXXXXXXXXXXXXX--------XXXXXXXDYLYNGHKYSAVGFCVGAVAGLVAITPAAGFVEPWAGVVIGVIAGTVCRFVADIT-KGKIDDTLDVFAVHGVGGVIGNLLTAIFAERSIIQGINGGWMNGNFKQLWIHLYATITVAAWSFCLTYIVFYLLDKTPGLRVKERHESLGLDLAQIGEYAYNYHRPETVPP 431
147 3.000e-52UniRef50_A0A1W9L509 Ammonium transporter n=2 Tax=Beggiatoa sp. IS2 TaxID=1934247 RepID=A0A1W9L509_9GAMM  ali  31  2.....................................IDIAWILICAVLVALMQPGFMCLESGLTRSKNSINVAVKNLADFGISTLLFWAIGYGLMFGDTWYGWIGTQQYFFQSPHDHPFGGA-------------------FFIFQMMFCGTAVTIISGAVAERMKFSSYXXXXXXXXXXXXXXXXXXXXNSTCPSGWLGQRGFIDFAGSTVVHSIGGWVSLAILLIIGPREGRFPTNGPPHEIRGXXXXXXXXXXX----XXXXXXXXXXXXXTLALNAQVGHILINTTIAAAAGMIVATFLEWSWHRQAKVEALMNGCLAGLVAITASCXXXXXXXXXXXXXXXXXXXXXXKYLLNHWRIDDAVDAIPVHAAGGIWGTLAVAFFAAPEFFIPG-----TSRWEQFXXXXXXXXXXXXXXXXXXXXXXXXXNTFFPLRLSIEEERIGLNVSEHGVS............ 398
148 3.000e-52UniRef50_A0A2U9R8A2 Uncharacterized protein n=2 Tax=Pichia kudriavzevii TaxID=4909 RepID=A0A2U9R8A2_PICKU  ali  29  40.....SRLELIVIHLPSNTSSIMAANALANDTSTLNMVDTAYELFCTVGVMILTPAIGMFYGGTLKRKNIIQILMQSYLVTAVISLQWFFLGYSLAVSTSSSHVMG-----------NLSLGAIPNLGMGPYFEGGTIPSIVYFTFSAFFPIATVQIFVGAIAERSRLLPSLILGFLWTTVVYCPLAYSTWNGNGWLL---NLGALDFAGGGPVHIASGITSLTYSYFIGPRKVWKNKEHEPENTIITFIGVSFIWFSWLCFNSG---------TLGAVNVRTGYILTNTQLAASAAMVSFVAVDYAFTRKWSLIAACEGAVSGLVNITPSCGFYTPYWAVITSIFVGAVCRLCYNFNEASHIDDTTRSFVIHGIGGILGSICLGVFASPDGATVIEGGWIYHHWKQMGYQFAGWVSISVWSAGATYILCFIIDKIPGMRADDEIENIGTDIFEMAER............ 478
149 4.000e-52UniRef50_R1CB00 Tentative ammonium transporter n=1 Tax=Emiliania huxleyi TaxID=2903 RepID=R1CB00_EMIHU  ali  24  6.......TLGAALMTNNPTLEAELSALRARVEADEADINTFYLMVCGAFVFLMQAGFALLAAGSVRAKNVKNILLKSVCDACLGGLVWFLVGYSVAYHGGDAPVAYHGGDAPGNPFIGTDSSYLALSGVRDWEKNDQGASYAGWMFQYAFAAAAATIVSGAVAERCXXXXXXXXXXXXXXXXXXXXXXXXXDPLGWLSASNPQGMIDFAGSGVVHMTGGVAAFVAAGVLGHRLDRWENPFQGQDAALQVIGTFLLWFGWYGFNPGSTLALHNADHTLARDAATTTLSAAAAATTGLLIKRHLPESLGGSRTWDLAHTCNSLLGGLVSITAGCSTVSPAASLLIGCAGAWIYHAASCLMRRLRIDDPLDAFAVHGACGFWGCVSVGLFASRVYSGYDAGLLNGGRGVLLAAQLAGALSIVCWVAATSGLLFWTLRALNIFRISEEMELAGSDFTKHGGPAYPWVAHHERM. 494
150 5.000e-52UniRef50_A0A044R5B3 Ammonium transporter n=5 Tax=Onchocercidae TaxID=6296 RepID=A0A044R5B3_ONCVO  ali  26  29................................EKLYQDDAVWITTSSFIIFTMHSGFGLLESGSVAAKDEVNIMVKNVVDVVFGGLAYWAFGYGLSFGNG-----------IYSNAITGWGKFFYNPERNLDSPRDEGWAYANFLFQLSFATTSSTIVSGAVAERAKLKSYILLG-CIVILIQALPSHWVWD---RQGIFFKLGVVDFAGCSCIHMVGGIIGLVATIYLKPRRNRFSENHQMSSPTNALLGTFMLWWGWFGINSGSACGVTNGRWRLAAR-----ASVATIMSSIGGGITSIIFSFAKTKKLQVNYLIFGLLSSVVAITAICAVARPWHALLIGAISSAISISVIPALEFLKIDDPVGIIPIHLAASIWGMCAVGIFAEDDLTNGHYGLIYSGSFKLLAIQXXXXXXXXXXXXXXXXXXXXXXXKSPGIRVTDYEEQIGADVIEHG.............. 439
151 5.000e-52UniRef50_A0A1Q3M3Z1 Ammonium transporter (Fragment) n=3 Tax=Bacteria TaxID=2 RepID=A0A1Q3M3Z1_9BACT  ali  53  2................................................................................................................................................LFQCMFAVITPALIIGTFAERVKFSXXXXXXXXXXXXXXXXXXXXXXNGEGWLF---KLGALDFAGGTVVHINAGVSALIFCLLVGRRKGYRTTGHPPHNIPFVVIGTSLLWLGWFGFNAGSGLAS---------NGIAANAFLVTHLATAVAAVTWMALEWIINKKPTVVGFCTGAVAGLVAITPAAGSADXXXXXXXXXXXXXXXXXXXXXKSKLTYDDSLDAFGVHGIGGIVGSILTGVFASPIV-TGGPKGALYGDWHQLGXXXXXXXXXXXXXXXXXXXXFKIVDAIIGIRVTKEEESIGLDISQHGELAYSED....... 310
152 6.000e-52UniRef50_A0A261XTH9 Uncharacterized protein (Fragment) n=1 Tax=Bifiguratus adelaidae TaxID=1938954 RepID=A0A261XTH9_9FUNG  ali  38  3.........................DPAVPSASQLNNGDIAWVIMGSGLVFLMCCGLGFFYSGMARANHALSLMFLMLVSVAVVSFQWYFWGYSLTFSESGGPFIG------------DFAHIVGRGIGMDVRIGTNIPTNVFFLYQMMFACITPALAFGASAERMRLFPAXXXXXXXXXXXXXXXXXXXXNPNGWLS---KLGVMDYAGGTPVHISSGLAAVAYAMVLGKRKDYG-ETCVPHNVGFVFLGTALLWFGWFGFNGG---------SALAANARGVQAIISTHISGCVGGLLWSLLDYRRSRKWSMIGFCTGAVAGLAMVTPAAGYVSTSSALVFGVAGGVVCNFAVAVKHRYHFDDALDVFAVHYVGGLLGLFLTGIFAQQSIITVPLGGWLDGHWMQVPIQXXXXXXXXXXXXXXXXXXXXXXNRIPGLRLNDEDEMLGTDMAQMGEIAYGY........ 424
153 6.000e-52UniRef50_A0A2D6NAM6 Ammonium transporter n=1 Tax=Dehalococcoidia bacterium TaxID=2026734 RepID=A0A2D6NAM6_9CHLR  ali  30  32............................................................ETGLTRAKNYINVAVKNLVDFGLAFTLFWAFGFALMFGATNGGWLGSTH-------------------FMVSFTDAKPWLTAFFLFQAMFAGTTVTIISGAVAERIRFRAYIVIAIVCSTLY-PLYGHWVWGGQGAPGWLAARGFVDFAGSTVVHSVAGWLALAAVLIVGPRLGRFERPITPSNVPVVMFGTLFLWVGWIGFNGG---------SVLAFDGTVPGVIANTMLAASGGLLTALGVGWLRYGYPKPTSPMNGALAGLVAITASSHXXXXXXXXXXXXXXXXXXXXXXXXXXRWRIDDAVGAIPVHLGAGIWGTLAVGMLGDPAILGTGL-----GRLEQIGAQLLGISVAGALTFGGGYVLFRLLNQLAPFRVSREDEIKGLNVSEH............... 399
154 7.000e-52UniRef50_A0A1Y5HQU8 Ammonium transporter n=1 Tax=`Osedax` symbiont bacterium Rs2_46_30_T18 TaxID=1856298 RepID=A0A1Y5HQU8_9BACT  ali  29  2.................................LFQNIDILWITFCAGIVFMMQAGFMCLESGLTRNMNSINVAMKNVADISLAFLVFWLFGFGLMFGESYQGVIGVSLFLIEQREISANV-------------------LTMFLFQAMFCGAAVTIISGAIAERIKFSSXXXXXXXXXXXXXXXXXXXXXXXGGTSGWLAEKGFIDFAGSSVVHSLGGWSALALLIIIGPRKNRFFADGRPRKVEPXXXXXXXXXXX----XXXXXXXXXXXXXXXXXNDSVANVIVNTMLAGSAGLSTGLFLERWIYRHYSPKSCINGALAGLVAVTASANIVSGTDXXXXXXXXXXXXXXXXXXXXRFKIDDAVSAVPVHLGAGVWGTFAVALFANDQLNNGLNTL------EQLTIQGLGVLVCGLWAFALTYIICSTINYFHPLRISDAVENEGLDLAEH............... 396
155 7.000e-52UniRef50_A0A2B4RLI7 Ammonium transporter n=3 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4RLI7_STYPI  ali  27  61............................................................ESGMVSRKNEANIMVKNAVDVIFGGLGFWMFGFAFTFGKDEG----------------ANAFSGYGSFFTDAEETRMGDVFALYCFQASFATTATTIVSGAVAERMNLKAYIIFAFTNTLTYCFP-AHWVWGDTGWLR---RMGVVDMGGASPVHLVGGVAGLVATIMLKPRAGKFKSTHKMGSPTNVLLGMFMLWWGWLGFNCGSTFGVSGGRWKLASRSAVC-----TINASCGGGVFATFYSYFKCNRLDIPFFMVGVLGSLVSITAICGVVRPGESLAIGFIGSAISILGWQLLNKLKIDDPVGAVPTHAGGSIWGMLAVGLFVEKDTLSSTYGAFKGGHVKILGVQLLACVSITVWTIITVFMQLYIIEKTVGLRFPLEEEILGADACEHGI............. 444
156 7.000e-52UniRef50_UPI000C1A2B02 ammonium transporter n=1 Tax=Erwinia TaxID=551 RepID=UPI000C1A2B02  ali  47  4...................................................................................................................................ITHAG-IPLLVHFVYQMMFAIITPALITGAFAHRVNFSAYMIFITLWTLLVYCPFVHMIWSSDGFFARW---GVADFAGGIVVHATAGLAALASAIYVGKRMVNTQQ---DHNIPFVALGAGLLWFGWYGFNAGSEFQINTITVXXXXXXXXXXXXXXXXXXXXDRAHC---------GTVKLSSFLTGAVAGLATITPAAGYVSLESAAIIGVIGSIICYYSVLLVRR-HIDDALDVFAVHGMGGITGSILVGVFAS................................................................................. 244
157 8.000e-52UniRef50_K9Q1J8 Ammonium transporter n=2 Tax=Synechococcales TaxID=1890424 RepID=K9Q1J8_9CYAN  ali  28  2.....................................VDSLWVLICACLVFLMQPGFMCLESGLTRSKNNINVAVKNLADFAVSTFCFWVVGYGLMFGLSATGWWGQNYFLHDWQ---------------------DPQEIAFFLFQIMFCGTATTIVSGAIAERTRFTAYLAIAMMISCVVYPLFGHWAWNGPEIQGWLGIRGFIDFAGSTVVHSIGAWVALAVLLHLGSRTGVYEKGRKHK-----IHGSNXXXXXXXXXXXXXXXXXXXXGSTLAFNDDVPHILLNTLMAAVTGLLGAGSIRAIQTRNIDVEALINGSLAGLVSITACCHXXXXXXXXXXXXXXXXXXXXGQYCLDCWEIDDAIAAIPVHGFAGAWGTLCVALFGQVELLPT-------SRLSQLFXXXXXXXXXXXXXXXXXXXXXXXXKKFFPLRVTAEAERLGLNITEH............... 389
158 9.000e-52UniRef50_UPI000C75A929 putative ammonium transporter 1 n=1 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C75A929  ali  25  155............................................................EAGAVRSKNTVNILIKNLLDAFIGGISYWAFGWGLAYGSGGNGFCGASEFLNYH---------------------LDYNKYPKWFFQFGFAATSSTIVAGAIAERCQIGAYFIYSTVITGFVYPIVSHWAWDYGDYNGNGQGWGFLDFGGSGVVHLVGSSCSLVACAFIGRRRGRFNKQGQVLEMLGHSXXXXXXXXXXXXXXXXXXXXKNASISQEGDGATVALAIVNTVLGASSGGISVLLIYRFFHHHWSFLVTLNGSLAGMVSICGGANVYEPWAALVIGTMAGIIFLAVRQLMFKLQLDDPLDSVAVHGTGGVLGLLAVPFFMYATLDEGKRGIFFDGHWTVLGYNALGCFCIIVWSCFWSVIIFGLTSYFGLLRITVDMELRGVDYLKHGESAYPAEA...... 546
159 1.000e-51UniRef50_A0A067P1Z8 Ammonium transporter n=15 Tax=Dikarya TaxID=451864 RepID=A0A067P1Z8_PLEOS  ali  32  283..............................................................GLARRKSALTLVWAVAASNAVTIFQWYFWGYSLALSRS----------ATNGYIGNLRHFGLRKVLAEPSPGSPLIPELLYSFYQMEFACVTVAILMGGIAERGRVFPAMVFTFVWMTLVYCPLACWAWG---ANGWAFKWGVMDYAGGGPVEIGSGIGGLAYAWALGRRTEKELINFRPHNVTNVGLGTFILWFGWIAFNGGSAFG---------ANLRAVMATWNSMVAAAFGGMTWCLLDYRIGRRWTMVGFCSGTIAGLVAATPSSGFIHPWASLILGVVAGAICNFATKIKFLVGIDDALDLFAEHAVGGILGLLFNALFADTEVIAEVAGGWIDHNWKQLYIQVAYICATCAYTFVMTALLAKGIDIIPGLRNDAKGEELGMDEVEIGEFATDYVEARRD.. 674
160 1.000e-51UniRef50_A0A073CBN3 Amt3 n=9 Tax=Cyanobacteria TaxID=1117 RepID=A0A073CBN3_PLAAG  ali  31  2.....................................IDILWLLVCSGLVFLMQPGFMCLESGLTRSKNSINVAVKNFADFGISVALFWAFGYAIMFSRAAMGGI--------------------DPQALFFDTPSNPGQAAFFLFEAMFCSTATTIVSGASAERMKFGAYLLVAALTSGIIYPVFGHWAWNGNHLLGWLGKIGFVDFAGSTIVHSIGGWVSLAVLLVIGPRLGRFTPDMRGSNLQLSVLGAMLLWLGWLGFNGG---------SYLHLDIRVATVIVNTILAGTSGMLVGAVLGWLLYRRPEVELIINGSLAGLVAITASSHXXXXXXXXXXXXXXXXXXXXXXXXXQRCQIDDAVDGIAVHAGGGVWGTLAVGLFGNLDLLHTGL-----SRSQQXXXXXXXXXXXXXXXXXXXXXXXXXXNHYFPLRVSLEAETTGLNISEHGTEIYDLFEVME... 407
161 1.000e-51UniRef50_A0A1C0V5Y2 Uncharacterized protein n=3 Tax=Limnothrix TaxID=132605 RepID=A0A1C0V5Y2_9CYAN  ali  29  3......................................DVAWLLGCSGLVFLMQPGFMCLESGMTRSKNSINVAAKNLSDF--------------------GXXXXXXXXXXXXXXXXXXXXXXXXHDYFALSVESQPQLAAFLIFQLMFCGTSTTIISGAVAERMRFSSYLIVCFLCSGLIYPLFGHWAWKGGQGVGWLRSLGFYDFAGSTVVHSVGGWIALATLLVVGPRWGRYQHKISGSNLPFSMLGAMMLWLGWLGFNGG---------STLALNEHVPAVLVHTVIGGVAGMLGGGALGWYYRHRPDVECLINSSLAGMVAVTACCNXXXXXXXXXXXXXXXXXXXXXXXXXDRRQIDDAVGAVPIHAGAGAWGTLCVGLFGDLSQMPGGLE-----RPQQIAVQLLGIGVCALWSFGLSYGLLRWVDRLHPLRVSLAEEQMGLNVAEHQVEVYDLFEVMDHH. 415
162 1.000e-51UniRef50_H3GCZ6 Ammonium transporter n=71 Tax=Oomycetes TaxID=4762 RepID=H3GCZ6_PHYRM  ali  43  91.............................................................AGLAGEDMASNTMMMSFVSMALVSIQFWAFGYSAAFGSHGVF---------------GWAGYNNVREIPSGTYGTGIPHILFAFFQTQFATITPALLSGGIVGRMKFGSYLLFILLWTSLVYDPLAHWMWSSITALGWEGKMGSLDFAGGTVIHISSGFGALAAALMVGKRYNHGDPV-KPHNVPLVMIGATLLWFGWFGFNAG---------SQGAADGIAATAAINTHLAPSAGFLTWVGLEFAMYKKFDPCGAASGAVAGLVAITPGCGXXXXXXXXXXXXXXXXXXXXXXHMKNYLRYDDTLDSFAIHGCAGVMGGLLTGLFATSEVNPNIEGGAFYGNGMQFVHQLVSQCVAAAYSFVVTIIILFVLKITIGLRVDEEKEVNGIDVSYHGGLAYDYSAQDHTGP 481
163 1.000e-51UniRef50_L1JJX7 Ammonium transporter n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1JJX7_GUITH  ali  42  1....................MASQWPE--SDCSKINSGDTXXXXXXXXXXXXXXXXXXXXYGGLVHRKSVLTIIMQCVISMGTTSLIWFLIGFSLAFGEGGGVIGNPKSYPVNLDPCTPVGYPM--QPNDAMAFPGLL----FAAYQMMFAIISPALITGAFADRVTXXXXXXXXXXXXXXXXXXXXXXXXNPAGFLNKWG---VKDFAGGIVVHISAGFAALASVFVVGSRKYKSEELQVPHNRTFVALGTGMLWFGWFGFNGGSALA-----------SNGVAVFAVTNSCIACSTAMWTIIEWVSTSKPSLVGACVGAIAGLATITPCAGFVRPWAALVIGVVAALFCYGCVKFRDMMKWDDALDVWAVHGMGGFIGSILLGILADEGV.............................................................................. 360
164 1.000e-51UniRef50_A0A238UT24 Ammonium transporter n=1 Tax=Actinomadura mexicana TaxID=134959 RepID=A0A238UT24_9ACTN  ali  43  94.......................................................................................................................................GVIPEYVFSMFQLVFAIITLALISGSVANRVRXXXXXXXXXXXXXXXXXXXXXXXXSKGGWINRWG---ALDFAGGLVVELNSGIAGLALALVLGPRREGPPE---PKNIPLVMAGMGLLWFGWFGFNGGSAL-----TDGALAAN----AVVNTMMCGCVAMLVWMLLERARFGQFSRLGGTTGALAGLVAITPACGYVNLLGATVLGIVVAVVCTYAVEVKTSAGYDDTLDVVGIHGAGGIVGVVLLGFFATGKYGSPTAGLAYGGSISLLGKQIVAILAVGCYSFVITYVIGKAVDVLLAFRPSAREEAEGLD................... 398
165 2.000e-51UniRef50_A0A2S5BET7 Ammonium transporter n=1 Tax=Rhodotorula taiwanensis TaxID=741276 RepID=A0A2S5BET7_9BASI  ali  30  75..........................................VITATVIVHIMPIGLGLLYSGLMRRKNALSMLFLAMSAYAVGTLQWWLMGYSLTYSETGSTFIGT-----------LRYGAGVGVDIQPSPGSTAIPALLYFIYQAQFQSITACVLVAGTAERGRMLPFLILAFAWCTVVYNPIARWVWSSKGWLYPH----DLDFAGGGPVHIASGTGSVVLAFFVGPRRGYGTADYRPQSPLLIALGTAFLWFGHAFSRFLRFWNCFNGASMSALNLKSMMCVSNTVLAGCAGALSWTTLDFIWTRKYSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTSLKHYAKIDDAVDAGALHGMGGICGAIVTGIFADSDGMTEIEGGWINGNFKQMGWQLAGCLTIVTYTAVVTYILCFVINLIPGFRSSEEAEIVGIDEAEIGEFTFDYVLLDQD.. 494
166 2.000e-51UniRef50_A7S3L2 Ammonium transporter n=2 Tax=Eumetazoa TaxID=6072 RepID=A7S3L2_NEMVE  ali  27  35..................................ISSDDATWILTSAFIIFTMQSGFGLLESGMVSSKNEANIMVKNAVDVIYGGLAYWVFGFALSFGT----------------KERNNGFCGLGYFFTDAEEHEMGTVYAKYFFQLSFSTTATTIVSGAMAERASLKAYTLFSFVNTITYCFPAHWI----WDEMGWLKALGAVDIAGGSAVHLVGGISGLVATLILKPRHGKFDPKCPMASPTNVLLGTFMLWWGWLGFNCGSTFGISGAKWKLASRSAVV-----TINGSVGGGVLGMSYSYLMHKKLNIHVFVTGILGGLVSITAICSVARPWEALVIGSIGALIACSGCSLLEKLKIDDPVGCVPTHAFAGIWGLIAVGLFAEKDTLSNSYGVFKGGPWRXXXXXXXXXXXXXXXXXXXXXXELKLIDKIFPLRVTLENELLGADDYEHGIK-YDFLEFEE... 449
167 2.000e-51UniRef50_E0VUA6 Ammonium transporter n=7 Tax=Neoptera TaxID=33340 RepID=E0VUA6_PEDHC  ali  28  7.....................ENQTEKDIPIIYQLNQEDTNWLMTSSFIIFTMQTGFGLLESGCISLKNEVNIMMKNVVDIVLGGFTYWLFGYGLSFG--------------RGKYTNSFIAFGDFAIDANVGDPLMGAKLAAFIFQLSFATTATTIVSGAMAERCNFKAYCLFSFLNTVVYCVPAGWV----WGEHGFLYKLGVVDIAGSGPVHVVGGSSAFASAFMLGPRLGRYLKGMPLGNPINCCMGLFVLWWGWLAFNSGSTYGISGSKWEFAA-----KAAVNTMLSSFSGGLFGLIYSLFQNGNIDILHLINGVLGSLVSITAGCYLYTAWESLIIGFVGSFLTNVSTPWFIHLGLDDPVSATSVHGLCGLWGVLSVGIFARSATTRGRNGLLYGGGWYLLGVQFLECXXXXXXXXXXXXXXXXXXXXXXXXXMKEHEELIGADLVEH............... 425
168 2.000e-51UniRef50_A0A238BXS7 Ammonium transporter (Fragment) n=1 Tax=Onchocerca flexuosa TaxID=387005 RepID=A0A238BXS7_9BILA  ali  25  18................................EKLYQDDAVWITTSSFIIFTMHSGFGLLESGSVAAKDEVNIMVKNVVDVVFGGLAYWAFGYGLSFGNG----------VYSNAITGWGNFFYNPERDLDSPRNE-GWAYANFLFQLSFATTSSTIVSGAVAERAKLKSYILLG-CIVILIQALPSHWVWD---RQGIFFKLGVVDFAGCSCIHMVGGIIGLVATIYLKPRRNRFSENHQMSSPTNALLGTFMLWWGWFGINSGSACGVTDGRWRLAAR-----ASVATIMSSIGGGITSITFSFAKTKKLQVNYLIFGLLSSVVAITAICAVARPWHALLIGAISSAISISVIPALEFLKIDDPVGIIPIHLTASIWGMCAVGIFAEDDLTNGHYGLIYSGSFKLLAIQXXXXXXXXXXXXXXXXXXXXXXXXSPGIRVTDYEEQIGADVIEHG.............. 428
169 2.000e-51UniRef50_A0A241UV57 Ammonium transporter n=3 Tax=Acinetobacter TaxID=469 RepID=A0A241UV57_9GAMM  ali  50  190...........................................................................................................................................................................................................GVLDFAGGTAVHINSGIAALVGVLVLGKRHGWPTTAMPPHNXXXXXXXXXXXXXXXXXXXXGSALS-ANTTAG--------VALLTTMLATCAGITGWMCIEKMMAKHVTSLGLASGAVAGLVGITPAAAYVGPLGALAIGFLTSICCFYAVTLKRKFGFDDAVDVFALHGVGGMVGAILTGIFCIPALGGTVSDVNLVQQF---FAQVAGIVLTIVYCGCFTWLIMKGIDMTIGLRVSAEEEQQGLDIIEHNERAYNS........ 437
170 3.000e-51UniRef50_A0A0E3YV33 Ammonium transporter n=29 Tax=root TaxID=1 RepID=A0A0E3YV33_9BACT  ali  45  79....................................PGHSAWMMTSCALVLFMTPGLALFYGGLVRRKNVLSILAQCLGLTGVVSLIWWACGYSLSFSTGNPVIGDLSFAFLR-----------DVGLAPNPNYAQWVPHNLFAIYQMMFAIITPALTVGAIAERMKFKXXXXXXXXXXXXXXXXXXXXXXXXGGLMNPTAAIKAIDFAGGIVVHMTSGWSALALCILLGKRLGHGREHMAPHSLVFCMAGTGMLWVGWYGFNAG---------SAVAADGVAVNAFVTTTLAAAAGCFMWPFLEYLRRGKPSVLGFCSGAVAGLATITPASGFVTAGTAILIGLVAGAATYFACHLKSFFKYDDSLDTFGVHAVGGTIGTLLAGIFATTAANPNLANGPIAAGKTLWLEQLKAGGIVLVWSVGATFVIAKLVGWVGGLRVDGDDETLGLDLAEHGEEGY.......... 491
171 3.000e-51UniRef50_A0A267G3F6 Ammonium transporter n=2 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267G3F6_9PLAT  ali  25  1............MASSAELLNGTLQELKTQIRGTNESLDSFFLCTMAIVVYFMQCGFAFLEAGAVRSKNTTNILIKNILDSFIGGIAYYVIGYGLAFGAPNG--------------------NPFCGSGYFAMSYLPESKFSHWFFQFVFAATAATIVSGAVAERCEFLAYITYSFIITGIVYPIVSHWAWDGDIGWLSIGIKAYHDFAGSGVVHVTGGCAAFVAAAILGPRIGRFDDETKKPLDIHSVPLASLGGFILFFGFFAFNGGSQLSISNSSDGSVVAIAMVNTILSGSVAAFVTLLLGRIRGPHWSLLQTINGGLAGMVAICAGCDVVYPWGACIIGFFAAISYTCWSMLLLALKIDDPLDAVAVHYGGGLWGVIAVAFLHRSRGIVMTFDQQSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLLKVF---RVSREYEIKGLDFPKHGEMAYPLTAYGH... 442
172 4.000e-51UniRef50_A6C3Z9 Ammonium/methylammonium permease n=4 Tax=Gimesia TaxID=1649453 RepID=A6C3Z9_9PLAN  ali  31  6....................................TTNTIWVLTCTSLVFLMQAGFCCLESGLSRSKNSINVATKNXXXXXXXXXX-------------------XXXXXXXXXXXXXYGGWVGTTQFAFEDTSNAHWPTVVFLFQLVFCSTAMTISSGAVAERMRFRAYXXXXXXXXXXXXXXXXXXXXATGAPAGWLGKLGFLDFAGSSVVHSVGAWSALAAVLILGPRTGRFTDDNNKHNLPMAALGFLILWFGWFGFNGG---------STLALNGQVPSIILNTILAGISGGICVLLWELIVSNQISVEKIFNGSLAGLVAITASCNAVSYXXXXXXXXXXXXXXXXXXXXXERFKIDDVVGAIPVHGFAGAWGTLAVALFADTSLFPSGA-----SRISQLGIQSLGAGVCFVWSFGSIWIIMKLVNHFMPIRVSVSDEKIGLNVAEHG.............. 401
173 4.000e-51UniRef50_A0A0B0EHP8 Ammonium transporter n=4 Tax=Planctomycetes TaxID=203682 RepID=A0A0B0EHP8_9BACT  ali  28  59.........HTSVASDMASSYSVHSSEIRDIEGVKISIDLAWTLLCGFLVFNMQAGFAFLGAGFLQKKNTLNYLTMSFMDFCXXXXX-----------XXXXXXXXXXXXXXXXXXXDTGNTLVGYSGFFLSFGSFDYSTSKLWLFQMMFSAAACTIVAGAVAERIKFNTHIICSAVLCGIIYPVYGHWVWGGGWLANLPFGSGMKDFAGSGVVHGIGGLTALVAAWMIGPRFGKYPNMFHGHNLSFVVLGTLFLLFGWFGFNAGSTLGSTD--------FRVSIIAANTFLAACTGGVALMYITYFDTGKFDIVMTCNGTLAGCVAITAXXXXXXXXXXXXXXXXXXXXXRESLHFVERLRIDDPVGAISVHGANGLWGLLSVGIFA--DGSYHGVKGLITGSGWQLLSQFIGCAVLITWTFSFGYILFYILKKTIGLRVPVNEENTGIDVYEHGISCYPGF....... 497
174 4.000e-51UniRef50_A0A1I3I9Y5 Ammonium transporter, Amt family n=6 Tax=Bacteria TaxID=2 RepID=A0A1I3I9Y5_9SPIO  ali  30  6.......................................SVWFLIGAALVFFMQCGFAMVETGFTRAKNAGNIIMKNLMDFCIGTPMFMLLGFGLMMSENY-------------------FFGVIGKPNMQLFTNFAEGDWSAFVFNLVFCATAATIVSGSMAERTKFSAYCIYSAVISAVVYPIEAGWVWNSQGWLV---QLGFVDFAGGAAIHSVGGTAALIGAMFLGPRIGKYDHAIPGHSLTLGALGTFILWFGWYGFNGAACTQLLGVGGLAA-------VFTTTTIAPAVAAVTTMIFTWVKNGKPDVSMTLNASLAGLVAITPTCATXXXXXXXXXXXXXXXXXXXXXXXXDKLHIDDPVGAVAVHLANGIWGTLSDGLF------NVENGVFYGGGFKHLGVQCLGEVTIVAWTTVCMIITFSLIKKFHGLRASREEEIVGLDKLEHGI............. 399
175 5.000e-51UniRef50_C1N1P5 Ammonium transporter n=2 Tax=Micromonas TaxID=38832 RepID=C1N1P5_MICPC  ali  27  5...................................DALDTMFIIYGASLVFFMQAGFSLLEVGSVSIRNTKNILFKNLMDVSFSTVCFYLVGYAFLYGGNSSFIGGTAFALQSRA--------FHGSDRSDDAEALRGVNYAKFVYAFAFAATATTIVSGAVAERFRFKAYAVYGACITGFIYPVVAHWAWSDDGWNGLLFSSGVVDYAGSAVVHVTGGLAALLACVAVGPRVGRFNGNMPYQSPVFQTLGTYIMWFCWYGFNCVASTSLSGGKGVLAGRSAVN----TTIAAAFGGAVTMLMDSYAKHQKLEPRRMNNGILCGLVSISGSAGLIEPHYAVIVGSVAGIVYPTASKLLHKFKVDDVVDAVPVHLGGGVWGLLAASLFTSSRAYLTKYDSYVDDGGAILGSNFVFLLAQVSWVVVTCSIVLYVIKRQIGLRVNLDDEVKGLDQSQHGGRSYTEF....... 446
176 5.000e-51UniRef50_A0A1Z4RMZ7 Ammonium transporter n=3 Tax=Chroococcales TaxID=1118 RepID=A0A1Z4RMZ7_9CHRO  ali  29  2....................................NSNYLWLIFSTFLVFLMQPGFMCLESGLTRTKNSINVAIKNLTDFGXXXXX-------------------XXXXXXXXXXXXXXXDLFGTSNFFFDPKSASAREIIFFIFEMMFCSTAANIVSGASAERLKFRSYVIVTMIISGLIYPIFCHWAWNGGNLHGYLYHLGFIDFAGSTVVHSVGGWVSLAVILIVGARKGRFNQAGKPQ----QIHGSNXXXXXXXXXXXXXXXXXXXXGNVFALTTQVASIILNTLMAGAAGMVCVGIISWQRLKTTKVEVLINGSLAGLVSITAACNIVTTPDAILIGAIGGGVSMLVSCLLESWQIDDAVDAIPVHLGGGIWGTLAVALYGQPELLHTGYN-----RFSQFXXXXXXXXXXXXXXXXXXXXXXKVINRITPLRVSARDEDQGLNVSEH............... 395
177 5.000e-51UniRef50_A0A142BCI6 Ammonium transporter n=2 Tax=Endozoicomonas TaxID=305899 RepID=A0A142BCI6_9GAMM  ali  32  1..........................................MTLCILLVLLMQAVFLCLEAGAVRSKNTVNVAAKNLVDLILVTLFYFAIGFTIQYG-------------------------WFSDFSQNAHPDGQHYPYIFLLFQTLFAATAATIVSGAVSERXXXXXXXXXXXXXXXXXXXXXXXXXXXXDTPQGWLAKAGFVDFAGATQVHALGGAVALASVLVIGPRLGFGYKVFRGLNQTLSLLGVMLLWLGWFGFNMG---------SLLKMDALLSLVMINTFISACAGGLASLVWSIVFFHKTDIPMVANGVLAGLVGITAGAHAVQPPEAILIGSMAGLICSGMTVFLEHHKIDDVIGAIPVHLGAGTWGALSVGLLGDPEILNTGHDL-----ISQFGIQLLGVSCVVVWSFVMSYTLLKVVNRWYPLRVSAESEQIGLNISEHG.............. 380
178 5.000e-51UniRef50_A0A2A2KVB7 Ammonium transporter n=2 Tax=Chromadorea TaxID=119089 RepID=A0A2A2KVB7_9BILA  ali  24  4.........................EPVGSSSETAAQDDGVWMSACSFTIFTMTSGFGLLECGRVSAKDEVNVMVKNVVDMIFGGLAYWVAGFGLTFG---------SYAEWSNPFVGVGDFFFDPERNDTANFNEKGLSYTMFIFQMSFATTTSTIVSAGMAERIHLKSHCFISFF-ITLVHAVSGHWVWA---REGIFRRIGVIDSAGCSCVHLVGGVSGLVATLYLKPRRHRFGSNGNKNDPTKAILGFFMLWWGWVAFNTASNYAVSHKQWTEGTRSAV-----ATIMASAGGGIVTVVISRVTMRKIEIDMLIDGMLASLVSTTAGCLFYTPWQAIAVGSIGSAAALSIYPLTEWAHIDDPVGIIPVHVVGSFWGMIAPSIFLNKDYGLDTNGLLYGGGFTLLGLQTLAACVIALWSAVCSFVILYTLQHSIGLRISKYDEELGADLREHG.............. 428
179 5.000e-51UniRef50_A0A1I3FG49 Ammonium transporter n=4 Tax=Bacteria TaxID=2 RepID=A0A1I3FG49_9PLAN  ali  48  55................................PPLDAGKVAWMLTSSALVLFMTPGLALFYGGLVRKKNILGVMMQCXXXXXXXXXXXXXXXXXXXXXXTNPYIGNFDFVLLKGVIAGPDRLL-----------EAAGNDMLFCVFQGMFFIITPALICGAFAERMKFSTMXXXXXXXXXXXXXXXXXXXXSTPGWLNVFNPFPGLDFAGGTVVHISSGVSALICALLIGKRVGFGKEPMPPHNLTYTCIGAAMLWVGWFGFNGG---------SALAADKWAVNAFLATHFAAAAGVLGWVFAEWIGHGKPTTLGACSGAVAGLVCITPAAGAVDPIQGLILGLAAGVVCYLACKLKNALGYDDSLDAFGVHGVGGTLGAILTGVFANKAITAGIGGGVLEGNPQQLVNQLVGIGCSMGLAIVGTFILLKLLDATMGLRVSQDDEIQGLDLSQHGEEGY.......... 473
180 7.000e-51UniRef50_A0A2E7K0D8 Ammonium transporter n=1 Tax=Rickettsiales bacterium TaxID=2026788 RepID=A0A2E7K0D8_9RICK  ali  23  80............................................................EAGLVRSKNSINVAQKNLADAFISATFYYLIGFNIMFGPTVNGFWGWG-------------------TDHYSLTHLSSWTHTFFVYQIVFCGTVATIVSGATAERMKFGAYMACTAFVSTVIYPIFGHWAWGDPTNHTFLTDDGFIDFAGSTVVCSLGAWVSLAALMVIGPRIGKYNDPIQGHSIVLAAFGGLVMWMGTLAFNSGLAHAGSEELA---------HVISNTILAGSFAGLTALVCGRLYEGLYRPERSIFGMLGGIVAIAAGCHVFPTIGTLIVSVVAGLICYFFEILTRKFKIDDAVCAIPINGFCGAWGTLMVGPLMMEEALGE------TTRLTQTLVQAEGVAIAFLWAFGLSYIFFRILDKMVGLRVTPAEEQVGLNTAEHG.............. 450
181 7.000e-51UniRef50_UPI00036C9C3C ammonium transporter n=1 Tax=Woodsholea maritima TaxID=240237 RepID=UPI00036C9C3C  ali  30  60............................................................EAGAARSKNSINVAQKNLTDFFMATTIFFLFGFALMFGPNVMGVFGWSNEYLFGP-------------------SQSNWSMAFFVFQAMFVGTAATIVSGAVAERMTFSSYXXXXXXXXXXXXXXXXXXXXGNTENTVWLADLGFIDFAGSTVVHSVGGWIALAAIICVGPRIGKYTTEIKGHSMVMTTSGALILFVGWIGFNGGSTTAGS---------ADIGRIIANTVIAGAIGGTLGMLMGRWRDGLFRPHRGVNGMLGGLVGITAGCDAVLPGGAAMIGVICGISVGFVEDLLERFKLDDVIGAVAVHGVCGAIGTLLVAVFAMPE------KLVADTRMMQLGVQAIGVVTAFVWTFGLSFVALKLISPIFHLRVSEKDEHDGLNHAEHGES............ 432
182 8.000e-51UniRef50_A0A0L7RD10 Ammonium transporter n=46 Tax=Arthropoda TaxID=6656 RepID=A0A0L7RD10_9HYME  ali  26  8................TTTINASVTEAYVASAYNLNQEDSNWIVTNSFIIFTMQTGFGMLESGCVSLKNEVNIMMKNVVDIVLGGLTYWAFGFAMSFGSDR--------------LNNPFIGMGEFLMDPSLDDKFMGPKCAAFLFQLSFATTSTTIVSGAMAERCNFKAYCLFSFLNTIVYCVPAGWI----WGDQGFLKNMGAVDIAGSGVVHLVGGTSALACAIMLGPRLGRYDNGIDPXXXXXXXXXXXXXXXXXXX--XXXXNSGSTYGISGQRWQYAARAAVSTMLASMGGGLIGLGFSLNNRNGIDILSQINGILGALVAITGGCFLFRAWEAITVGMIGASITCFAMPMLDKMHIDDPVGASATHGASGIWGIIAIGLFADNNTTSGRKGLFKGGGWYLLGVQCFXXXXXXXXXXXXXXXXXXXXNKIIPIRMSVHDELLGADLVEH............... 430
183 8.000e-51UniRef50_UPI0003B55E14 ammonium transporter n=1 Tax=Geovibrio sp. L21-Ace-BES TaxID=1304888 RepID=UPI0003B55E14  ali  33  34............................................................ETGYVRAKNSINIAMKNTTDFVAATLSFWIVGFALMFGESAGGFSGVTGYFLEGFSSSE--------------------DYAFFIFQLVFAGTAATIVSGAVAERMKXXXXXXXXXXXXXXXXXXXXHWVWNGDGWL---AKMGFVDFAGSTVVHSVGGWIGLVGAFILGPRIGRFNEKGEPYNLTLTTLGTFILWFGWFGFNGGSTLTGDG---------SVPLIILNTMLSAAAGGAGSFILSLLVTKKVLVDKMLNGILGGLVGITAGCXXXXXXXXXXXXXXXXXXXXXXERALILAHIDDPVGAVPVHGFCGAWGTLAVGIFAADVSLTT---------------QFIGVASCFVWSAGLAVPLFLTLKFTDLLRVKPDDEEIGLNIAEHG.............. 387
184 8.000e-51UniRef50_G5EB13 Ammonium transporter n=283 Tax=Eukaryota TaxID=2759 RepID=G5EB13_EMENI  ali  38  54.............................................................SGLARRKSALSXXXXXXXXXXXXXXXXXXXXYSLAFSHTAGKYIG-----------NLDNFGFKGVLGAPSVGSTKVPDXXXXXXXXXXXXXXXXXXXXXXXERGRMLPCMVFVFIWSTIIYDPVACWTWN---ASGWVFQLGGLDFAGGTPVHIVSGTTALAYSLMLGKRRGHGTHNYRPHNVTHVVIGTVFLWVGWFGFNAG---------SALSANLRAVMAAVVTNLAASVGGVTWCLLDYRLERKWSTVGFCSGVISGLVAITPGSGFVTPWAAFIFGVVGAAACNFATKVKYLIRVDDALDIFAVHGIGGLVGNLLTGLFAADDGSTEIDGGWINHNYIQLGYQLADSVTGMAYSFFGSCIILFIINMIPGLRVPEEDEVLGIDDAEIGEFAYDYVELTRDV. 447
185 1.000e-50UniRef50_A0A1Z5TPM6 NADPH--cytochrome P450 reductase n=1 Tax=Hortaea werneckii EXF-2000 TaxID=1157616 RepID=A0A1Z5TPM6_HORWE  ali  36  63..................................................................RKSSLALVFQSLAVAGMVTFQWMFWGYSLAYSRTAGPYIG-----------NLVNFGMMEVQAAPSPGSAVVPEIAFCLYQMLFCAVTVQILIGGSFERGRILPSLVFGFCWATIVYCPLACWTWNANGWLY---NLPSLDYAGGGPVHVASGWAALAYALVLGKRKHKGEQHGKPHNVTLVFLGTVLIWFGWFGFNGGSALNGS---------VRALYAAFNTNTAASTGVLGWITVDYIRRGRFSVVGACEGAIAGLVGITPAAGYVQVWPAALIGFLTAAVCALMQDVNKWLRIDEGLYVFKLHGIGGMIGSFLTGIFADSAISATVAEGAWNGNGVQVGLQLVDIVSISAYSFVMSCVLLLILKFFMHLRVSEEVEMNGLDLDQ................ 435
186 1.000e-50UniRef50_UPI000C78B81F putative ammonium transporter 1 n=1 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C78B81F  ali  25  24.......................VQTTPSEMQQLKDNMDNFFLVMMGCIILFMQAGFAFLEAGSVRSKNVTNILTKNFSEIVFGVPAYFA--------------------FGYAFTFGGGGGNSFIGLEYFCLIGLPPKQYSHAFFQATFAATCTTIVSGAIAERSNYNGYIIFCVFVTGVIYPIQAHWGWNANGWL---AQTEFHDFAGSGVVHLAGGSIALVATYILGPRLGRFNHPYSGHSMPLISLGVFIILFGFMAFNGGSQGSISNAEDGDIVAHAV---LSTLIACCVGGGVVLFIVKLTPGGSWSLNKMMNGSLIGMVSICSGADGFHPLIVCIVSGIAGCAYFVTSKLMIRMQVDDPVDAVAVHFAGGLVGMIASPIFMNNGVLFT---GGSSRSLEMLLWNCIAVLVIIAWNMSSAIVFFKALKMVNLFRATQKEEIQGLDILKHNEPAYPMEAYMNEM. 447
187 1.000e-50UniRef50_A0A2M8CWN5 Uncharacterized protein n=1 Tax=Alphaproteobacteria bacterium CG_4_9_14_3_um_filter_47_13 TaxID=1973899 RepID=A0A2M8CWN5_9PROT :_  ali  25  2.....................................IDIIWVILCSFLVFFMQPGFLCLEAGLTRTKNAINVAIKNISDFGVSSLIFWAVGFGFMFGETKYGWIG-------------------GTDFFPGFESDPARGFSFFLFQIMFCGTAVTIISGAVAERXXXXXXXXXXXXXXXXXXXXXXXXXXSFTGNPSWLLRLGFVDFAXXXXXXXXXXXXXXXXXXXXXXRTGRFQKEFSGSHLPLAMTGVFFLWIGWIGFNGGSTFAFSDQ---------VPKIIVNTVLAGSAGMLTAGTAGWIQYGYPKIITIMNGSLAGLVSITACCXXXXXXXXXXXXXXXXXXXXXXXXXXXRLKIDDVIGAVPVHLMSGIWGTIAVALFSDRSILATGL-----GRLEQLQIQLYGISVCFLMGFCATYIIFRILNYFWPLRISHQAEIEGLNFAE................ 393
188 1.000e-50UniRef50_E6RC55 Ammonium transporter n=12 Tax=Dikarya TaxID=451864 RepID=E6RC55_CRYGW  ali  36  56.................................................................RRKNALSMIFLSMAGVAVGSFQWFFWGYSLTFSDTGSKYIG-----------DLRYFGLKGVLAQPSAGSDRIPALVFCIYQCMFCVITGVIAIGGFAERSRIGPVMVFLFCWLTLVYCPLACWTWNPNGWS---FIMGGLDFAGGTPVHISSGTASLAIALYLGKRRGYGTERYKPHNTAFVVIGTVFLWFGWFGFNGG---------SALSANLRAVQACIVTNLSASIGGLTWMFLDYRLERKWSAVGFCSGAISGLVGITPXXXXXXXXXXXXXXXXXXXXCNFATKLKFLIRVDETLDVFASHGIGGMVGCFLTGLFAQGDGITDIPGGWVSHNWIQAGYQMADLTAGFAYTFVMTTIICWLLHFIPGLRASEEAEIIGIDDAYLGEFAYDYVGTDPEL. 445
189 1.000e-50UniRef50_A0A1G1MV93 Ammonium transporter n=1 Tax=Omnitrophica WOR_2 bacterium GWF2_43_52 TaxID=1801847 RepID=A0A1G1MV93_9BACT  ali  29  7.....................................IDTLWILICSVLVFIMQPGFSCLESGLTRAKNTINVAIKNLTDFGISSILFWALGFGLMFGESRGGLIGTSHFFLSLDRHSWFIA--------------------FFLFELVFCGTATTIISGAVAERMRFRAYXXXXXXXXXXXXXXXXXXXXNGNAYSGWLGKLGFRDFAGSTVVHSLAGWVSLSALVLIGPREGRFTKNAPPRKISGHDXXXXXXXXX----XXXXXXXXXXXGSTLAMNDAVSRIITNTILAGASGMVTTLAIGWSIKRLPHIEFVINGSLAGCVAITASCXXXXXXXXXXXXXXXXXXXXXXEELLERLRIDDAVGAIPVHLGAGVWGTLAVAVFGNPALINTGL-----SPLQQLSAQGXXXXXXXXXXXXXXXXXXXXXNRFVRLRVSPEEEYSGLNISEHG.............. 399
190 1.000e-50UniRef50_A0A2H0VXU1 Ammonium transporter n=1 Tax=Chlamydiae bacterium CG10_big_fil_rev_8_21_14_0_10_42_34 TaxID=1973936 RepID=A0A2H0VXU1_9BACT  ali  48  97.............................................................................................................................................SFILFQGMFAAISPVIINGSVVERVRFPALLLFSLLWSLAVYCPVAHWVWGPGGFL---ADMGALDFAGGTVIHITTGFSGLAACLYVGKRGGHAAKL-LPHNLTLSIIGTILIWFGWFGFNGGSAL---------YTDKVCSTAFITTNTAAASGLLAWMFAEWLHRGKPXXXXXXXXXXXXXXXXXXXXXXXXXMSSIAIGMVTSLICYGFVIAKHRVKYDDALDAFGIHGVGGVVGSVLTGVFASNAVDSEISNGLLYGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKFTHVRAHGKEERIGLDLTQHGESGYR......... 404
191 2.000e-50UniRef50_A0A0L1HHY0 Ammonium transporter 1 n=1 Tax=Stemphylium lycopersici TaxID=183478 RepID=A0A0L1HHY0_9PLEO  ali  32  504..........................MTTDLNALYDKGDLCWMLVSTVLCWQITPAIGFLYAGMSRRKSALTMLFQSLFCACAAGLQFWVYGYSLYQSHTSNPFLG-----------NLSKAGLHNTLASPSLANADIPDILYACFGFTFVTATAMILAGAMLERGRLGPSMLFLMCWTTFVYYVLAHAEWNP---SGWLFQLGVLDFAGSGPVHIASGFGALAWALMLGKRLDPNRESLHARIPHFRPHSPXXXXXXXXX--XXXXXXXXXXXSTANLSLRSIYIACNTNLAACAGGLAWVLLEYLFHPKFSILGFCSGIISGLVGITPACGFVPIQTAPAIGALTSAAAFFTVRYKHVFGVDEGLDIFAIHGVGGVVGDILTGFFAAPGVSNAYAGGWWNRNWVQMGYQXXXXXXXXXXXXXXXXXXXXXXDKIPGIRASEEDELKGLD................... 923
192 2.000e-50UniRef50_D3AZZ2 Ammonium transporter n=2 Tax=Acytosteliales TaxID=2058181 RepID=D3AZZ2_POLPP  ali  22  69.....................................MDSNWVLRSSYLVLLMQAGFSLLESGMVRAKNTKNILVKNLITTALGAIIFFGIGYSLSF--------------------DSGKSYSNPLIACCSFFSLEEGDYYVWVSKWAFSSIACTIINGSVSERTKXXXXXXXXXXXXXXXXXXXXHWIWNEGGWLY---QLGVVDYGGGIAVHVLGGTIGLVGTMLLGPRLGKFDPETGKPLVLSEHNIVLSSIGTLFLWFSWYGQHPVLYGMDLNKSRIASRGAINTTLSGSISMVTSFVITVVSTKRYDLKICINGLLAGFVASSASAGFIEPYYSIIVGVVSSFIFIGFSKLLLRYQIDDPCQSTSVHFACGIWGAVSCGLFSDSSLLDEVYKNRENHIIEGVFIQLIGVSATIIWCTILAYVVFKILKKYSLLRVDSDIELTGFDNAHHGGAAYNYRSY..... 475
193 2.000e-50UniRef50_A0A226D3Z5 Ammonium transporter 1 n=1 Tax=Folsomia candida TaxID=158441 RepID=A0A226D3Z5_FOLCA  ali  40  7...............MTTSFLENVTTSVPPMSRMDDHGDTGFVLASTALVFMMIPGVGYFYSGMATSKSALSLIMLSCWSIAVVSVQWFLFGYSLTFSKTGNFFIG-----------NFDHIFLLGVFEDSNVINPKIPDIAFCLYQGMFAAITPALAI--------------------------------------GWGAQMGGLDFAGGTPVHISAGAAALAYAVILGERTLTPSGVHKPHNMSKVFMGTAFIWFGWFGFNGGSALQPN---------VQAVMAAFVTNLSACVGGITWVLLDYRLEKKYSALGFCVGAVAGLVTITPACGYVGPASSIVFGILGSAGCNVALNFKHFLKYDDALDVFAVHGVGAIIGNILTGIFAQKVYANTIEGGWLDGHWMQIVHQIADTVAGLGWSFCVTFAILWIMNKIPGLRVDQESERIGIDKSELGISCYEHVD...... 402
194 2.000e-50UniRef50_Q8RUT6 Ammonium transporter n=7 Tax=Chlamydomonadales TaxID=3042 RepID=Q8RUT6_CHLRE  ali  25  54...................LMGATADAQSTASDVGVGLDVSFLLFSGYLVFVMQLGFAVLCAGSIRSKNCMNILLKNMLDACVGAIGFYVFGYAFAYGRKYG-------QNSNGFIGNWNFALSYTTQTSMSGTEFTTFGWHQFFFQWSFCAATTTIVSGAVAERCTFMAYMIYAFFLSSFVYPVIVHWVWDGQGWLSAFNTFGAIDFAGSGVVHMTGGIAALMGAWIMGPRVGRFANDMRGHSSTLVVMGTFLLWFGWFGFNPG----SNLVVASQAAATVVSRVAVTTALAGGAGGISMLFYKFLTVKAWDVVATCNGILAGLVAVTASCSXXXXXXXXXXXXXXXXXXXXXXXXLYKLKVDDPVSAFALHGAVGAWGVLFPGFLAAPHYVVEVYGLFYGGHGQVLLVQLIEVLAIFGWTGFMMGSFFFILNKAGLLRVPLQEEMAGLDAA................. 507
195 3.000e-50UniRef50_UPI000376C1CB ammonium transporter n=1 Tax=Kushneria aurantia TaxID=504092 RepID=UPI000376C1CB  ali  25  2................................DTASTIDSLWVSISALLVFLMQAGFLCLEAGLTRSKNAINVAMKNVSDFAVSIMAFWLAGFGVMFGIDHAGWIGLD------------------LYVPDFMSADGVQLATFFLFQCMFCATAATIVSGAVAERXXXXXXXXXXXXXXXXXXXXXXXXXXXGFWEPGWLEALGFVDFAGSTVVHSLGGWVALAALLHIGPRRGRFIAGEAPRRIPASNMPLSMLGVLLL----FFGWFGFNGGSTLAFDERVPFILLNTLMAGVAGTLSALLWGWRRDGHVDPCLALNGTIAGLVAVTAGAHALALPEAVLVGALGGLLMLAADNALLKYRIDDGIGAIPAHLAPGIWGTLAVGLLGDPHRLGTGL-----GPWAQTXXXXXXXXXXXXXXXXXXXXXXXXXKGLMALRVSADDEEMGLNVTEHG.............. 400
196 3.000e-50UniRef50_A0A1H9JUP1 Ammonium transporter n=1 Tax=Treponema bryantii TaxID=163 RepID=A0A1H9JUP1_9SPIO  ali  30  5.....................................VDALWVAVSGALVFFMQPGFSMVESGLTREKNSINVAIKNLTDIGISLFVYWLVGFALMFGKSAGGFLGLTG------------------FIPGASGNIDFNTGTFLFFQAMFCSTSATIVSGAVAERMKYSSYXXXXXXXXXXXXXXXXXXXXAGIQPSGWLNKIGFVDFAGSTVVHSVGGYVGLAGIIVLGSRKGRFPKGEKPRNIPMTVAGVFILWFGWLGFNGGSTLAFND---------IVPQVLLNTCIGAATGMLSALFTGWAFKKIPDVNFVINGTLAGLVAITANCHCXXXXXXXXXXXXXXXXXXXXXXXXEKFKLDDAVGAVPVHLCAGIWGTLAVGIFGQPELLGTNPIF-----GSQFXXXXXXXXXXXXXXXXXXXXGFNILNKILPLRVSSEDEDKGLNIVEHG.............. 402
197 4.000e-50UniRef50_A0A2P6TLC5 Ammonium transporter n=1 Tax=Chlorella sorokiniana TaxID=3076 RepID=A0A2P6TLC5_CHLSO  ali  27  258.........LKAALEAAVAGLQVVLRDTVDKCGAAAAAEERYTLLSAYLVFFMQAGFAMLSAGSVRAKNAKNIILLNLLDACFGCLAWYATGYAFAFGDPE---------LNAATNSYPWQGNPFIGHTYFFQSGLARTSYASWFFQFTFAATSATIVSGAVAERCKFECYVAYNLMLVSFVYPVVAHWVWSPWGWMSATFNSGVYDFAGDGPVHMVGGIASFVAAKILGPRIGRFDADMPGHNASLTLLGVFLLWFGWYGFNPGSTNAILGPYIGFSSISAA--IAVNTTISAAAATVSTLLVSMLHQYVWDLIIAGNGALAGLVAITGGCXXXXXXXXXXXXXXXXXXXXXXSKFLHRLMIDDPLDAIAVHAGGGIWGMLACAAFAAPNMVTDWYGSHPDSTPEQPVQRAYGFIMGGXXXXXXXXXXXXXXXKLGLMRVSADVEALGLDISYHGGSSYPHE....... 741
198 4.000e-50UniRef50_A0A1S3IJT0 Ammonium transporter n=18 Tax=Eumetazoa TaxID=6072 RepID=A0A1S3IJT0_LINUN  ali  27  26................................EQITWDDATWILTSSFIIFTMQSGFGLLESGAVHGKNEVNIMVKNAVDVIFGGITFWMVGFGLAFGDG----------------PWANPFCGIGYFLVDSDESKMGWTFAWFTFQMSFATTSTTIVSGAMAERTKLLSYIVFSTFNTFIYCFP-THWLWSPVGFL---QQLGAIDFAGSGVVHLVGGTTGLVATLMLKPRIGRYEPDYKMANPTNALLGLFMLWWGWLGFNCGSTFGISGGKWKLAARSAV----VTVNGSAGGGAVGIFLSYIFRQRKLDIGDLVNSVLGALVSVTAICGLARPWEGLIIGMLGGGISVLLPKALDKMKIDDPVGVVSVHGVCGVWGLLSVGLFVDQDNIQNLTYGRK-GAFRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVLLRVTEEEELLGADYVEHGI............. 427
199 4.000e-50UniRef50_A0A0R1H5W0 Ammonium transporter n=1 Tax=Lactobacillus amylovorus DSM 20531 TaxID=1423723 RepID=A0A0R1H5W0_LACAM  ali  44  1.........................................................................................................................................................................................MVHMVWTPGGILAKKG---MLDFAGGTVVHITAGITALLLSIFVGPRDFDPNGEVKHYNLPWVLMGTSILWIGWYGFNVGSALTV---------SDVATQAFLTTTVATGTSFVVWMFLDMFIKEKTTMIGLCTGALCGLVGITPAAGYVTVAGAFAIGFICTLASYFIHVIKPKLKLDDPLDAFGCHGVSGIVGSILTGLFATKIVNPQIENDLLYGGLHXXXXXXXXXXXXXXXXXXXXXXXXXXXKKIISIRVSKEDELMGLDLAEHGEQAYGIEFEEK... 274
200 5.000e-50UniRef50_A0A2U3DQW9 Ammonium transporter n=1 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3DQW9_9HYPO  ali  38  292.............................................................SGLARRKSALSXXXXXXXXXXXXXXXXXXXXYSLAFGQTSG----------NPFIGDLKHFGLMKVWATPSVGSPLIPALLYSFYQMMFCAVTAALTVGAVAERGRVIPAMVFTFFWATLVYCPLAYWVWN---ANGWGFKHGVLDYAGGVPVEIGSGVSALAYSWVLGRRNDKMMMNFRPHNISLITLGTIFLWFGWLGFNGG---------SSFGANLRAVMACWNSCLTAMFAAMTWCLLDFRLAKKWSMVGWCSGTISGLVAATPASGFIDPWASIVLGVVAGIACNFGTKVKFLIRIDDSLDVFAEHGIGGMVGLIFNGFFATDGVNTGLTGGFLDGSYVTLGWQIAAIVASSSYAFVMSAIIAKIIDIIPGLRASEEAELLGMDDDQHGEFSYDYVEVRRD.. 684
201 6.000e-50UniRef50_A0A2M7BP50 Ammonia channel protein (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A2M7BP50_9DELT  ali  55  29.............................................................GGLVRRKNVLSILMQCFIIVCVISLQWFLFGYSLAFGPGWGIIGSLKWAGLNFVG---------GQPN--ADYAATIPHQXXXXXXXXXXXXXXXXXXXXXXERMKFSAFLIFTILWATLVYDPLAHWVWGTGGWLR---NLGALDFAGGIVVHVSSGISALTLAILLGKRCGYDLQPFRPHNLPFTVLGAALLWFGWFGFNAGSALGANELAVNAFIT.............................................................................................................................................................................................. 235
202 9.000e-50UniRef50_UPI00094805B7 putative ammonium transporter 1 n=2 Tax=Branchiostoma belcheri TaxID=7741 RepID=UPI00094805B7  ali  26  1...................MASRNLTTVEALAVLQKNSDQLFLVVTGLFVFFMQAGFGFREAGSVRSKNTTNILIRTMLNVFISGIAYWGVGYAFAYGTPSNFFLGHSNFFLSLPVVDVTHA--------------------RWFFQFTLAATCVTIVSRALTERAEFAACLVYAMLISGFLYPVVSHWAWDPAGWLRIGAKDPFQDFAGSGVVHMTGGAIALVGAIMVGRRIGRFEVRIPEHNVPLVSLGTFMMFLGLLAFNVGAQGAISRSGDGEA----VSVITVNTVISAAMGGLVAMLMKRLGKPNWTYLSAANGALTGMVSVAAGCDVVYTWGALVIGTVAGLTYCVWSRLLQALRIDDPVDTIAVHLGGGFWGLVAAPILSRNGIIQEVSTMNLKXXXXXXXX----XXXXXXXXXXXXXXXXXXXKCFGALRVDGEVEMQGLDVPKHDEPAYPQDGY..... 436
203 9.000e-50UniRef50_S3UHX1 Ammonium transporter n=41 Tax=Spirochaetes TaxID=203691 RepID=S3UHX1_9LEPT  ali  29  30...........................................................LESGLTRAKNSINVAIKNVADFGVATLLFYTFGFGLMFGMSWNGIIGTN-------------------LFSPDFPAGNAWPPTFFLFQLVFCGTSATIVSGAVAERLKFQSYLIATALISGIIYPIAGHWCWGGEEQHGWLAMKGFHDFAGSTLVHSVGGWVSLALLIVVGPRIGRFPENESPKNLPMAMLGGILLWFGWMGFNGGSTLGFNEK---------VPGIILNTIISSGFSMTVAMLIAWVVKGFPEATAPLNGSLAGLVAITAGADCFTPTQAALIGSIAGSFVLPAEKLLERWKIDDAVGAIPVHLVGGIWGTVAVGLFGNLQLIDPKID-----RLTLLGIQXXXXXXXXXXXXXXXXXXXXXXNRFSSLRVDGEEERMGLNISEH............... 400
204 1.000e-49UniRef50_A0A2T6E2N8 Ammonium transporter n=2 Tax=Saccharospirillum TaxID=231683 RepID=A0A2T6E2N8_9GAMM  ali  30  18.........LAALLFLLGVGTSTQAADLPEL-DIDTKLDLLWIGISAVLVFFMQAGFCLLETGSIRKKNSFNVAVKNMSDLLLSVIGFWMVGYALMFGSSVGGWFGSSDFFFSDNHAPF--------------------DIMFFLFQMMFAGTAATIVSGAVAERMHXXXXXXXXXXXXXXXXXXXXXXX---XXSDGWLAQRGFIDFAGSTVVHSTGAWLALAGIIVLGPRFGRFTAEGKGHDLLLTTLGVFILWFGWFGFNGG---------SELAFDSAVPGILFNTTLAAAAGGAVCLVLGRLISPVIRIELILNGVLGGLVAVTAGCAVLHPLGAVIIGATGGLIAHFASECLLRCKLDDPVSAVAVHGFAGAWGTLALAFLAPVENLN-------HSVMTQLGVQXXXXXXXXXXXXXXXXXXXXXXKATKMLRVSEAFEIQGLNVSEHG.............. 430
205 1.000e-49UniRef50_A0A1I5HF94 Ammonium transporter n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1I5HF94_9RHIZ  ali  29  85............................................................EGGMVRSKNSINVAQKNILDLLVSISLFYLLGFGLMFGTSLGGWIGWQ-------------------TDLFAWDSFPDWNYTFFVFQAVFVGTAATIVSGAVAERMTFTGYLASSVLISMIIYPVFGHWAWGSGDNTAWLADKGFIDFAGSXXXXXXXXXXXXXXXXXXXXRIGRFNRDGTPNKXXXXXXXXXXXXXX----XXXXXXXXXXXXSTTAGTPDFARIIANTLLSAVFGGTAGFLLGWVKDDVFEPSRSINGMLGALVAITAGCDAVNPHGAVMIGIIAGLAVCLAEDFIGVLKLDDVVGAVSVHGVGGALGTLLVAPFAIDSKLAA------GSRVDQFLVQGQGVLLCFVWAFTAAIVMFKLIDMTVGLRVDAEDELRGLNISEHG.............. 455
206 1.000e-49UniRef50_R1FD66 Ammonium transporter n=4 Tax=Emiliania huxleyi TaxID=2903 RepID=R1FD66_EMIHU  ali  28  28.....................................................QCGFALLEAGSVRTKNTKNILLKNLLDACLGAIIWWLWGMGVAYGDSGDYDDGNEFIGTAPNNGGPFAAAGWEGKDWQESGGEGYYTMALWFFQYVFAAAAATIVSGAVAERAQXXXXXXXXXXXXXXXXXXXXXXXXCDGGYLSKTWAGGCIDFAGSGVVHMTGGVAALCGAFVIGPRAGRFDEPIPGQSTPFQVVGTFILWMGWYGFNGLAPHIPHSSPPLSADCAVMARAAMCTTVSASIGGLTVVFFDRIFSKTYDVGMVCNGILAGLVSITAGCASMHVWAAFLTGFIGAFVYYGASKTMLKLKIDDPLDAYAVHGACGGWGVIAVGIFGSNNYITMGPPGIIYGGGTLLGAQIAAVCIETLWVATLSLMIHALLTRIGILRVSEEVEMAGMDVSKHGGSAY.......... 471
207 1.000e-49UniRef50_B8LVM2 Ammonium transporter n=13 Tax=Ascomycota TaxID=4890 RepID=B8LVM2_TALSN  ali  39  59.............................................................SGLARRKSXXXXXXXXXXXXXXXXXXXXXXXXSLAFSHTAGSYIG-----------DLKNFGFMNVLGAPSVGSTKVPDLLFAVYQGMFAAITVALAVGAVAERGRMLPCIVFMFVWSTIIYDPIACWTWNS---SGWVFKLGGLDFAGGTPVHISSGAAALAYSLMLGKRRGHGTHNYRPHNVTHVVIGTVFLWVGWFGFNAG---------SALSANLRAVMAAVVTNLAASVGGVTWCLLDYRLEKKWSTVGFCSGVIAGLVAITPXXXXXXXXXXXXXXXXXXXXCNYGTKLKYLLGIDDALDIYAVHGIGGIVGNLLTGLFAADDGATTIPGGWLNHHYIQLAYQLADSVSGLAYSFFGSCIILLIINFIPGLRSTEEDEIMGIDDAEIGEFAYDYVEITRDV. 452
208 1.000e-49UniRef50_A0A210PLF2 Ammonium transporter n=8 Tax=Eumetazoa TaxID=6072 RepID=A0A210PLF2_MIZYE  ali  29  1.........MASVNESLMALKTEVEVLKEWQSYTNDNMDQFFLITMGTIIYLMQGGFALLEAGSVRSKNTTNILIKNLLDSFISGVCYWLFGYAFAFGGGNAFIG----------------------TENFAHSNLEDTEYAYWFFHFVFAATAATIVSGAVAERCDFVAYLVYSSLITGFIYPVLTHWAWSSEGWLLKGFTYTYNDFAGSGVVHMLGGIAAFTAALIMGPRIGRFPEDIKGHSVPLSALGGFILLFGFFAFNGSSQGAISNEGDGAAVATAVK----NTVISGSSGALVTLIMNRLPFKKWSFLTTLNGALTGMVSVCGAANQIETYGALCIGAIGGCAYMITTWVLFKFKVDDPLDATAVHFGGGTWGVIAVAFFSTDFGILYHWDTRXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXKKLNLLRVSFEYEMKGLDIPKHGEPAYPVEAYGH... 449
209 1.000e-49UniRef50_A0A2G2IIS0 Ammonia channel protein (Fragment) n=2 Tax=Planctomycetaceae TaxID=126 RepID=A0A2G2IIS0_9PLAN  ali  54  79...................................DTGDNAWMLTSSALVLFMTPGLAMFYGGLVRRKNILSXXXXXXXXXXXXXXXXXXXXXXXXXXXDGRYIGNGEYVLM----MNVQSYFNGTEVVTPIHADSNIPEYTFMVFQGMFFIITPALICGAFAERMKFSSMVLFSVLWGTLVYCPLCHWVW-DGGLLAHGPGLGALDFAGGTVVHISSGVSALVCALILGNRLGFGHDDMRPHNLTYTAIGAGMLWVGWFGF................................................................................................................................................................................................................ 303
210 1.000e-49UniRef50_A2SPS8 Ammonium transporter n=2 Tax=Methanocorpusculum TaxID=2192 RepID=A2SPS8_METLZ  ali  50  155..........................................................................................................................................................................................................LGALDFAGGTVVHISSGFAALALALVIGKRVGYGKQMFRPHNIPMTLIGGMFLIVGWFGFNAGSALAA---------NQLAASAFLVTAAAAATGALTWMALS-WKSGKPNSLGFISGAIAGLVGITPAAGYVNVGGGLLIGIITAAVCYAALSWRIKAGLDESLDAWAIHGMGGFAGAILTGVFAVSAIC--GVGGLLEGNVMQFGIQXXXXXXXXXXXXXXXXXXXXXXXKTMGLRATEDEEYIGMDLAQHGEQA........... 399
211 2.000e-49UniRef50_A0A0J9XAI2 Ammonium transporter n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XAI2_GEOCN  ali  33  10........................TGTSSDTMTASELANIAFLAWSSFSIFLMIQGAGLFYSGLSKRKSALTQAALSLVVTAVVQIQWFVWGYSLSFARNASKFIGT---------------LQFAGLYNLTRDYNSVPELGSAVFQSMLACLTAALLVGSIADRARXXXXXXXXXXXXXXXXXXXXCWTWN---RNGWGSTMGYLDYAGGTPIHMCAGMTALAYSFMVGKKYE-EPDLHRPHSTMFVVIGTCLLWVGWFGFNSG---------ANLVATPRAVQALLNTQIAAAVGGFAWVGLDFRMGGKWSIVGFCSGVISGLVSITPAAGFVPSWSAPVFGLLGGLLCNTGTKIKYYLKIDDSLDVFAVHGVGAMVGNILTALFASVAIAGPNGGGWLDHHYIQLGYQXXXXXXXXXXXXXXXXXXXXXXRYIPGLRITPEDEELGIDLAEHDEYAFDYVELYPDLP 436
212 2.000e-49UniRef50_B7QKQ6 Ammonium transporter n=7 Tax=Eumetazoa TaxID=6072 RepID=B7QKQ6_IXOSC  ali  26  1..............MANSLDVTTVNPTFLPDEEDFTYDDATWVLTAAIVIFTMQTGFGLLESGCVSQKNEVNILMKNAADVILGGLTYWLFGFGLQYGNGQG---------------TENAFCATGHFLVDAQPEEMGVVFSNFIFQLSFSTTATTIVSGAMAERANYNAYCVFSLLNTIVYCIPAGWV----WGNHGFLKKLGALDFAGSGCVHLLGGASALVAAMLLGPRRGRYDGTFQMSRPTNVLLGMFTLWWGWLVFNCGSSFGVRHDKWKY-----ASRAAVTTINASLGGGVVGVFYSYFINKKFLVGDIVNAILTALVAVTAGSGFYSAYESIVVGAMGALLACWVPSAMDYARIDDPXXXXXXXXXXXXXXXXXXXXXXDADMSSGNSGLLKGGGVYLLGVQALTALCITAWSVVVSYVLLKAIDYVIPIRMSELEEEVRADLMEHSLR-YPEYDYD.... 433
213 2.000e-49UniRef50_A0A1Y2M9A2 Ammonium transporter n=1 Tax=Epicoccum nigrum TaxID=105696 RepID=A0A1Y2M9A2_EPING  ali  31  26..........................MTQDLNALYDKGDLCWILVSSVLCWQITPAIGFLYAGMHRRKAALTMIFQSLFCACAVGIQFWVYGYSLYQSHTDNMFLG-----------NLSKAGLHNVLAYPSLANPDIPDILYACFGFTFVTCTAMILAGAMLERGRMWPSMLFLLCWTTFVYYVLAHAEWNPSGFLY---KLGVMDFAGSGPVHIASGFSALAWAVMLGPRLDPHKESHHPKTPHFKPHNPXXXXXXXXX--XXXXXXXXXXXSTANLSIRSIYVVCNTNLAACGGGLAWVLLEYLYLRKFSIIGFCSXXXXXXXXXXXXXXXXXXXXXXXXXALTACASFFTVRYKHLLRIDEGLDIFAIHGVGGFVGDILTGFFAADGVNNAYAGGWWNRNWKQMGYQLAAACTCAAWSFVVSIVLLFIINRIPGIRATEDDELRGLD................... 442
214 2.000e-49UniRef50_A0A2P6V572 Ammonium transporter n=1 Tax=Micractinium conductrix TaxID=554055 RepID=A0A2P6V572_9CHLO  ali  25  98...................VAGHCAADDFSPEQLYEELTTMWTLLCAFFVFQMQSGFALLEAGTVRAKNTKNILLKNAIDASVATVCWWSVGSAFAYGSGQCGQNG---------------FIGAFNFFSSKASATGSSYWALWLWNWAFASTSATIVSGALAIQVRXXXXXXXXXXSARRLACGTAPLPLGEAYAPLFGQTNGLLDFAGSGVVHMVGGGAALMATLITGPRLGRFDAQFAPSSPVFQALGTFILWLGWYGFNAGSTNCFHNC------MQIAAQAAVNTTLSAGFGALTCLGLAILLGLPGDIGPVLNGVLAGAVSITAGCALVQSYAAAIIGVVGGLVYTGFSRLLVRLRVDDPVDATPVHFACGAWGLLAVGFFATETSVKAVYGVFYGGTGNQLGLQVLGTVVIAAWTCALSGALFLVLRKLCWLRVPPHVEQQGLDLAQ................ 552
215 2.000e-49UniRef50_A0A160T0C4 Ammonium transporter n=1 Tax=Candidatus Promineofilum breve TaxID=1806508 RepID=A0A160T0C4_9CHLR  ali  31  4.FRTIRRVVNIVLVVGLLLFATRTAFAQDAVQPAVNALDTVWVLFCAFLVFFMQAGFGFLEAGFVRSKNVVNILAENFMDTTMATVAFIFVGFGLMFGAGNSFFGTEWFAL---------------RGIPEIYPGLTIPTLAFFFFQFAFCAAAGAIASGMMAERTNFKADLCYSLVTAGLIYPVFGHWVWGGGWL----AQMGYIDFAGSSVVHIVGACIGLAGTLTLGKRKDKFGDSIRGHSLPLAALGTFILWLGWFGFNPGST--------LVAEPISISHIVVTTDFAATAGAIVAILLAYVQMRKWDISMAFNGALGGLVAITASXXXXXXXXXXXXXXXXXXXXXXXXHMLEVFKIDDPVGALPVHGLNGVFGILAVGIFA-----GNGVGLLSGGGFAQXXXXXXXXXXXXXXXXXXXXXXXXXLKRTVGLRVSAEVEEEGLDHAQHGLHSHPEFVE..... 436
216 2.000e-49UniRef50_A0A286TTS3 Ammonium transporter n=3 Tax=Bacteria TaxID=2 RepID=A0A286TTS3_9BACT  ali  30  15.......ILHSAEASDIASSYSVHSSDVRDITGVKISIDLAWTLLCGFLVFNMQAGFAFLGAGFLQKKNTLNYLTMSFMDFCVGGIIFWSFGFALMFGGSHLGMG-----------LDAGNMLVGFSGFFLSFGSFDFSTSQLWLFQMMFSAAACTIVAGAVAERIKFNAHVICSIVLSGIIYPIYGHWVWGGGWLANLPFGSGLRDFAGSGVVHGIGGLIALVGAWMVGPRFGKYPNMFHGHNLSFVVLGTLFLLFGWFGFNAGSTLGSTD--------LRVSIIAANTFLAACAGGVSLMYITYYDTGKYDIVMTCNGTLAGCVAITAXXXXXXXXXXXXXXXXXXXXXKASLHFVEKLRIDDPVGAISVHGANGLWGLLSVGIFADGSYLGV--KGLITGSGWQLLSXXXXXXXXXXXXXXXXXXXXXXXKKTIGLRVPVSEENTGIDLYEHGIPCYPGF....... 455
217 2.000e-49UniRef50_G5EB09 Ammonium transporter n=167 Tax=Eukaryota TaxID=2759 RepID=G5EB09_EMENI  ali  37  74..............................................................GLARRKSALSMIWACMGSMCVVTFQWYFWGYSLAFSPT----------ATNGYIGNLRNFGLMKVLADPSPGSPLVPNLLYAFYQMQFCAVTAAIIMGAVAERGRLLPAMVFTFVWATIVYCPIACWVWN---VNGWAFNYGVLDYAGGGPVEICSGLSALAYSMVLGRRQERMMLNFRPHNVSLILLGTVFLWFGWLGFNGG---------SSFGANMRATMACWNTNLTAAFGAITWVILDWRLARKWSMVGWCSGTISGLVAATPASGFLPPWASVVLGIVTGIVCNYSTKVKYWIRIDDSMDVFAEHGVAGIVGLIFNAFFADDAIVGLDGGGWLIHNWKQLYXXXXXXXXXXXXXXXXXXXXXXXXNAIPGLRASEEAELLGMDDDQLGEFAYDYVEVRRD.. 466
218 2.000e-49UniRef50_A0A1J5P7S0 Ammonia channel n=4 Tax=root TaxID=1 RepID=A0A1J5P7S0_9ZZZZ  ali  40  1.....................................................................................................................................................................................................................MHINAGIAGLVGALIIGKRTGYGKDLMAPHSLTMTMIGASLLWVGWFGFNAGSNLEATGTTA---------LAFVNTMVATAGAALSWLLCEWMVKGKPSLLGICSGAVAGLVAVTPASGFAGPIGALVLGLIVSPVCLFFVSVKNSLGYDDALDVFGVHCIGGIIGALGTGILVTDYTNITGNNAGTYDFATQMIAQGKAVAATLLWSGIGSAILYKLVDVIVGLRPSVEAEREGLDLTDHGERAYN......... 249
219 2.000e-49UniRef50_A0A2D6CP17 Ammonium transporter n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2D6CP17_9GAMM  ali  49  11..................................................................................................................................VDALSGTIPETVFMTFQMTFAIITPALIVGAFAERMKXXXXXXXXXXXXXXXXXXXXXXXXXXX----XXGEMGVLDFAGGTVVHINAGIAGLVACIVLGKRNGYTKTPMLPNNLGYTIVGAAMLWVGWFGFNAGSELA-ADGTAG--------MAMAVTQIATAAAALGWMFSEWLSHGKPSVLGIASGAVAGLVAITPACGSVGPMGALAIGIAAGVLCYLAATLKNALGYDDSLDVFGVHXXXXXXXXXXXXXXXXXXXXXXXAEGVSIGQ--QVGKXXXXXXXXXXXXXXXXXXXXKVIDMVIGLRVSSDEESEGLDIALHDERGYN......... 328
220 3.000e-49UniRef50_A0A1S9RCH8 Uncharacterized protein n=1 Tax=Penicillium brasilianum TaxID=104259 RepID=A0A1S9RCH8_9EURO  ali  35  59.................................................................RRKSALTLLFQSLMIVAVTTFQWIFWGYSLAYSRDASPFIGT-----------LKNFGLKGVMAAPSPGSAVLPEIVFCFYQLLFCACTVMIVVGGAFERGNMLPSLVFSFCWATVVYCPVACWTWNSNGWLY---NLPSLDFAGGGPVHIASGWSALAYALVLGKRKHVDETHGKPHNTTLVFLGTTLIWFGWFGFNGG---------SALNASVRAMLAAFNTNTAACTGVLGWVLVDSINRGKFSVVGACEXXXXXXXXXXXXXXXXXXXXXXCIGFLTSIVCASLQNVNNWLHIDEGMDVFKLHGIGGMVGAFLTGIFASQSVGATEATGGIDGNGMQVGKQLAEVCAISAYSFTVSCILLYILKWIPGLRVHEEAEMIGLDRVQIGERA........... 442
221 3.000e-49UniRef50_D3BBH9 Ammonium transporter n=1 Tax=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) TaxID=670386 RepID=D3BBH9_POLPP  ali  26  281............................SPSDSFQAAVDDSWVLSATFLVFFTQAGYCMLEAGVVRAKNAKSIIIKSIIDTAFGSLIFWAVGFAFAFGHNNNPFLGTSHFFLIR-----------------------YDNLAFFAFQWAFSTTSITIVSGSLAERVHINSCXXXXXXXXXXXXXXXXXXXXSKDGWLRLIGTNGIVDFAGGVVVHMVGGAVGLMGTYIVGPRIGRFPKPLPGHSITLSTLGAFIIWYGFYGYNTGSTLGISMGRMAIASRSAVTMTISATASCATTLMVI-----KLFSGKYDVNKSVNGLLGGLVSASASCSMVDPWAGFVIGCVSSFVYLGTSKLLLKLRIDDPLDSAPIHFSCGMWGAISVGLFATQNDLTNSYGLFYGGGVEQLGVQXXXXXXXXXXXXXXXXXXXXXXKRFNLLRIDPTRELMGIDMDQHGGPAYPNF....... 700
222 3.000e-49UniRef50_A0A0L0DMP5 Ammonium transporter n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0DMP5_THETB  ali  42  85......................................................................................................FIGGLDYVALKGF-----------DPSTCFGRVATLPSTLYALYECMFAVITPLLITGAFAERLTFRAYVVFIVVWELTVYYPVAHWIWGGGWLM----QRGALDFAGGIVVHTTAGAAALVTAVMLGARAGHGSHALKPHSVPLTMIGGGLLWFGWFGFNGGSAYRSGGD---------AASATLNTHIAASACGVVWLLISWKREGRPHTVDVMNGIIAGLAGITPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLHIDDALEVSAVHGATGLIGSLATGFVASSTYSDAVTNEGLHGGSGKLLGEXXXXXXXXXXXXXXXXXXXXXXXXRVDLRVSAAEEDEGLDVGQHEGHAY.......... 425
223 3.000e-49UniRef50_A0A142WNF6 Ammonia channel n=1 Tax=Planctomyces sp. SH-PL14 TaxID=1632864 RepID=A0A142WNF6_9PLAN  ali  39  91..............................................................GMVRSKNLLNMFMVVMVCVPLIAIEWVAYGYNMAFSPGLVFLKAFT--PTDPMKFDDTYGRQLTSGDTVGSVPVGIPEXXXXXXXXXXXXXXXXXXXXXXXERVKFSAWCLFTVLWATIVYNPVAHWVWNVNGWLFQKG---VMDFAXXXXXXXXXXXXXXXXXXXXPKRRGYPGPQFVPHSVGWTLMGAGMLMVGWFGFNAGSAIAVGKD----FLPVAGAVSVMAFATTAIAGSAAWMFAEWLKVGKPTALGVASGMVAGLVVITPCAGHVSPGGALVIGLIGGLVCFLAVQAKPKLGYDDSLDVVGVHGVGGALGALLVGYFAVRPV---------MGGMEQVKLQXXXXXXXXXXXXXXXXXXXXXXHKTIGFTVSETTEEEGLDINEHGESAYH......... 501
224 4.000e-49UniRef50_M7WUS1 Ammonium transporter n=9 Tax=Microbotryomycetes TaxID=162481 RepID=M7WUS1_RHOT1  ali  33  55.............................................................SGLLRRKNALSMLFLAMAVYSLITIEWFFWGYSLAFSETGSKFIG-----------DLRHFGLMNVLDAPSQGSSKIPALLFAFYQSMFAALTPVIAVGGVAERARXXXXXXXXXXXXXXXXXXXXCWTWNPTGWGYIN---GVLDFAGGGPVHITSGTASLVWSFYLGRRRGYGTAKYRPHSVSHVILGTTLIWFGWFGFNGG---------SEVAMNLRSVQASIVTNVAAAMGGMTWMIMDFIYTRKWSAVSLCSGILAGLVGITPXXXXXXXXXXXXXXXXXXXXXNFATGLKVLLKIDDAVDGFALHAVGGYVGSVLTGLFADSDGYTAIPGGWINHHYVQLGWQLASATSILAYTAVMTYILIFIVDHIPGFRCSEDDEIIGMDESQTGEHGYDYVSIRRDL. 448
225 4.000e-49UniRef50_A0A075HUT8 Ammonium transporter n=146 Tax=root TaxID=1 RepID=A0A075HUT8_9ARCH  ali  52  152..........................................................................................................................................................................................................MGALDFAGGTVVHISSGFSALVAAILVGKRSGKLENF-KPHNIPYVLLGTGILWFGWFGFNAGSSLAA---------DGIAVNAFLVTNTSAAAGALMMMFLSMRESGKPSAVMTATGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLKNQRGWDDSLDVWAVHGMGGLWGAIATGLFASAAYGVGVDGLFSGGPISVVTTQLVASVASIAYAGIVTFVLLKILDSTLGLRVDSKDEEAGMDISVHAEEAYN......... 400
226 5.000e-49UniRef50_A0A2M8NV68 Ammonium transporter (Fragment) n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8NV68_9CHLR  ali  29  1..............................MDNPSVAINTMWLLFSACLVFLMQAGFLCLEAGLTRRKNNINVAIKNLTDFAVTTVFFWLVGYGIMFGLSGNQIIGTSEFGID-------------------LTSAPPETIAFFFFQVMFCGTAVTILAGAIAERVKFGSYXXXXXXXXXXXXXXXXXXXXNGGEMRGWLGQIGFVDFAGSTVVHSVGGWISLAVLLVVGARAGRFPKGKPPQKIHGSDXXXXXXXXX----XXXXXXXXXXXGSTLGINDQVPRVIVNTVVASSFGLVGSLLIGWIIRKRAEIDLVLNGVLAGAVAITANCHXXXXXXXXXXXXXXXXXXXXXXXXXXRLRIDDAVSAIPVHLGAGIWGTLAVGIFGDPLLLGTGL-----SRGDQXXXXXXXXXXXXXXXXXXXXXXXXXXXRIFPLRVSAEEEHIGLNISEHG.............. 401
227 5.000e-49UniRef50_A0A2G5L594 Ammonium transporter n=3 Tax=Bacteria TaxID=2 RepID=A0A2G5L594_9BACT  ali  25  14....................SPPTANPTENLALVALNIDDLWVMVAAALVFFMQAGFKVLETGMVKKEHRSGIGAKNLLDWVAGSIAFFLVGFALMFGNTLDGFLGFQYFFGDSLDSGKXXXXXXXXXXXXXXXXXXX--------------------XGAMSGRTXXXXXXXXXXXXXXXXXXXXXHWAWGNLWDTPWLADMGFMDFAGSTVVHSTGAWVAVMGIYMVGPRLGRYDAYGRIQDYAYSILGVMILWLGWWGFNGG---------STLAFNEDVVKIILNTNLAGAAACFTAFFHAYLIQNKTDVIKIAGGSLTGLVAITACCNVVTPISSLMIGALAGVIHNVFVIIAEKWKLDDPVGAVAVHGIGGVFGTLCVALFGQEELL-------MHTRWMQLGVQFMGIATCFVFTSAVSYIMFTIIKKTIGLRVSPVEEKRG..................... 416
228 5.000e-49UniRef50_A0A061SDK5 Ammonium transporter n=3 Tax=Tetraselmis sp. GSL018 TaxID=582737 RepID=A0A061SDK5_9CHLO  ali  33  28....................................NDDIFWLLYGSVLVFNMQAGFALLEAGQVRIKNRSNMLLKNVVDVCMGGVVWYLFGYAFAFGLSSNGFIGGSWDVLSGC-----------------------ADYSKWMFQWTFATTSATIVSGAVAERCSFSAYLFMTFLMQGFLYPVVVHWVWSGYGWLGKDGGNGLMDFAGSGVVHLTGGTCALVGAVVVGPRAGRFSWPMRGNSVAFATLGTMTLWFSWYGFNCVSTGSYS-------AMYEASRVAMATTMSACGGGLAGLVLNLAHTGAPDILQALNGILGGLVAVTAGAPYYEPYXXXXXXXXXXXXXXXXXXXXEALKIDDPVNASPVHMACGIWGLLEVGLLASPAYVDDHFGALYGGGAKQXXXXXXXXXXXXXXXXXXXXXXXXALKAAKILRVSFEDEIAGLD................... 420
229 5.000e-49UniRef50_A0A0K2MGZ4 Ammonium transporter n=48 Tax=cellular organisms TaxID=131567 RepID=A0A0K2MGZ4_CLOBE  ali  28  39...............VAATGSETLSDVATTANKGYYGANFTWIMITGFMVFFFQCGFAMVETGFCRGKNAAHTMTMNFMVFLVGAIGYFLTGFAIQFGGSGGAAGLGSGGAALGSMISIPGLGGIMGYNGFLLSGLGIYDYALFFFQMVFMDTTVTIPTGALAERVKYSAVVVLSFFISMFLYPFFGNWVWGGGWLSNFGLGHGVVDFAGSGVVHAMGGMIALSSAIIIGPRIGKFKKPFPGHNIPMAIIGTIILFFCWFSFNAGSTLNSSDFRLAIVA--------TNTMIAGAIGGLVAMFYMWVKYGKPDPSMTANGALAGLVAITAPCAFVSAPCAFFIGGVAGLLVCVAVSFFEKLKLDDPVGAISVHGVNGIWGIISLGLFADGSYGDGLNGGLFFGNPSQXXXXXXXXXXXXXXXXXXXXXXXKILDNVWGIRVSPEAELNGLDIPEMGVSGYPD........ 496
230 5.000e-49UniRef50_A0A1W1V5B7 Rh family protein/ammonium transporter n=1 Tax=Hymenobacter roseosalivarius DSM 11622 TaxID=645990 RepID=A0A1W1V5B7_9BACT  ali  47  1..................................................................................................................................................................................................................................MVLGRRNGHRNTSSSTPNVPYVLLGTGLLWFGWFGFNAGSALGA---------NELAATSFVNTNLASAAALIAWLLIEVVRGTKPTAVGACTGAVVGLVAITPAAGYVQYGQSILIGVVAALVSHAAVHWQNRPTIDDTLDVFPCHGLGGIVGMLLTGVFAD-------KVGLIHGTATVFGYHVLGLLIVVTYSFVGSWLLLKLTAKLFGLRVKPAEEQLGLDLSQHEESTYDEEFEQ.... 228
231 6.000e-49UniRef50_A0A2A4AXY1 Ammonia permease n=2 Tax=Pseudomonas pelagia TaxID=553151 RepID=A0A2A4AXY1_9PSED  ali  32  6.....................................IDVLWVVLCAGLVFNMQLGFLCLEAGLTRSKNTINVAVKNMADXXXXXXXXXXXXXXXXXXXXEHGWFGTGFVMLSF---------------------LDTWQSAFFLFQAMFCTTAATIVSGAAAERMRFSGYXXXXXXXXXXXXXXXXXXXXGGAFSQGWLAAQGFVDFAGSTVVHSIGGWIALAVVLVLGPRQGRYERSMPGSNLPMAMLGALLLMFGWFGFNGGSTFSFDNTVPGIIA---------NTVLAGVAGILGGMGLSWLRWRHVDPVYPLNGLIAGMVAVTASAHVIDAGAALLIGLTGAVVMYLADRLMYRLKIDDAVGAVPVHLASGIWGTLALALFADLELLGTGL-----SRWQQFLIQGQXXXXXXXXXXXXXXXXXXXXNRIVPIRVSAEDEVVGLNVSEHG.............. 396
232 7.000e-49UniRef50_P54148 Putative ammonium transporter sll0537 n=6 Tax=Bacteria TaxID=2 RepID=Y537_SYNY3  ali  29  1..................................MTSIDTLWLLLCAGLVFFMQAGFMCLESGLTRSKNSINVAIKNFADFGISVALFWSFGFSIMFGLSQGGWWGTGYSFV--------------------DVGGEPTLAVFFLFQAMFCGTATTIISGAAAERLKFSAYLLVAGLASGLIYPLFGDWAWNGETTGGWLENLGFRDFAGSTVVHSVGAWIGLATILVVGPRQGRFPKTGKGSNMPFSVLGTLILWFGWLGFNGGSTFGLTPE---------VPGIMVNTVLAGVGGMLMAGLISLLQDKMIQVEPLMNGSLAGLVAITASANVVMTPIAMVIGATGSAIAYLVGKKMLHWGVDDAVDAVAVHGGAGVWGTLCVGLFGQLPLVDTGLN-----RWQQCGVQXXXXXXXXXXXXXXXXXXXXXXNRVFALRISPEDEEIGLNVSEH............... 399
233 7.000e-49UniRef50_A0A2K8T096 Amt, ammonium transporter, Amt family n=3 Tax=Cyanobacteria TaxID=1117 RepID=A0A2K8T096_9NOSO  ali  85  1...............................................................................................................................................................................................................................................................................................................MEAVLRGKPTAVGAATGAVAGLVGITPXXXXXXXXXXXXXXXXXXXXCFYAISYKHKLQIDDALDTFPVHGVGGTVGAILTAIFATTQVNGAGKEGVLRGNFGELXXXXXXXXXXXXXXXXXXXXXXXXXDATVGLRVKEEAEYQGLDINEHGEEGYNSEFGDR... 164
234 8.000e-49UniRef50_Q9Y877 Ammonium transporter n=8 Tax=Basidiomycota TaxID=5204 RepID=Q9Y877_USTVI  ali  36  92..................................................................................................................FIGDLKHFGLMNVTLEPSAGSSKIPALLYYFYQSMFATVTVVILVGGIAERARILPLLIFCFCWATIVYDPIANWVWNPNGWLY---KLGELDFAGGGPVHITSGTAGFAWSLYLGRRRGYGTAKYRPHSVFQIILGTVFLWFGWFGFNGG---------SELAMNLRAVQASTVTNIAAAMGGITWFAMDWFYTKKWSAVSMCSGILAGLVGITPAAGYIGSPAALAIGFLTAIACNFGTGLKVLLGIDDAVDSFALHAIGGYCGSALTALFADSDGYTEIPGGWINHNYIQLGWQLAGATTIMAYTFVVTYLLLFVIDHIPGLRATEDMEILGIDETELGENAYDFVFRNRDL. 443
235 8.000e-49UniRef50_E9KJL3 Ammonium transporter n=1 Tax=Dunaliella viridis TaxID=140095 RepID=E9KJL3_9CHLO  ali  25  76................................ASADSVNVFWLLICGYLVFLMQLGFAMLCAGLVRYKNANNIMLKNILDASVGSICWYVLGYGFAYGRSNAFIGNHDFGLTYTTKANWFMAWPQ-----DTHDYVTAGNYAGYFFQWAFAATAATIVSGAVAERCTFIAYLSYSIYMASFVYPVVVHACWSGIGWLSPWVGNGTYDFAGSGVVHMTGGVAALVGATMLGPRLGRFRDGKVNDEMSGXXXXXXXXXXXXXXXXXXXXNPGSQLAIAGVVDAVAGRCAVCTTLSAGAGGVTALLFRFWRSGAFEVVYTCNGVLAGLVGVTASCSLIEPWAAIICGVFAALTMYGAECALHALQIDDPVSAFPVHGAAGMYALIFTGFFTKHDYAKEVYGYFYGGHGQVMLSEIVELFFILCWVGINFFLLFGLLKITGRLRVPPEVEHAGHEASVHG.............. 541
236 8.000e-49UniRef50_A0A229XZJ3 Uncharacterized protein n=1 Tax=Neosartorya fumigata TaxID=746128 RepID=A0A229XZJ3_ASPFM  ali  33  55..............................................................GLARRKSALALLFQSWMVFAVTTFQWMFWGYSLTYSRDGGPFIGT-----------LKNFGMRDVLVAPSPGSAVLPEIVFCLYQLLFCACTVMIVIGGAFERGNILPSLIFSFFWATLVYCPLARWTWSSHGWLY---KLPALDFAGGGPVHIASGWAALAYAMVLGKRKDHGMVSCKPHNTTLVFIGTVLICCGWLGFNGG---------STLNASVRSMMVVFNTNTAASTGILGWTMVDYIKHKKFSVVGACEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCSLMQNINDWLKIDEGMDVFKLHGVGGIVGAFLTGLFATEDISSTFSSGAIDGNGIQVGYQLAEICAISGYSFVVSCVLLYILKFIPGLRVDEESEMMGLDQAQ................ 431
237 8.000e-49UniRef50_A0A1Q9EW09 Ammonium transporter 1 member 1 n=1 Tax=Symbiodinium microadriaticum TaxID=2951 RepID=A0A1Q9EW09_SYMMI  ali  24  133.....RRLAVDVSLPPSIFGASNSTRPYTESEEIASIMDQMWLILCGCLVMFMQAGFALVESGSCRSRNVQNVLLKNLTDVCMGTLGWWCSGWALAYSGPM-----KDGLLENGFAGYSSWFGAGFLEHRPGLGFEPTTSMANWFFQWTFCSAAATIVSGGVAERVNFAGYCXXXXXXXXXXXXXXXXXX-XXXXXXXXXTRTGFMDFAGSGIVHMTGGIAALVGASIAGPRRGRWEGPEEAFQPHSLPLIVLGTMVLWFGQDCDDPAVCGTRKASIERGFMAAQVAMNTTVAAAVGGITVFLCRLGTSKKYDIAGFCNGILAGLVSITAGCGNVECGSSFMIAMVGGIVYEVSSRLVKKMKVDDPIDAFAVHGAPGMWGTLAAAIF................................................................................... 508
238 9.000e-49UniRef50_E4YP63 Ammonium transporter n=5 Tax=Oikopleura dioica TaxID=34765 RepID=E4YP63_OIKDI  ali  22  41............................................................EAGSVRAKNVVNILVKNVLDCFIGAIVYWAFGYAFAYGD-----------VDKNHPQSSANRFIGFKFFFSTDIDDGSGFYATWFFQFVFAATAATIVSGAVAERTQFGAYLVYSTFITGFIYPVVTHWGWS---KTGWLQNQIFVDFAGSAIVHCTGGIAAFVGALVIGPRIGRFPNPQPGHSTPFAALGAFILFLGFLAFNGGSEQAIVGGDHAVVVAAAFVNTMIGGASGSITAVVLNYCIAWMRQKYWSLLQMINGGLTGMVAMCAGCNVLHQGAALGIGAMSGGTLMWLSWATKRMKIDDPLDAFAVHFGGGLVGILSTPVFMNGGIVHWQNCDSQRANYKVFAWNLAGFITITIWSGCMSLIVFYCLKLVKMLRVSEDDEIRGLDIGKHGEPAYPIEAYGH... 448
239 9.000e-49UniRef50_B8C0P7 Ammonium transporter n=11 Tax=Bacillariophyta TaxID=2836 RepID=B8C0P7_THAPS  ali  26  37.......................SSSFDAQTASTHASINTFFLLYAATLVFFMQAGFAMVSAGCVRTNNVQNTLLKNLLDACGAALGFYTVGYAFAWG---------------GSLDTATTERTFIGTQNFFLMDVDSSQDSFWLFQLAFCSASATIVAGTLAERCQMVAYLAYSMTLAGFVYPVVVHSIWSPSGFLSATRETGMIDFAGSTVVHLTGGMTALIATIVLGPRTGRFYKEFAGHSLALQMLGVFILWFGWYGFNAGSILNITNDLNHTIVSHTA----INTTLAASAGSIMTLFLSTVVAERFSLSYAMNGCLSGLVAITAGCSVVEHWAAIIIGLVGGALYLACSKFLVKKRIDDAVDGIPVHLINGIWGTLSVGLFAVPELLEQVYGRGDHAGWFYSWGQGSAXXXXXXXXXXXXXPFFCFLHYVGWLRADSLEEVVGLDAA................. 480
240 9.000e-49UniRef50_A0A2P6VJY4 Ammonium transporter n=2 Tax=Chlorellaceae TaxID=35461 RepID=A0A2P6VJY4_9CHLO  ali  28  40.................................LETSLTDLWLLFCGYLVFFQQCGFALLEAGSVRQKNVRNILLKNVIDACVAVLMWWAVGAALEGVTECGG----------------SAFVGKTGFFLSGDTAATPGYMSRWFFGWAFSATASTLVSGAVAERLRFRSYLCYTFLITGLVYPVAAHWVWSPDGWLSFPGSVGLIDFSGSGVVHLLGGTAALVGAAVLGPRLGRYTSAGPGCNPAQVALGTFILWLGWYGFNPGSTGCFYGCMPLAA------KIAVNTTLGAGAGGLTTLALTVVLGAPGDVGPLLNGIIAGLVSITGSCAVVAPWAAVVIGGLGGCFYTCSSWLLRKARIDDPLDVSAVHGCCGAWGLIAGGLFATQAGVQEAYGLFFGGGGTQLGVQLLGLVSIFAWSAALNACLFLTLRAIGWLRVPKEEEIQGLDYTQ................ 464
241 1.000e-48UniRef50_A0A1S7LHW0 Putative Ammonium transporter n=1 Tax=magneto-ovoid bacterium MO-1 TaxID=451514 RepID=A0A1S7LHW0_9BACT  ali  31  16.....................PELSWAAENSSPTRDEVNILWIMICAGLVFFMQAGFTALETGFVRAKNTINVAMKNVGDFVFAVLGFYLIGFGFMFGETSSGWLGGSYWLLDGL--------------------GTGYETAFFLFQAMFVGTAATIVSGAVAERMRXXXXXXXXXXXXXXXXXXXXXXXXXXXNNDGWLGAMGFVDFAGSTVVHSVGAWIGLAGTLILGPRIGRFRKEIPGHNVTMATVGVFIIWFGWFGFNGG---------STLLANASIAPIIANTVLSAVAGGAAGYTLTMFADPHLKVDSVLNGVLGGLVGITAGCASVESGGAVMIGLTSGAVVYFSQKMLVKLKIDDPVGVIPVHGFAGAWGTLALALFAPVESLPAGSIL------GQXXXXXXXXXXXXXXXXXXXXXXXXXXXKLNLLRVTAKQEYQGLNQVEHG.............. 422
242 1.000e-48UniRef50_A0A0D2VKX5 Ammonium transporter n=2 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2VKX5_CAPO3  ali  27  1..............MSSSASPTLPPEPAAPVYINALMFNTVGYLFSGMLIFLMQLGFALLEAGAVRAANATNITLKNTLNAALGMVCYWVSGFGLSYGGGNKFIGSSAFFLLDLESLGFTEA--------------------FAFCQLMFALTSSTIMSGSMAERTNXXXXXXXXXXXXXXXXXXXXXXX---XXDWGWLSQMGYIDHAGSSVVHATGGCAALLGALMVGPRIGRFGSSGQPMSLPGHSTVLVAQGALWVGFFAFNICSGNDFTQATIL----GHXXXXXXXXXXXXXXXXXXXXKAMQRRWSLLIALNAVLAGLVAICSGCATVPHWAAVIIGAFAGLQLLLTSHLMVRFKIDDPLDAIAVHLGGGIVGTIGSGLFAREE------GLVFTGDFSQLGIQLLGILCVCSWTCAWSFLVFFALRRAGMLRVSEKAELEGLDVYTHREPSYPEFMGMRRDP 425
243 1.000e-48UniRef50_A8ZU49 Ammonium transporter n=49 Tax=Bacteria TaxID=2 RepID=A8ZU49_DESOH  ali  31  1MKRILYMTPLLGLAMSVSAWAGEAAITPAAIELVQSHADYLWTLVAACLVFFMQAGFALVETGFTRAKNAVNILMKNLMDFSIGSXX-----------------XXXXXXXXXXXXXXXXXXGTSGFFLSDFSPEGDPWVLAFWMFQVVFCATAATIVSGAMAERTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXNGGGWEGFGFIDFAGSTVVHSVGGWAALAGAIVLGPRMGKYAKDG----TARAIPGHNXXXXXXXXXXXXXXXXXXXXGSTTVADKSIAMIFVNTNLAAATGAVFAMIVSWLKFGKPEISMSLNGALAGLVGITAGCANVSXXXXXXXXXXXXXXXXXXXXXXXKIKVDDPVGAVSVHGVCGAWGTLAAGIFNMGGTSASI-----------IGVQLLGMGTCFAWTFSMAFVMFKLIDKTIGLRVSPEEEAEGLDFSEHGGNAYPDFSV..... 438
244 1.000e-48UniRef50_A0YJ42 Ammonium/methylammonium permease n=12 Tax=Cyanobacteria TaxID=1117 RepID=A0YJ42_LYNSP  ali  32  2.....................................IDTLWLLLCSCLVFLMQAGFMCLESGLTRSKNSINVAAKNLGDFAISALLFWGIGFGLMFGSSHLGWFGITDFWLNLDKAKLT---------------------AFFLFQVMFCSTATTIVSGAVAERMKXXXXXXXXXXXXXXXXXXXXXXXXNGGVLAGRLGFLGFVDFAGSTVVHSIGAWVSLAALLLIGSRSGRFPKTKPPQNLQFSVLGTMLLWFGWLGFNGG---------STLAFNEQVPHIMANTVLAGAGGMVLAGGLNWRKRKAPEVETLINGTLAGLVAITASCHXXXXXXXXXXXXXXXXXXXXXXXXXENLRIDDAVGAVAVHGGAGVWGTLAVGLFGQLELLGTGLE-----RYAQIGXXXXXXXXXXXXXXXXXXXXXXXXXRILPLRVSISEEKIGLNISEH............... 392
245 1.000e-48UniRef50_A0A2V7G796 Ammonia channel protein (Fragment) n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2V7G796_9BACT  ali  61  32.............................................................GGLVRPKNALNTMMMSVIALGLVGVQWVVAGYSLTFHTGGGWLGGFGWVGLHGVGLT-------PDP----TYAATIPHQAHAAFQGMFAIITPALISGAIVERMRFRSYAVFLVLWATLVYDPLAHWVWGADGWL---FKRGALDFAGGTVVHISAGVSALVAAWMLGPRKDFRRVPLAPHNV................................................................................................................................................................................................................................. 201
246 1.000e-48UniRef50_A0A2E1WRU2 Ammonium transporter n=4 Tax=Bacteria TaxID=2 RepID=A0A2E1WRU2_9BACT  ali  53  35...................................DSGDTAWMLTSTALVLLMTAGLAFFYGGLVPSKNVLNTMMMSXXXXXXXXXXXXXXXXXXXXXGDGQYFGDLSMALLSGVXTEA---------------XGTIPHILFMGFQGTFAIITAALISGAVVGRMKXXXXXXXXXXXXXXXXXXXXXXXXXXX----XXXXXGALDFAGGTVVHVNAGAAALAAAIVLKPRQDYGVRAMLPHNVPFVLLGAGLLWFGWFGFNGGSALAAXGLGATGAVT---------TMFAPGATVVVWAXXDHFTTGKTTXXXXXXXXXXXXXXXXXXXXXVTPMXAIAIGAIAAIPSYXFIKWRTSSSLDDSLDVFGAHGIGGAVGAILTGXXAXEA--XGGTAGLXEGNPGQVLXXXXXXXXXXXXXXXXXXXXXKVIGASGGLRPAADLELRGMDGIAHGEEGY.......... 430
247 2.000e-48UniRef50_A0A0K8L3T4 Ammonium transporter 1 n=1 Tax=Aspergillus udagawae TaxID=91492 RepID=A0A0K8L3T4_9EURO  ali  34  54.............................................................SGLARRKSALALLFQSWMILAVTTFQWMFWGYSLTYSRNGGPFIGT-----------LRNFGMRDVLVAPSPGSAVLPEIVFCLYQLLFCACTVMIVVGGAFERGNILPSLIFSFFWATLVYCPVARWTWSSHGWLY---NLPALDFAGGGPVHIASGWAALAYAMVLGKRKDHGMSLRKPHNTTLVFVGTVLICFGWLGFNGG---------STLNASVRSMVVIFNTNTAASTGILGWAMVDYVKHKKFSVVGVCEXXXXXXXXXXXXXXXXXXXXXXCIGFVTSIVCSLLQNINNWLNIDEGMDVFKLHGVGGIVGAFLTGLFATENISSTFSSGAIDGNGIQIGYQLAEICAISGYSFVVSCVLLYILRFIPGLRVDEESEIIGLDQAQ................ 431
248 2.000e-48UniRef50_A0A0P8DCL8 Ammonium transporter, Amt family n=1 Tax=Phormidesmis priestleyi Ana TaxID=1666911 RepID=A0A0P8DCL8_9CYAN  ali  28  4.....................................LNVIWVVGCAGLVLLMQPGFMCLESGLTRSKNSINVAIKNLVDLGVSLCX--------------------XXXXXXXXXXXXXXXXXXXTAGFFLPVEQDPELAAFFIFQAMFAGTSTTLVSGALAERLKFTGYVAITMLISGVIYPLFGHWAWNGINGSGWLGQLGFIDFAGSSVVHSIGGWVSLAALLVVGPRTGRFFRRIHGSNLPFSVLGVMLLWVGWLGFNGGSTFGLTEQIPAIIVH---------TILAGAAGMVAAGSFGYWRQRLMRPETLINGSLAGLVSITASCHAVNTPMAVLIGAMGGLMMLAATDLIERCGIDDGVDAVALHGVAGVWGTLALALFGDLDLIGTGL-----SRYQQLGXXXXXXXXXXXXXXXXXXXXXKNLNRILPLRVSIEEEEMGLNVVEHGTEVYDLFRVMDE.. 428
249 2.000e-48UniRef50_UPI0002ACEA66 ammonium transporter n=1 Tax=Leptolyngbya sp. PCC 6406 TaxID=1173264 RepID=UPI0002ACEA66  ali  27  1...............MVALILKSSVLLKSADPLSTNVTDTLWIVVCAGLVFLMQPGFMCLESGLTRSKNSINVAVKNLADFGLSXXX---------------------XXXXXXXXXXXXXXXXXXGWGNFAIDGGHYPDLIAFLFQAMFCSTATTILSGAVAERLRXXXXXXXXXXXXXXXXXXXXXXXXNGGQASGWLGKLGFIDFAGASVVHSTGAWISLAILLHIGPRLGRFPAQGPPQKIQGSNXXXXXXXXX----XXXXXXXXXXXGSTLIFTNQVAGIILNTLIAGAAGMITAGLLSLLRYRHLEVELLLNGSLAGLVAITASCHXXXXXXXXXXXXXXXXXXXXXXXXXEHWRIDDAVDAVAVHGGAGLWGTMAVGIFGQLDVLGTNL-----SRGHLIAIQFIGVLTCFFWAFGLTWLVLKGIDRWLPLRVSAAEEEIGLNVSEH............... 414
250 2.000e-48UniRef50_UPI0008366A00 ammonium transporter n=1 Tax=Pseudovibrio stylochi TaxID=1807766 RepID=UPI0008366A00  ali  28  67............................................................EAGKVRSKNSISVAQKNIVDLIINVTVFYFLGFAIMFGSPIGDWFGFS------------------SSLAAFRSADDPWVYTFFVFQAVFAGTAGTIVSGAVAERMRXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPEVDTYHGFMDFAGSTVVHSVGGWVALAACLVIGPRLGRYDNPMEGHSLVLSSLGTIILWVGWIGFNGGSTTVGNSDFA---------PIVFNTILSSVFGGAAAIIADRIKTQHFHPDQALNGVIAGLVGITAGCNVVDAWGAITIGVASGLAMHFSSYIMHYLKIDDVIGSVPVHGVSGAVGTLLLALVGDESLL------VSGSHWDQFIIQLEGVVYIFLYSFSVAYIMCLAVNRFFKLRVSAEQEVVGLNIAEH............... 438
251 2.000e-48UniRef50_A0A093VF80 Ammonium transporter 1 n=2 Tax=Eurotiales TaxID=5042 RepID=A0A093VF80_TALMA  ali  33  990.................................................................RRKSALALLFQSLMVVAVTTFQWMFWGYSIAFSRDAGPFIGT-----------LSAFGMKNVLVAPSPGSNVLPEIVYCLYQLLFCACTVMIVVGGAFERGNIIPSLIFSFFWATIVYCPIACWTWNPNGWLY---NLPSLDFAGGGPVHISSGWAALAYAFVLGKRKHHGEHHGKAHNTTLVFLGTVLIWFGWFGFNGG---------SALNASVRAMVAAFNTNTAACTGVIGWVLVDYIRNGKFSVVGACEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNINEWMHIDDGMEVFKLHGIGGICGAFMTGIFATSSISASIAPGAIDGNGKQVYLQLAEIAAISAYSFTVSCILLLILKYIPGLRVDEEVEMIGLDKAQ................ 1363
252 2.000e-48UniRef50_N8UK80 Ammonium transporter n=23 Tax=Acinetobacter TaxID=469 RepID=N8UK80_9GAMM  ali  43  59.................................................................RAKNILSIYTQFFAVAGVVCVLWLTVVYSMSADKTHMQAGVTNLYSF--VGSLNKAFLVGIDENTLL---GGVPEXXXXXXXXXXXXXXXXXXXXXXXERMKXXXXXXXXXXXXXXXXXXXXHMVW--GGEGAIMHTWGVLDFAGGTAVHINAGIAALVGAIVLGKRKGWPASPVPPHNXXXXXXXXXXXXXXXXXXXXGSAFAVNAS---------ATIAMMTTMVATCGGILGWMVIEKMYTQHVTALGLASGAIGGLVGITXXXXXXXXXXXXXXXXXXXXCCFYAVTLKHKMGVDDALDVFALHGIGGMVGCMLTGIFCIPQL--GGKVADIS-LLNQLAAQAGSIVLTVIYCGVLTWLIMKFVDKTIGLRVTPEQEERGLDVSDHNERAYNN........ 437
253 2.000e-48UniRef50_A0A1D8S0P9 Ammonium transporter n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A1D8S0P9_9GAMM  ali  49  175........................................................................................................................................................................................................GQMGIYDFAGGIVVHITCGVAALVAAVVLGPRYGFPRTPMLPHNLTMTITGAGLLWVGWFGFNGGSALAA---------NGDAAMAMLVTHLSASAGALTWAAIEWKKFGKASVLGAVTGMVAGLGTITPASGFVGPGGALVIGISAGFICFYSVYIKQKLKIDDSLDVFPVHGVGGILGTLLAGVFSSTELGAFSGYGYAEGMLGQVSXXXXXXXXXXXXXXXXXXXXFKLVSMTKGLRVDKEQEITGLDLIEHDESGYN......... 431
254 3.000e-48UniRef50_L1J6I4 Ammonium transporter n=4 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1J6I4_GUITH  ali  37  88.............................................................GGLAQAPNVLSTVMQSFSIMCTVSFLWFSFGYSLCFTAGDVFYGNSSNFWLHDMTSKKMR---------------NDSEKLFMVYQMTFAVISAAIICGSFAERMRFSAMLIFIAIWHILVYCPVAHWSWGPGGFL---NTAGCLDYAGGDVVHVSAGFSGLVASMLVGKRRG--------ISQGQEISPHNXXXXXXXXXXXXXXXXXXXXGSAFAADHMAINAMATTQMSGACGGLAWMAVEWIMRKRPTVVGIVSGSICGLVCITPGCGYVDLAGAVAIGLIGGITGFFSIQMKHMFGFDDALDAFGVHGICGVVGCLATGLFADQGVTDPNENGAFYGKPSQLYIQLYGVVVVVAYCSVISFLILKLLDIVMGIRCSPEAEKIGLDISEHG.............. 463
255 3.000e-48UniRef50_A0A2H5ZN31 Ammonium transporter n=1 Tax=bacterium HR30 TaxID=2035425 RepID=A0A2H5ZN31_9BACT  ali  53  70............................................................YGGLVRPKNVLSTLMHSFFCAALISVTWVVYGYSLAFGPTVDGVIGR-----------LDYAFLNGLAGTAAPAAPTIPHFVFAAFQATFAIITPALISGAFAERMRFPAFVLFMLLWSTLIYNPLAHWVWGGGWIAS---EVGALDFAGGTVVHISSGVSALVTAIFLGRRLGYPGEAIPPHNMALTVLGASLLWVGWFGFNAGSALSSGH---------LAAVAFVNTNTAAAAAALGWLVAEWIRSGRPTVLGAASGAVAGLVCITPGAGFVTPAASIVFGLAAGVLCYAAVTLKPKLGYDDALDVVGVHMVGGTLGALLTGVFATAKVNPAVPGGLFYGHPELLWKQXXXXXXXXXXXXXXXXXXXXXXNALVDVRADAEEEMIGLDLTQHSEQAYPYFPV..... 459
256 3.000e-48UniRef50_A0A210QB90 Ammonium transporter n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210QB90_MIZYE  ali  28  32........................MSPEDDLEAWID--DATWILTSSFIIFTMQSGFGLLESGMASRKNEVNIMVKNVVDVVFGGLTYWAIGYGLTFGDSPGSNG----------------FSGFGSFFLNPDEKHMGTVFSKFIFQASFCTTATTIVSGAVAERTKLTAYIVFCLLNTLVYSFP-AHWIWAPNGWL---KRLHVVDVAGVGPVHLVGGTTALIAAIMVKPRYGRFSKEGHHGNSVNALLGLFILWWGWLGFNCGSTFGISGGKWKLAARSAA-----TTILAACGGGMAFVLSFFIHKGKFDIGLLVNGILGALVSITGICAVTKTWVAVVIGGIGACVTAGAEALLVKLKIDDPVGATAVHLAGSLWGMISCGLFATKDNVERSFSFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGIDLTIGLRMTLEEELYGADYFEHNVE............ 446
257 4.000e-48UniRef50_A0A2H1VMS8 SFRICE_009437 n=2 Tax=Obtectomera TaxID=104431 RepID=A0A2H1VMS8_SPOFR  ali  26  19......................TNTTVNLQESFEIDLEDTNWILTSSFIIFTMQTGFGMLESGCVSIKNEANIMMKNLADISLGGLTYWIFGYGMSFGE--------------GTYSNPFIGVGDFLLDPPVGDALMGPVFASFLFQLSFATTATTIVSGAMAERCNFKAYCLFSLL-NTIVYCVPAGWVWGSHGFL---NKLGAVDIAGSGPVHLIGGASAFASALMLGPRLGRYAHGIPMGNPVNAVMGTFVLWWGWLAFNSGSTYGVSGAKWQYAARAAVM----TMMGSFGGGCFGLLFTLIKNKGKAEVMELINSVLGSLVSITGGCFLYRAWESLLIGFIGAAIASGTSPLFDMMGVDDPVGASAVHGACGLWGVLAVGLFADNETTNGRSGLFKGGGWYLLGVQSXXXXXXXXXXXXXXXXXXXXXDKIMPIRMDPYTELLGADITEH............... 477
258 4.000e-48UniRef50_Q2G5X7 Ammonium transporter n=21 Tax=Alphaproteobacteria TaxID=28211 RepID=Q2G5X7_NOVAD  ali  48  124.........................................................................................................................................IPESAFALFQMCFALITPALMVGAWVDRARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRFG---TLDFAGGIVVHTTAGVSALVVAMLLGKRAGFPRTLMLPHSPSLTMAGAALLWVGWFGFNGGSALAA---------NDDAASAIINTHVAACVAALVWLIIEKLSVGKPTSVGFATGAVAGLATVTPAAGFISPGAAMLFGAAAACVCYPMIQIKQRLEIDDSLDVFAVHGVGGMIGSLLLAVFLAP---SFGGTGYADGNLARQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMRVTEDEEREGLDITSHGERAWE......... 435
259 4.000e-48UniRef50_A0KPE9 Ammonium transporter n=166 Tax=root TaxID=1 RepID=A0KPE9_AERHH  ali  44  76.................................................................RSKNMLSMLMQVFTLFSLICVLWILYGYSLAFTEGNSVYGSFSKALLKGVTPDSI--------AATFSKGVGISEFIYVVFQGAFAAITCGLIVGAFAERIKXXXXXXXXXXXXXXXXXPDAYXXXXXXXXXXXXXGYGALDFAGGTVVHINAAVAGLVGAYLVGKRLGYGRDPMTPHSLTMTMIGASLLWFGWFGFNAGSALEA---------NGTAALAFINTWVAPAAAALSWTLAEWVMKGRPSLLGAASGAVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLKRLLGADDSLDVFGVHGVCGILGALLTGVFASPDLGGTGTNQVAEGYLAQVKXXXXXXXXXXXXXXXXXXXXYKLVDLLIGLRVKEDAEREGLDVTTHGEKAYS......... 477
260 5.000e-48UniRef50_B3SC46 Ammonium transporter n=2 Tax=Metazoa TaxID=33208 RepID=B3SC46_TRIAD  ali  25  3............DLQVESTAAPTNTTTHPYNVVTNENLNEVFHVIIGMIVFFMQAGFAFLEAGSIRSKNTTNILVKNLMDVFIGAVSFWAIGYALAFGKGTPFFG----------------------TEYFFLIGLPLTGYSYWWYHYVYAATASTIVSGAVAERT---AXXXXXXXXXXXXXXXXXXXXXXXXDPQGWLLYGVGKDFAGSSVVHCVGGVTSLTGAFILGPRIGRFDENGKPKTIPGHTXXXXXXXXXXXXXXXXXXXXGSQFRVTYGGGPVAALIAVNTAMACSGGGLTALLIKRLHPKIWSLLVCLNGSLAGIVSICASCNXXXXXXXXXXXXXXXXXXXXXSEIFLRCKIDDPLDAAAVHMGAGIWGVIAQPIFNFK--TSIFYTGFTALSWARFGWNLLGLGCIILWTGLTSGLMFYLLNKFGMFRVSEEIELKGLDLPIHGEPAYPRAAYGS... 435
261 5.000e-48UniRef50_A0A1W2C1Z4 Ammonium transporter, Amt family n=18 Tax=Bacteria TaxID=2 RepID=A0A1W2C1Z4_9FIRM  ali  28  39................LTTGSETVQDVAAVANKAYFGANYTWVMICAFMVFFFQCGFAMVETGFCRGKNAAHTMTMNFMVFLVGAVGYFLVGFALQFGSGGAAGLGTGGSVLDSMLSIPGLGGILGYKGFMLSGTYDAGVYALFFFQMVFMDTTVTIPTGAMAERVKYSAVVITSFFISXXXXXXXXXXXXXXXXXXXXGANHGVVDFAGSGVVHSMGGMLALSGAIVIGPRIGKFKKDFPGHNIPMAIIGTIILFFCWFSFNAGSTLNSTDFRLSVVA--------TNTMIAGAIGGLVAMFYMWGKYGKPDPSMTANGTLAGLVAITAPCAFVNXXXXXXXXXXXXXXXXXXXXXXEKLKLDDPVGAISVHGVNGFWGIIALGLFADGNGVTGNVTGLFFGDAAQXXXXXXXXXXXXXXXXXXXXXXXKLLDKVWGLRVSPEAELEGLDIPEMGVLAYPDQMVRSDLD 502
262 5.000e-48UniRef50_A0A0T2QAX0 Ammonium transporter n=6 Tax=Bacteria TaxID=2 RepID=A0A0T2QAX0_9SPHN  ali  45  158.........................................................................................................................................ISEYIFICFQMTFAAITAALVLGSVVERMKXXXXXXXXXXXXXXXXXXXXXXXXEA---RGVFFVMGALDFAGGTVVHINAGVSALVAALILGKRRGYPTEPMPPHSLTLTMVGTGLLWVGWFGFNAGSALEANGSAALAMINT-----FVAT----ASAGLFWMLTERVMGHKGSALGFCSGIVAGLVAVTPAAGNSGPFGAIVLGAVASVVCYFAVALKPALGYDDSLDAFIHGIGGIIGAIGTGIVFSPALGGPGGDDFVIG---AQLVTQVKXXXXXXXXXXXXXXXXXXXXKAVTGLRVSEQTEIEGLDIGEHGERAYN......... 468
263 7.000e-48UniRef50_A0A1G5J4Q0 Ammonium transporter n=2 Tax=Desulfoluna spongiiphila TaxID=419481 RepID=A0A1G5J4Q0_9DELT  ali  43  113.........................................................................................................................................IPEYIIAMFQGKFAIITPALISGAIAERVQFRGYXXXXXXXXXXXXXXXXXXXXXPDGWLLNIGAAGVIDLAGGLVIHVSAGISALVAALYLGPRKGFPRTAFHPNNLVMTMMGAGLLWVGWFGFNAGSTLGSGLDTA---------RALAMTQISAASGALTWLVIEAWIFKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSCLCYWALTLKTRFGYDDSLDCFGIHGVGSGLGVLMLSFFIRDSAEASAAAGKAWGPFDQLLVQATGMGVTILLASSVTLLLCFVIEKTLGFRVDEESELIGLDQVLHGETGY.......... 428
264 7.000e-48UniRef50_B1Y6V4 Ammonium transporter n=11 Tax=Proteobacteria TaxID=1224 RepID=B1Y6V4_LEPCP  ali  44  40................................PVLSAGDTAFIFACCIAVWLMTPGLALFYGGLARTKNVLSILMQVFTVSSLITVLWALYGYTLTFTDGQSFIGGLDKLFMKGVGAD--------------ALQGTIPEXXXXXXXXXXXXXXXXXXXXXXXERIKFSAVLVFMAIWFTINYVPMAHMGWGGGWVFKL----GAQDFAGGNVVHVNVGIAALVGAWMVGARKGAGTGAMSPHNMTMTMTGGSMLWVGWLAFCGGCAL----AANGFAMXXXXXXXXXXXXXXXXXXXXEWL-----HRGRPSMLGAVSGAIAGLVAITPACGXXXXXXXXXXXXXXXXXXXXXXKLKPMIGLDDSFDVFGVHGVGGIVGGILTTIFAMPSL--GGLGFAEGRDFGQMQVQLMVIGFSVVYSAISSWIAFKLTSIVCGLRVDEDEEDEGLDLISHGEPGYK......... 446
265 9.000e-48UniRef50_A0A069DMW4 Ammonium transporter n=2 Tax=Hydroidolina TaxID=37516 RepID=A0A069DMW4_9CNID  ali  25  20...................................EAIDALWVIMATFIIFTMQSGFGLLESGIVSRKSESNVMVKNVLDVCLGGMTFWLFGFGFIFGPDSS--------------ENVNKFSGTGHWAVTVDVENEAATYTQMFFHLSFSTAATTIVSGAVAERVHLPSYMIFAAINTGFIYVFPAHWAWGGGWLSQEAFF----DFAGSSVVHMAGGIAALAAAIILGPRHGRFDTKGAMSSPTNVILGTFFLWWGWIGFNCGSTFAVTGGGWKIASKTAVVTMNGAMAGGLSAVFLSAILYLSHRRKYIDITFLASGILGGLVGVTACAPIIRPWEGLFLGFVGGMIANGVNELLIKLKIDDPVGAFGVHYAAGLWSMIATGFFAEKIGLAPEDGVFKGGNGGLLAWNLAGCLAITLWSGGLATIVFLTLKYTIGIRMSLDHELKGSDAVEHNIH............ 430
266 1.000e-47UniRef50_A0A1I4N3W6 Ammonium transporter, Amt family n=7 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1I4N3W6_DESNO  ali  30  1..................................MEKIDLLWILISASLVFLMQPGFMCLESGLTRSKNSINVAIKNFADFVLSAAVFWVLGFGLMFGH-------------------LSWDLFHVPDFSPATKDSSGFSAAFFFFQIMFCGTATTIFSGAVAERMRXXXXXXXXXXXXXXXXXXXXXXXXNGGQLTGWLGERGFVDFAXXXXXXXXXXXXXXXXXXXXXXRKGRFPKDAPPRNLPLTVLGAFLIWLGWFGFNGG---------STLALDTTVPGIIVNTVLAGVAGGTSNLLLGWLTSRTPKITYLVNGVLGGLVAVTASCHAVDNFAATCIGLVAGAVCLGCETLLTRLHIDDAVGAVPVHLGCGIWGILAVAVFGDPTALGTGL-----SMPDQXXXXXXXXXXXXXXXXXXXXXXXXXXDPIFPLRVAPEDEETGLNVSEHG.............. 397
267 1.000e-47UniRef50_L1IN89 Ammonium transporter n=5 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1IN89_GUITH  ali  30  33.....................................MDTAWIVLCGALVFFMQAGFAMLEAGIVHPKNVTNILFKNMIDASIAAIAFWLLGYGFAFGSDSGGFIG--------KCGSACYFGLKDVYNGAGDGMGSSDGWEKWFFQWAFAGAAATIVAGAVCERTKLEAYFIYSVFLSTFMYPVIVHWVWGYGWLSAWGAYNGLIDFAGSGVVHMVGGFCGLVGAIIAGARRGRFGPDGSVNNNTLQALGVFILWFGWYGFNCGSTLMISG-----GAANVAGKVAVNMTISAASAAITATFLAKALQGHYNISMGLNGVLAGLVGITANCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRIDDPCDASVVHGFCGMWGIWATGIFCTDQYAGYPNANEACGSGEQFGVQXXXXXXXXXXXXXXXXXXXXXXDKTIGIRVSAEVEEAGLDISEHG.............. 463
268 1.000e-47UniRef50_D4ZW54 Ammonium transporter n=6 Tax=Cyanobacteria TaxID=1117 RepID=D4ZW54_ARTPN  ali  33  3......................................DLIWLLICSSLVFLMQPGFMCLESGLTRSKNSINVAIKNLADFGISVWLFWAIGYGLMFGTSQLGLFGSSYFVL--------------------DVSNIPSVAAFFLFQTMFCSTATTIVSGAVAERMRFTAYLIVAGFTSGLIYPIFGHWAWNNGVNNGWLDQLGFIDFAGSTVVHSIGGWVALAALLVIGPRAGRFPKGKSPRK----IHGSNXXXXXXXXXXXXXXXXXXXXXXXXXXSNQIPVIIVNTILAGVAGMLVRLFMACWRTGSIEIECLINGSLAGLVAITASCXXXXXXXXXXXXXXXXXXXXXXXXXXXKWRIDDAVDAVAVHVGAGVWGTLAVGLFARLDVLNTGLN-----RFGQIAVQXXXXXXXXXXXXXXXXXXXXXXXRFYPLRVSEDGENIGLNIYEH............... 393
269 1.000e-47UniRef50_A0A0F9K4A6 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9K4A6_9ZZZZ  ali  48  240.......................................................................................................................................GAIPEYLFFAYQMMFAIITPALITGAFANRXXXXXXXXXXXXXXXXXXXXXXXXXXX----XXXXXKWGIKDFAGGIVVHNTAGMAALASVLFVGRRRKGDD---VPHSIPLVALGTGLLWFGWYGFNAGSQLKVDSVT---------VTAFINTDIAASCAAIAWMTVEWFQTKKPRFVGLLTGAVAGLATITPAAGFVTPGSAAFIGVLAGVICYAAVSLKNKLGWDDALDVWGVHGVGGALGTIMLGLLAHEMIN--GQTGIFGGNAKFFGLQCXXXXXXXXXXXXXXXXXXXXXNKITPVKTTESEEME-LDESLHGETAYEE........ 548
270 2.000e-47UniRef50_T2J0N1 Ammonium transporter n=2 Tax=Crocosphaera watsonii TaxID=263511 RepID=T2J0N1_CROWT  ali  28  36.....................EDLSSLQEQLNQTKIAVDTGWILFTGSLVFFMNPGFAMVETGFCRRQNAINVLAKNLIVFCLATVAFWAVGYSFMFGKSYDFIGLQGFFLIGFENNP-----------------TEIPLKAQFFFQLTFAGTAATIVSGAVAERIKFPAFLIFSLLLVGFSYPITGRWVWGEGWLYGKFF-----DFAGSTLVHAVGGCAGLVGALFLGPRLNKYEEIEPGHNLSLATLGCLILWFGWFGFNAGSTLELNSP--------AVAHILVNTLVAGATGGIIGTLSAWFMFNKPSLTFIINGILAGCVSITASCAXXXXXXXXXXXXXXXXXXXXXTDFIDRFGIDDPVGAIPVHLFCGFWGTLAVGFFSAGPGVVDWYPG....................................................................... 421
271 2.000e-47UniRef50_UPI0004E20F9A ammonium transporter n=1 Tax=Desulfovibrio frigidus TaxID=340956 RepID=UPI0004E20F9A  ali  31  28...........................................................LESGLTRSKNSINVAAKNLADFVFSVCGFWAVGYGLMFGAEYAGLIGTD--------------------SFFANLESTPYMVAFFVFQAMFCGTATTIFSGAIAERMSXXXXXXXXXXXXXXXXXXXXXXXXNGGKLAGWLGAKGFVDFAGSTVVHSVGGWVALAALLVVGPRRGRFVDEVNASNLPMSVLGTLLLWFGWFGFNGG---------STLAMNGTVPTIIVNTLLAGGAGSVVSLLVGWFECRTPKISYMINGCLGGLVAITANCHVVSALDAVIIGSAAGPICIWAEKTLERFQIDDAVGAVPVHLACGIWGTLAVALFGDTALIGTGL-----SMLEQLEXXXXXXXXXXXXXXXXXXXXXXXXXRFIPLRVSKEDEEVGLNISEHN.............. 397
272 2.000e-47UniRef50_A0A1X2IDB2 Ammonium transporter n=1 Tax=Absidia repens TaxID=90262 RepID=A0A1X2IDB2_9FUNG  ali  38  2..............................VDAVIDKGDTAWVMVCACFVFLMCPGLGFFYAGLARAKNALSLMYLCLLSVGVVSIQWYLVGYSLTFSTTGSSFVG-----------DTSLFLLRNVGSAPLLPEHTIPSSAFFVFQAMFACITPALAFGSAAERMSLGPAIIFIFVWTTLVYDVVTYWTWNPNGWL---AKMGVMDFAGGITVHCSSGLAAVAYAMVLGKRRDYNKNVNTPHNVSFVFLGLSMMWFGWFAFNAGSAF---------AANARSVNSLVCTHLAGCVGGVVWVLLDYRHARKWSIIGLCTGAVAGLATVTPGSGFVTPSSGLAFGFFGALVCHVALNYKHRYHFDDALDXXXXXXXXXXXSVIALGYSEDTPLDTIQNGGWLDGNWMQVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLRLDDEAEALGTDWSEMGERAYAY........ 423
273 2.000e-47UniRef50_A0A225ACU7 Uncharacterized protein n=1 Tax=Talaromyces atroroseus TaxID=1441469 RepID=A0A225ACU7_9EURO  ali  34  60..................................................................RKSALALLFQSMMVVAVTTFQWMFWGYSLAFSRNAGPFIGT-----------LDAFGMMNVLAAPSPGSDVLPEIVYCLYQLLFCACTVMIVVGGAFERGNIVPSLIFSFFWATIVYCPIACWTWNSNGWLY---NLPSLDFAGGGPVHISSGWAALAYAFVLGKRKHHGEHHGKPHNTTLVFLGTVLIWFGWFGFNGG---------SALNASVRAMVAAFNTNTAACTGVLGWVLVDYIRYGKFSVVGACEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVNDWLHIDDGMEVFKLHGIGGICGAFMTGIFATSSISASLSPGAIDGNGKQVYLQLAEIAAISAYSFTVSCILLYILKFIPGLRVEEEAELIGLDKAQ................ 432
274 2.000e-47UniRef50_UPI00084B7D88 putative ammonium transporter 3 n=7 Tax=Arthropoda TaxID=6656 RepID=UPI00084B7D88  ali  25  47.....................GVAHQTEPDPASSISRDDAAWVLTATFIIFTMQSGFGLLEGGCVSIKNETNIMVKNVVDVVLGGITYWMFGYGLSFGTARG----------------SNPLFGWGSFFLNADEDTMGDVYTTFFFQLSFATTATTVVSGAVAERFNFVAYVIFSSV-NTIVYCIPAGWLWS---KRGFLYQMGVIDIAGSCGVHLCGGASAFLAAVMVGPRLGRYDHPLPMGSPTTAILGMFMLWWGWLGFNCGSTFGIQDHKWKYAARTAV-----TTIQASIGGGIAGMSISWYKNRQLEIGDVVNSILGALVSNTAGCALYTTYEALLVGTVGGTIAVLTMPLIDKLHVDDPVGATSVHGLCGLWAMIAIGLFVKADMTNGRSGLLRGGGXXXXXXXXXXXXXXXXXXXXXXXXXXKIIDKFMPIRMSEWEELVGADFAEHG.............. 464
275 2.000e-47UniRef50_R1D1H4 Ammonium transporter n=4 Tax=Emiliania huxleyi TaxID=2903 RepID=R1D1H4_EMIHU  ali  27  2.............................EDEDLKSAINVAWVLLCTALVFWEQAGFAMWEAGCLRSTSLHSILLKNMCDAAIGAAAFFTLGYAIGFGGGADHKFAGNDKFFLKACAARLHNPAPPPFALPAALWAFA-------------ATAATTVSGCMAERTQFAGYLIYSFFVTAFIYAVPLHWLWADAGWLCAWGDYGMIDFAGSGIVHMLGGAAGLVGSYVVGPRAGRFTDKGPGHSIALTTLGVYCLWFGWFGFNAGYTLGTTGGMWKTAAL-----ICVNTTISPSASILSVLLIEKFLAGYYDTSKCMNGIVAGLVGITGPCGVVEPYAAAIIGIVSGAVYCGSWRLHERLRIDDPVHAGAVHAWPGFWGCIASGLFAWPKQVAGGGGLFYTGHGGQFGTNVLGTLVVLAWTVATSSIVFGSLQAAKLLRVTAEEEEMGVDLAEH............... 423
276 2.000e-47UniRef50_A0A1X4NM45 Ammonium transporter n=2 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1X4NM45_9RHOB  ali  28  4.....................................IDQVWIIFCATLIFMMQAGFMCLEAGITRSKNNISVAIKNISDLSISVLLFWAIGYGLMFGTSFGGLIGTSDFAFEKLGASGV--------------------YVQFIFQAMFCGTAATILSGAVAERSAFHAYXXXXXXXXXXXXXXXXXXXXXEGAPVGWLNRQGFHDFAGSXXXXXXXXXXXXXXXXXXXXREGRFLDSGQPRNLPLTMLGVLLIWFGWFGFNGGSAGGFTDEVPGLLL---------NTIVGGAGGVLTGLAISWAMERKPSVFYGMNGGLAGLVAITASCDLISVREAIVVGAVGGSIAFFGDKALERLHIDDVVGAVPVHFLSGLWGLAAVAIFGSDQLGIEVA--------EQLATQXXXXXXXXXXXXXXXXXXXXXXXQVIPLRVTQHVETIGLNVGEHG.............. 393
277 3.000e-47UniRef50_J9HAH9 Ammonium transporter n=24 Tax=Bacilli TaxID=91061 RepID=J9HAH9_9BACL  ali  51  34..............................TTTPINSGDTXXXXXXXXXXXXXXXXXXXXXGGLVRTKNVITTMLQXXXXXXXXXXXXXXXXXXXXXXXDVHIIGNLSWFMMRGVG-----------AAPDSDYASTIPNXXXXXXXXXXXXXXXXXXXXGLAERVKFASFXXXXXXXXXXXXXXXXXXXXGAGGWLHT---LGVLDFAGGTVVHISSGVAGLVAALYLGRRAEHGSGEIKAHNVPFVLLGTALLWFGWFGFNAGSALAA------NYLS---AEAFLATNTATAAAAVGWMIAEKLRTGHVTLVGACAGAVAGLVAITPXXXXXXXXXXXXXXXXXXXXCYLASTFKSKLGYDDALDAFGGHGIGGTWGALATGIFASTTVNSAGANGLIHGNAHQVLLQXXXXXXXXXXXXXXXXXXXXXXXKLIGIRVTKEEEIMGLDLALHRESAYPETLTASELP 452
278 3.000e-47UniRef50_A0A0D2UPA8 Ammonium transporter n=1 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2UPA8_CAPO3  ali  45  4...................................NPGDTAWVLVSTALVQLMTPGLSFFYAGLVNSRNVXXXXXXXXXXXXXXXXXXXXXXXSEAFGPNTHVTGGTENRALEGL---------------VGGMVGDXXXXXXXXXXXXXXXXXXXXXXXSVATRMRFIPFMTFVALWHLLVYCPLTHWVWTVGD--GWINDYGAIDFAGGLVVHVSSGVSAFVAAFWLGQNPLRDNHEHKPHNVPYVMLGAALLWFGWFGFNAGSAL-----TAGQL----AGLAFANTQIAAAVAMFTWNLVEGWFNGRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFFGAFTSPVCYLALKLTKRSPIDDTLDTFAVHGVGGAVGSLLTGLFATTEVGS-PVDGSFYGDGGELGKQXXXXXXXXXXXXXXXXXXXXXXKGMAKLRISADDMAVGVDGIDHGESAY.......... 416
279 4.000e-47UniRef50_A0A2E1ADK0 Uncharacterized protein n=1 Tax=Anaerolineaceae bacterium TaxID=2024896 RepID=A0A2E1ADK0_9CHLR  ali  30  1..............................MNPSSDALNYLWILVCAALVFLMQAGFLCLETGVTRSKNNINVALKNLVDFGITTILFWAFGYGLMFGLSQSGLLGTDQFFLEF-------------------NGDNIDTVVFFVFQVMFCGTAVTILSGAVAERLRFSSXXXXXXXXXXXXXXXXXXXXKNGGLVTGWLGQAGFRDFAGSTFVHSLGGWAALAILLIIGTRRHRFNADG----STNPXXXXXXXXXXXXXXXXXXXXXXXXXXSTLALNADXXXXXXXXXXXXXXXXXXXXXXSQMTTGRVQASDIMNGVLAGLVAITGSVNAXXXXXXXXXXXXXXXXXXXXDRLLLRLRIDDAVGAVPVHLGAGIWGTLAVGLFADMTQLGFDTG---MTRINLLVMQLVGVVVCGVWAFGLTYIIFRIIDRFMPLRISEDDEKIGLNISEHG.............. 403
280 4.000e-47UniRef50_UPI000A2A488B putative ammonium transporter 3 n=1 Tax=Exaiptasia pallida TaxID=1720309 RepID=UPI000A2A488B  ali  25  1....................MSANNSSNTDASQHNPWDDAIWILTCSFIIFTMQSGFGLLESGMVSRKHEINILVKNIADVLFGGLAFWMFGYAFSFGNKPG----------------ANMFIGFGDFFVDADGDEMGWVYSRFFFQASFSTTATTIVSGSMAERVKLEAYCLFSFL-NTIIFCMPAHWLWSEVGWLR---AIGAYDAAGACTVHLVGGVTGLVATMILKPRSGRFEDDDADLGQXXXXXXXXXXXXXXXXXXXXXNCGSTFGVTDGKWKIAARAAVMTINASVGGGITAILLSYFTKQRKFDVKFLIRGVLGSLVSISGICGYAHPWEAIIIGALGALIACYSVPFLEHLHIDDPVGSVSIHLFPAIWGMIATGLFANTIVTMHKGGIFSTGTFKFLGXXXXXXXXXXXXXXXXXXXXXXXXXKTIGLRVSYQEEVLGADIVEHSLGGY.......... 422
281 5.000e-47UniRef50_UPI0007806FF3 ammonium transporter n=2 Tax=Endozoicomonas TaxID=305899 RepID=UPI0007806FF3  ali  28  2.................................PYGHLNTLFLTLCILLVFMMQIGFLCLEAGAVRSKNNVNVAAKNLLDFVLVTLVYALISFSIQFG------------------------AFDALLERAHPRSPGYP-YLFLMFQALFAVTATTIVSGAIAERSSLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXGWLHEMGFIDFAXXXXXXXXXXXXXXXXXXXXXPRDGFGEESYKKFRGQNQXXXXXXXXXX------XXXXXXXXXXSLLKVDVSMPTIMTTTMLGACSGGLAATVWSLIFFKKFDVPVIANGVLAGLVGITAGAHILEIYTSIIIGFIAGLICCGAMAQLEHWKIDDVIGAVPVHMAAGIWGTVAVALLGNLREVNNGLN-----TIEQLGVQAMGVAVTVAWAFGISYCTLFVINKFIPLRVTREAEQLGLNIAEHG.............. 390
282 5.000e-47UniRef50_A0A269PLS8 Ammonium transporter n=3 Tax=Pseudoalteromonadaceae TaxID=267888 RepID=A0A269PLS8_9GAMM  ali  34  36............................................................EVGAVRSKNSINVAVKNISDFCVANVVFLLFGFAFMFS-NNGSIINTDYLLLYGVDSTR--------------------LLCFFAFQAMFCGTATTILSGSISERXXXXXXXXXXXXXXXXXXXXXXRMAWGGAESAGWLNQQGFVDFAGSSVVHSVGGWVALAAIIVIGPRIGRFTKGLPPHNIPMSTIGTIFLWFGWFGFNAG---------STLAMNDAVPIILLNTNTAAAFGGLTALILTWLLMKKPNVPHILNGVLAGLVSITACCHAVEVYEAAVIGILGGSIYLYSSHLLDQFEIDDVIRAVPVHGVCGLWGTIAVALFGNSHVLGTGLNFE-----QQLLIQXXXXXXXXXXXXXXXXXXXXXXKNIVPLRVCKEHEIKGLNVVEH............... 401
283 5.000e-47UniRef50_A0A1M6TKR2 Ammonium transporter n=1 Tax=Reichenbachiella agariperforans TaxID=156994 RepID=A0A1M6TKR2_9BACT  ali  24  8..................ALLGLVSTPPEGAGFVRLNIDDLWVLVAAALVFFMQAGFKVLETGMVKKEHRSSIGAKNLLDWVAGSIAFFLVGFAFMFGDSIDGFLGLDYFFGQGLDSGKXXXXXXXXXXXXXXXXXXX--------------------XGAMSGRTXXXXXXXXXXXXXXXXXXXXXHWAWGNLWNPDWLASMGFMDFAGSTVVHSTGAWVAVMGIYMVGPRLGRYDAYGRIQDYAYSILGVMILWLGWWGFNGG---------STLAFNEDVVKIILNTNLAGAAACFTGFFHAYLFQNKKDVIKIAGGSLTGLVAITACCNVVTPISSLMIGALAGVIHNIFVVISEKWKLDDPVGAIAVHGIGGVFGTMSVALFGQEELL-------MHSRWMQLGIQFMGVATCFLFTTAVSYVMFTVIKKTIGLRVSPIEEKKG..................... 412
284 5.000e-47UniRef50_A0A059B5V8 Uncharacterized protein (Fragment) n=1 Tax=Eucalyptus grandis TaxID=71139 RepID=A0A059B5V8_EUCGR  ali  39  2......................................DNVWQLTAAALVGLQSPGLVIFYGRMVKGKWAVDSAFMAFYAFTAILVCWV----------GLPYV----------VRGESS-----ALPRETGRGAGRVPTGC------VFTAITLILVASVLLGRMNFRAWMLFVPLWLTCSYRVAAYSIWCPDGW---SARLGVINSAAGYVIHLSSGVAGFTAAYWVGPREDKDREHSPPNNLILMLAGAGLLWMGWTGFNGGAPFAASST---------ASLAVLNTHVCTAMSSLMWLILDSFLFSKPSMVGAVNGMITGLVCITPAAGLVQGWAAILMGVASGCVPWYTMTVLHNRQVDNPMSVFHTHAIPGTLGGVLTGFFAVPKL.............................................................................. 319
285 6.000e-47UniRef50_B3RRT6 Ammonium transporter (Fragment) n=5 Tax=Metazoa TaxID=33208 RepID=B3RRT6_TRIAD  ali  25  2......................................DAGWLLASGFIIFTMQSGFGMLESGLVSKKNEVNIMVKNTVDVIFGGISFWMFGYAIAFGIDT-------------VPGRNNPFTGIGNFFVDGHVNSSGWLYTNFFFQLSFSTTSTTIVSGAMAERTKLDSYCVFSFFNTLVYAFPAHWI----WDSKGWLRQMGVVDAAGGCAVHIVGGFTGLIATLILRPRIGRFSSNYQPESPTNAIVGMFMLWWGWLGFNCGSSFGVTGHLWKFSARAAV-----TTMMSSIGGGLYAIIFSYIFKKKIKINHMINGILGALVAITPCCMVVDAWASIVIGIIAAACSCHGATLLARIRIDDPVDCVATHGFCGMWGMLAAGLFAQKELTDQFSGLFYGGGMHLFGIQXXXXXXXXXXXXXXXXXXXXXXKVSMGIRLTEEEEHLGADAVEH............... 402
286 7.000e-47UniRef50_A0A1F5YFJ5 Ammonium transporter n=33 Tax=root TaxID=1 RepID=A0A1F5YFJ5_9BACT  ali  34  1MRNQARSAAWLPVLVMLVPAALFAQEDTITPEALAKGINTXXXXXXXXXXXXXXXXXXXXEAGFTRAKNAANILMKNMMDFTMASLAFWIIGYALMYGVG-NGLFGSSYFFLKGVPADTN----------------GIPTQAFWFFQVVFTAAAATIVAGAMAERTRFVSYLIYSFLISAFLYPLVGHWAWGGGWL----AQLGFQDFAGSTVVHTVGGWAALVGAIMLGPRIGKFSPDGHPHNIPLAALGCLILWFGWFGFNPGSSLSGMNA-------DLIAKVAVNTNMAAASGCVATMLLVWALYGKPDFSMAINGALGGLVAITAPCXXXXXXXXXXXXXXXXXXXXXXXXLLDKLLIDDPVGAVPVHGMCGVWGTLSLGLF------HETAGLFYGGGWMQLGVQALGSVTVVLFTIAGMYVIFKILDLTFGLRVTPEEEIRGLDIGEHGMESYAGFQV..... 436
287 7.000e-47UniRef50_A0A2E7CXY5 Ammonium transporter n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E7CXY5_9PLAN  ali  28  3..................................KTPVDVAWVVVSAGLVFLMQAGFMCLESGLTRAKNSINVAIKNTTDXXXXXXXXXXXXXXXXXXXXKGGWFGTTDFLANVGQGGMWLAAFFLFQAAF-------------------CGTATTIVSGAVVERMKFSGYMIVAVMLSGLIYTLFGHWAWGGIGEPGWLAAKGFVDFAGSTVVHSIGGWVALAVVLVIGPRRGRFDENGEPQTIPGHDXXXXXXXXX----XXXXXXXXXXXXXTLSMDTSVPQIIANTILSGSAGMATALLISWGQHGRADVEIVVNGGLAGLVSITASCHXXXXXXXXXXXXXXXXXXXXXXXXXXRLKVDDVIGAISVHGFAGAWGTLAVAIYGDFKTLGTGL-----SVGQQFTVQLLGVGVCFAWAFGVAFLILKIVDPLISLRVSEEDEHVGLNVAEHG.............. 398
288 8.000e-47UniRef50_UPI000A017A18 ammonium transporter n=1 Tax=Azospirillum halopraeferens TaxID=34010 RepID=UPI000A017A18  ali  30  113............................................................EAGLVRSKNSINVAQKNLVDFVAAVTIFGVFGFAVMFGTSAGGVVGWNTNMLAFNHSND-------------------WDYAFFIFQLVFCGTAATIVSGAVAERMRFTSYLWATVFVSGLIYPVFGHWAWGSADNPAWLASEGFIDFAGSTVVHSVGGWVALAAVIVLGPRIGRFTPPIQGHSPVLATSGALILWVGWIGFNGGSTLAGTPQFA---------HIVFNTIVSGAVGGVVGMIIGRLMDGLWRVDRVINGVLGGLVAITAGCDXXXXXXXXXXXXXXXXXXXXXGEAMERLKLDDAVGAVPVHGVCGAWGTLMTAFFAMPDKMPAGDV------WSQFLVQAEGVTAAFVWAFGLSLIFFKLLNLGGGMRVSREHELLGLNEAEHG.............. 485
289 9.000e-47UniRef50_T1IDW3 Uncharacterized protein n=1 Tax=Rhodnius prolixus TaxID=13249 RepID=T1IDW3_RHOPR  ali  24  29......................................DASWIMTSAFIIFTMQTGFGMLESGCVSTKNEMNIMMKNIADIFLGGVTYWAVGFGFSFGTYW-----------------TCPVLAIGDFALDPTPEEMGPKFTAFLFQLSFATTATTIVSGAMAERCNFKAYCVFSFMNTVVYCIPAGWV----WGDHGFLKQMGAVDIAGSGPVHLIGGVSAFASAMMLGPRLGRYESGNPLGTPVNCAMGLFVLWWGWLAFNSGSTYGLSGLKWAYSAKAAVM----TMLSSFGGGIVGLTYTLIINRGNANILDIINSVLGSLVAVTAGCFLYSSWHALLIGCIGGLVTSFTTPLFDKIKVDDPVGASAVHGMCGIWGVIAVGLFAEDPYAGLFIGYYTKISFYDMMKHII----------LTNKFIIFSINKVIPIRMLAHEELLGADLAEH............... 421
290 1.000e-46UniRef50_A0A081CIQ7 Ammonium transporter MEP1 n=1 Tax=Pseudozyma antarctica TaxID=84753 RepID=A0A081CIQ7_PSEA2  ali  33  70.............................................................SGLARRKNALHXXXXXXXXXXXXXXXXXXXXXSLAFSQTSGAFLG----------NLRNFGHMGVLERPVPQANNKVPEIVYSIYQCMFANLVPAIAIGAACERGRVWPFLVFTFVWTTLVYDVIACWVWNP---TGWAFKWGVLDYAGGGPVEINSGITGLVISYYLGPRHGYGTERFKPHNVSHIVLGTVFLWVGWIGFNGGSTF---------AANIRAAMAISTTNLAASAAGLTWMFLDFRLERKWSVVGFCTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNFATVLKGPMRVDDVMDIFSVHALAGYVGTLLTGIFANNDGILVIPGGWLDGNWIQLAYQLAYCVAVTAWCGGVTFAIMFVLDFIGPFRASELGEIVGMDEDQCGEWAYDYAFINRDL. 465
291 1.000e-46UniRef50_R7TS58 Ammonium transporter (Fragment) n=2 Tax=Capitella teleta TaxID=283909 RepID=R7TS58_CAPTE  ali  26  2......................................DAIWILTSTSIIFTMQSGFGLLESGSASTKNEVNIMVKNAVDVIFGGLTFWLFGYSFSFGQDP---------------KYTNFFTGWGNFLAFSSDENMGNVYSKFFFQASFATTATTIVSCAMAERTRLESYIIFSLFNTLVYCFPAHCV----WGKKGWLAELGMIDVAGCGSIHVVGGVAGLVATTILRPRHGRFGQEGKMGSPTNVVLGTFMLWWGWLGFNCGSTFGVSGDKWKLAIRS----AMATLNSSLAGGIMGCLISYIFKKRTFDVPYMVNGILGSLVGITALCALAEPWESFTIGAIGGTFALAGAEIVTKLKIDDPVGCVGVHAFGGFWGLVSVGLFKKKDSLSEVEGLFYGGGFHXXXXXXXXXXXXXXXXXXXXCLMLNTINLLVPLRMPLHEELLGSDIVEHGI............. 411
292 1.000e-46UniRef50_B0DQF4 Ammonium transporter n=2 Tax=Laccaria TaxID=29882 RepID=B0DQF4_LACBS  ali  35  1................................................MVYLMVPGLAFLYSGLSRRKSALSLIWVVSASNVVVIFQWFLCGYSLGFSPT----------ATNGIIGNLRNIGLMNVLGEPSPGTPLLPDILYSFFQMEFACVTAGILVGGIAERGRXXXXXXXXXXXXXXXXXXXXXXXXN---ANGWAAKLGVLDFAGGGPVEIASGMGGLAYAWVLGQRKKQELLNFRPHNVSLVALGTSLLWFGWIGFNGGSAFG---------ANLRAIFAVWNSMIAAAFGGIVWCLLDYRVDRRWSMVGLCSGTIAGLVAATPSSGYIQPWASVFVGIISGTLCNFATKLKFMLRVDDALDLFAEHAIGGIIGLLLTSFFASSTVMAGVTTATPNRWLEQLAKQFAYVCATSIYTFVLTALIAKTVNSIPGLRCAPEAEVLGVDEVEIGEFATDYIE...... 398
293 1.000e-46UniRef50_A0A0F7SI55 Tfiid and saga subunit n=1 Tax=Phaffia rhodozyma TaxID=264483 RepID=A0A0F7SI55_PHARH  ali  33  996.........................ATTDGVASSYDPGDIAWVMTCSALVWMMIPGLGYLYSGLVRRKNALSLLFITISSLAVTSFQWFFWGYSLTFSKTGGLFWG----------NLRNFAFMKVLELPVPEANNKIPEXXXXXXXXXXXXXXXXXXXXAAAERGRFLPAMVFTFVWTTLVYDPLAHWVWSSHGWA---FKWGVLDYAGGIPIEVASGTTGLAYSLFIGPRRG-GETLFKPQNISHVVLGTVLLWVGWLGFNGGSTF---------AANLRAAMAIYTTNLAGSIGGITWVAMDYRLERKWSCIGFCTGAICXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLSTRLKTVMKVDDALDIFACHALSGAIGTLMTGIFAEADGYSSIAGGWLDGNFRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFRSSEQAEILGMDETEHDEFVQDYVSFRRDAD 1424
294 1.000e-46UniRef50_A0A2G8JTK6 Ammonium transporter n=1 Tax=Stichopus japonicus TaxID=307972 RepID=A0A2G8JTK6_STIJA  ali  24  34.................GPLSQVPEVQDSGGIEALNWDDATWILTSAFIIFTMQSGFGLLESGSVSSKNEVNIMIKNTVDVLFGGLSYWMFGFGFS--------------IWIDGESNQFSGVSNFFLDAAVDHIHSGQIFSLFFFQTSFATTATTIVSGSMAERTKLEAYVIFSMLNTFVYCFP---AHWLWRSEENWFYQMGAIDLAGASTVHLVGGVTGLVATVMLGPRTGRFKDKGKMGSPTNAVLGLFMLWWGWLGFNCGSTYGIAKRQVGPG--YQILLANKFYIYSRIMSRYFIFYSYVTKKRKFDIVYIINGVLGSLVSITAYCALARPWEGLVIGAVGGGVACLSVPIIEMLRIDDPVSVVPVHCVAAIWGMLSVGLFGEVDELDHIPGLFKGGGFKXXXXXXXXXXXXXXXXXXXXXXXXXXXDVTIHIRVPLHEELLGADLVEH............... 458
295 1.000e-46UniRef50_U3LZ95 Ammonium transporter n=8 Tax=Fungi incertae sedis TaxID=112252 RepID=U3LZ95_9GLOM  ali  37  36.............................................................SGMAHRKNALSLILLCMVSVAVVTVQWFFFGYSLAFSKSGNKLIG-----------GFRKALFLNLEKEDPYPNTNISESTFAIYQLMFAAITPALAIGSTAERARIFPTXXXXXXXXXXXXXXXXXXXXSEHGWAH---DLGSLDFAGGTPVHMASGAAALAYALVLKKRMESEEGEPKPNNVTNIILGTIMLWFGWFGFNGG---------SALGANPRATNAIIVTNLSASIGGITWMLWDYRLEGKFSALGFCSGAISGLVAITPASGYVSPPSAIAFGLVSGFLCNLATKLRNIFNYDDACDVFAVHFVGGFIGNILTAIFAQNSIVDPIDGGFLDHNWIQIVYQLANSLAGGLYSFFATLMIVLIMNEIPGLRASPDSETLGIDQSELGESAY.......... 420
296 1.000e-46UniRef50_A0A167AU79 Ammonium transporter n=1 Tax=Pseudoalteromonas luteoviolacea H33 TaxID=1365251 RepID=A0A167AU79_9GAMM  ali  30  1....................................................MQPGFTCFESGLVRSKNNINVALKNVADFCISGVCFWIIGYGLMYGASANGFFGTDQFALNSY--------------------DDPSVLAYFLFQMMFCGTAATILSGAVAERMRFSGYIICAFVTATLLFPIVGHWIWHGKHFLGWLLELGFIDFXXXXXXXXXXXXXXXXXXXXXXXRLGRFTSEGEPQNLPLSALGTFLLFIGWFGFNGGSVHTPSSELA---------RVFSNTALSACAGGVSALLLSWNLHSMQGIRYVLNGLLTGLVAISASADLVNLPSAIVIGAIAGCVSVLLGDLLEKYKIDDVVSAVPIHLGGGVWGTLAIALFVPLE------KLKHESHTEQFLVQLLXXXXXXXXXXXXXXXXXXXXNRVHPLRVSAQTETIGLNFGEHGM............. 379
297 1.000e-46UniRef50_A0A212R1C7 Ammonium transporter n=2 Tax=Beijerinckiaceae TaxID=45404 RepID=A0A212R1C7_RHOAC  ali  43  243...........................................................................................................................................................................................................GALDFAGGTVVHINAGIAGLVGALIVGKRIGYGREALPPHSLTMTMIGAALLWVGWFGFNAGSNLEANGVTA---------LAFVNTMVATAGAALSWLLVEWAVKGKPSLLGLVSGAVAGLVAVTPASGYAGPIGSLVLGLTVSPLCLFFVSVKNTFGYDDALDVFGVHCIGGXXXXXXXXXXXTDYTNFANGNASTADMIAQLIIQAKAVGTTLVWSGVGSAILYKLVDLVVGLRPAPDHEREGLDVTDHGERAYN......... 503
298 1.000e-46UniRef50_A0A254QCZ3 Ammonium transporter n=1 Tax=Armatimonadetes bacterium Cent15-Ar3 TaxID=1987502 RepID=A0A254QCZ3_9BACT  ali  50  99.......................................................................................................................TEYLLGKNISLKTPYTQTIPAALFMLFQMKFAIITPALISGAIAERVRFKAYXXXXXXXXXXXXXXXXXXXXNPDGWLF---KAGALDFAGGTVVHLASGISALALSIFLGKRKSVEAK---ANNXXXXXXXXXXXXXXXXXXXXGSSLA---------MNDIAVSAFLTTHLAAAAGMVTWMVVEMIRKGKVTAMGAACGLVAGLVAITPAAGYISTPSAILIGVAAGLVCVFAIELKHKLGYDDALDVVGVHGVGGTLGAILTGALADPAINS-AVEGSLKDGRGHLMVQFQXXXXXXXXXXXXXXXXXXXXNKVTRLRSSESAEVKGLDHSYHGEQGY.......... 427
299 2.000e-46UniRef50_A8HSA2 Ammonium transporter n=10 Tax=Chlorophyceae TaxID=3166 RepID=A8HSA2_CHLRE  ali  28  32.................FAFAADNSDLSDRLDQTNQGLNTLYLVSCGALVFVMHAGFAMLCAGAIRSKNTMNILLQTVMDAAVSAVAFYILGYGFAYGIGNNPNGFIGDSL-----------FGLSRWVSHSSSSDAGANWQAWFFQWAFAATATTIPAGAVAERLNFNAYXXXXXXXXXXXXXXXXXXXXAAEGWLGHLFRSGMIDFAGSGVVHMTGGLAGLAGCIMVGPRMGRFDSNGQPHSATLVVLGTVLLWFGWYGFNPGSQLIINYTASAAVVGRAA----VTTTLSGAAGCLSCLLTAFLRHKAWDLVSGCNGALVGFVSITASANVVEPWAALIAGLVGGWVFDAVCLLFLKLRIDDPLSAAPMHAFCGAWGVFFAGLLAKKEYICESYGLFYVGDGRXXXXXXXXXXXXXXXXXXXXXXXXXXXKAVGLLRISAEEEQAGLDVSKHGGSAYNYD....... 485
300 2.000e-46UniRef50_H4F0E6 Ammonium transporter (Fragment) n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=H4F0E6_9RHIZ  ali  25  9...RSTILPSCLGAVLAALVATPSFAADDQAATVYNPADLAWLMAASGMVMMMQVGFLLLEAGMVRSKNSINVAQKNLLDFVFGVVAFAAVGFMLAFGKTGWLPFGVDGDLFFLQQTDSWVAG-------------------FFVFQVMFCGTAATIVSGAVAERMKXXXXXXXXXXXXXXXXXXXXXXXXXGPNSGAFLANLGFVDFAGSTVVHATGGWIALAACMVLGPRLGRFDANGRPHNPVLSTTGALILFFGWIGFNGG---------STLKASLDVAPIIMNTVLAGGMGTCVGYLLGFKQDGVVLPEKSLAGMLGALVAVTAGCHVLEPGGALLIGALGAAVAVYGNQFVEYMKVDDAVGAIGVHAFAGVAGT------LALALLAPVEHLPAGSRLGQLYVQVFGSALNFYWSFGLGYAFFYALDRLIQIRVSAPVEEIGLNIAEHG.............. 436
301 2.000e-46UniRef50_Q12R70 Ammonium transporter n=1 Tax=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) TaxID=318161 RepID=Q12R70_SHEDO  ali  27  8.......................................NLWILLCACLVLIMQAGFTCFESGNVRNKNSVNVALKNVSDFCVCAVCYWAFGYALMYGNSIDGIVGANGFFY--------------------STTTNSHETSFFLFQLMFCCTSATIISGAVAERMRFTGYXXXXXXXXXXXXXXXXXXXXGGTSTPGWLEQLGFIDFAGATVVHSVGGWMALACVLIIGPRLGRFNNKHFGDNLPLTALGTFLLFLGWFGFNGGSYGKIDDMLSS---------VFVNTALGGTFGGFVVLLICIWQQSLLSIRFVLNGVLAGLVAITASANSISSIDAATIGGISGALSFFATILLEKCKIDDVXXXXXXXXX-----XXXXXXXXXXXXXDGQYFIAGNSRVDQFLIQLLGVVTCGIFAFGLPYMLIRLLNRVYPLRVSPRVEILGLNFGEFG.............. 401
302 2.000e-46UniRef50_A0A1Q9EHZ7 Ammonia channel n=1 Tax=Symbiodinium microadriaticum TaxID=2951 RepID=A0A1Q9EHZ7_SYMMI  ali  48  1............MTDAAVNVLANMTEADPPLTATEDAGAVAWVLTSTALVFLMTAGLGFFYGGLVRDTNIINTMMMSXXXXXXXXXX----------XXXXXXXXXXGDNGENGIGLVIGNFDYSFWMGLDMTNWDTLPGLAFASFQMTFAIIASAIISGSLVERVRFSAYCIMLALWSLLIYAPLCHWVWGPGGWIG--SQLGALDFAGGTVVHISSGVSGLVAGAILGPRKHVEKDLG-PANAPFVILGGCLLWFGWLGFNGGSALSTTD--------GVAARAVATTFVAAASSMLTWLALERVLKGKSTSVGASVGAVAGLVVITPAAGFVTPGWSIALGVLGAPWCYFTCELVNRINVDDTLDAFGLHGSGGFAGAILTGIFAVDD------GLIYSGSFLLLGKQXXXXXXXXXXXXXXXXXXXXXXKMLFKLRIPEEHEIGGVDEHTHGET............ 420
303 2.000e-46UniRef50_A0A0B7B8S7 Ammonium transporter n=3 Tax=Arion vulgaris TaxID=1028688 RepID=A0A0B7B8S7_9EUPU  ali  26  57............................................................EASCVRCKNAGNALLKNVLDMAVTVIAYWTCGFALAFGKGNSFIGWHAYWASSDLEGDYMAFFFFEFVFAA---------------------TSATLVSGALSERCDFIAYFIYSFLITAFIYPPVTHWAWSDEGWLGVQERVGFHDFSGSGAVHLVGGTAALLGAIILGPRIGRFHPETKGHSVPFAALGAFLLIVGFLAFNGASQLTMTKPGDNVIIALSI----TNTIIAGSMSGFSSVVIRRLFRRNWSVLYTVNGCVSGMVAICGGCDLFRPWGACLVGMVAGVCFNITSWGVAKLKIDDPVDAVAVHFSGGXXXXXXX---XXXXXXXXXXXXXDKRSGLMLAWQLVGLCAIMLWTATLSAIMFGSMKGLGMFRVSEEVERKGLDLPIHGEHAYPPEAYE.... 449
304 2.000e-46UniRef50_A0A1Y1I2H8 Protein phosphatase 2C family protein n=2 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1I2H8_KLENI  ali  25  1.........MASMTELDQLGAALNATLQHEASVSAHTDAAIWRLQAATIVFFMQVGFALVEAGSVRAKNTQNIMVKNVMDACFCAAAFWTFGWALGFGEGSSVIGWRNESQSIALFNEGNQVN--------------------FFFQYTFAATSVTITSGAVAERFRLKAYLLYVVVHSGFMYPMIAHFIWAGTGLMGFLGTDGVLDNAGSLVVHVTGGVASLVAAWMVGPRIGRYPVPFKPNSVSFVAAGTLILWAGFYGFNAGSVD--LGSLDIIVWYEQLARVCSNTTLCAAFAGCTAYFMTTRRGGSP-PDHLFNAVLGGCVAACATSSVTDSWAACVIGMVAGAIYLGGVRLMAFLEIDDPVHSVAVHLACGTWGGLSAGLFATADGIRSTYGIFYGGSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXRYFGRLRVPRHEEEIGLDVALHG.............. 444
305 2.000e-46UniRef50_A0A0V0R948 Ammonium transporter n=1 Tax=Pseudocohnilembus persalinus TaxID=266149 RepID=A0A0V0R948_PSEPJ  ali  26  5.............................EIPSVEPGLDTIWVAINTFLIMFMQLGFSFVEAGSVRKKNVHSILMKNTLDICIGTVTWWLFGYAFAFGESRSGFIGSSKDLYV------------------ANQIQSASGYVHWLNQWAFASTATTIISGAVAERLLIQGYQXXXXXXXXXXXXXXXXXX----XXNGWLMEQNFHDFAGTNAVHMVGGVAGLVATVIIGPRIGRFDKNFRPHSIKDIVLGTIVLWFCWYGFNCGTVQGFSEDIENASAQ--VGLVGINTTLGAIGGALVAFFAGVIINKHVDTVNICMGILAGLVAITGCCNVVEPWAALLTGMVGSLVYIGHSKLLVKLKIDDPLDASSIHFACGVWGGIATGLFQFENGLIY--------GGDRIGIQLLGILCICAWTGGLTAIIALIMKKIGWLRCSAEIEEIGFD................... 424
306 2.000e-46UniRef50_A0A1Q6VF35 Ammonium transporter (Fragment) n=2 Tax=unclassified Gemmatimonadetes TaxID=234665 RepID=A0A1Q6VF35_9BACT  ali  57  40.............................................................GGLVRPKNALNTMMMSMVALGLISVQWVLVGYSIGFGHGTPWWGGLGWVGFRGVGLD-------PDPA----YAATIPLQAHXXXXXXXXXXXXXXXXXXXXERMHFRAYVVFILLWATLVYDPLAHWVWGAGGWL---QKLGALDFAGGTVVHISAGVSALVAARMLGPRKDFKRAPIVPHNXXXXXXXX---------XXXXXXXXXXXXGSALAANGLAALAFTNTNTAAAAALVTWVCLDLARGGKATAVGAATGLVVGLVGITXXXXXXXXXXXXXXXXXXXXXXXXXXQIRATTRLDDSLDVF.................................................................................................... 325
307 3.000e-46UniRef50_A0A1H7W155 Ammonium transporter n=716 Tax=root TaxID=1 RepID=A0A1H7W155_STIAU  ali  45  30................................GPINAADTAWILTATALVLLMTPGLSFFYGGMVRLKNVVSTXXXXXXXXXXXXXXXXXXXXSLCFGDSFHGLIGDPRTFFM---------FSGVGGETHPDLAPTIPLMLFALFQLKFAIITPALITGAFAERVRFKAYVLFMVLFSLFIYAPLAHWTWHPEGFLR---KWGVLDFAGGTVVHMSAGFAALAGALVLGRRKVHENTPHTPANLPFVLLGTGMLWFGWFGFNAG---------SALSASSLATLAFATTNTASASAMLTWMAFDWMRGRKPNALGACXXXXXXXXXXXXXXXXXXXXQSILVGFVASVVSNAAAHFKSRTALDDTLDVFPCHGLGGVVGMVLTGVLAKDVGLITGKTDT-------FLMHLLALGIVTVFSFAGSYLLYKVVNLIVPLRVTQAQEEEGLDLSQHGET............ 428
308 3.000e-46UniRef50_UPI000C6E80BF putative ammonium transporter 3 isoform X1 n=2 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6E80BF  ali  28  15...............................NERNDANDVVFILTSAFLIFTMQSGYALLESGIVSRKNEVNILIKNATNLLIGGFAYWIFGFSLSFGDG-----------------LKTIWFATGRFFTQASLQDMGVLYSKFVFHLGYCTTSTTLVSGSMAERCKFTAYCLVSFLNIFIYCIPAGWM----WREDGFLAVLGAVDIGGSGIVHLVGGCSGLVAAIILGPRVGRYDQGFEPGNPTNALLGLFMLWWGWLGFNSGSTFGIMENKWKY-----SSRAAVTTILASTGGGMVGMCFSFFKKGLHDVSILMDSVMGSMVAISGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDDPTNTFAVHGVGGLWGMIAIGLFPERDYTRNLSGLFVGGGCKLLIIQILASGCLICWSLLVSTIFLLLINVTIGLRMTIEEEIMGPDYVDHN.............. 421
309 3.000e-46UniRef50_P58905 Ammonium transporter 1 member 1 n=190 Tax=Streptophyta TaxID=35493 RepID=AMT11_SOLLC  ali  27  17..........TNAVAAASYICNQFSGVSDRFVDTGYAIDSTYLLFSAYLVFSMQLGFAMLLAGSVR--NTMNIMLTNVLDAAAGGLFYYLFGFAFALGGPSNGFIGRHFFGLKEIPSNSF-------------------DYMNFLYQWAFAIAAAGITSGSIAERTQFVAYLIYSSFLTGFVYPVVSHWFWTPDGWASPTNSNGVIDFAGSGVVHMVGGIAGFYGALIEGPRIGRYDHTGRGHSASLVVLGTFLLWFGWYGFNPGSFNKIGASGGYYGQWSAVGRTAVTTTLAGCTAALTTLFGKRILSGHWNVTDVCNGLLGGFAAITAGCSVVEPXXXXXXXXXXXXXXXXXXXXXEKFKYDDPLEAAQLHGGCGAWGIIFTGLFAKGEFVDQVYPGFMGGGGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFKLLRISSEDEMAGMDLTRHGGFAYYHEED..... 472
310 3.000e-46UniRef50_A0A146GBE7 Ammonium transporter n=2 Tax=Spartobacteria TaxID=134549 RepID=A0A146GBE7_9BACT  ali  30  1..................................MDATNLLWVFACSALVMCMQIGFCMLESGLVRSKNTINVALKNXXXXXXXXXX-------------------XXXXXXXXXXXXXXXXXXTTGFFFSPAEHASNTQNAFFLFQMMFCATAATIVSGAVAERMRFGXXXXXXXXXXXXXXXXXXXXXXNP---SGWLKQLGFVDFAGSTVVHSMGGWMALAAAMVIGPRLGRFDSKLPPHSLVTSTVGVLVLFVAWLGFNGG---------STLALDHRVGMIIVNTVLAGCAGCLSAMGAVWYFQKLPLLPETLNGCVAGLVAVTAGCHAVSPGEAVFIGAVGGIISYFAVHLLDHWKIDDVVGASAAHAIPGVWGTLAVALFGDLAALGTGLN-----RSQQLGVQCXXXXXXXXXXXXXXXXXXXXXNRLVPLRINEEGERIGLNVAEHG.............. 389
311 3.000e-46UniRef50_A0A0J1FCP7 Ammonium transporter n=32 Tax=Firmicutes TaxID=1239 RepID=A0A0J1FCP7_9FIRM  ali  53  62..............................................................GMVRKKNVLSTMMHSLVVMGLISLQWVLFGYSLAFGPDHGGIIGGLNWL----------GLTGVGSAPNPMXXXXXXXXXXXXXXXXXXXXXXXXXXGSVAERMKFPAFVAFIFLWALLVYDPLAHWVWGNGGFLR---NLGALDFAGGTVVHISSGFSGLVAALVLGKRQGYGKEPMAPHHIPMTILGAGLLWFGWFGFNSG---------SALAANGLAGMAFVTTNTSAAAAALAWITVERLHRGKPTVLGAASGAVTGLVAITPAAGFVSPLSSIFIGFMGGIISYFAVSLKERLGYDDALDAFGCHGIGGTWGALATGIFASKAINPAGANGLLYGDPRQLGXXXXXXXXXXXXXXXXXXXXLKAIALFTTLRVNFEEEDTGLDLSLHGEEAYPDFISGS... 445
312 3.000e-46UniRef50_UPI000A2A5563 putative ammonium transporter 1 isoform X2 n=2 Tax=Exaiptasia pallida TaxID=1720309 RepID=UPI000A2A5563  ali  26  38............................................................EAGSVRSKNTTNILLKNVLDVFIGGLSFWLFGYAFLYGEKSNSFIGYSNFALAHA-----------------------TTYAHWFFQFVFAATSSTIVSGAMAERTEFSSYMMYSVCLTGFIYPVAAHWAWNPNGWLNVTHTVTFMDFAGSSVVHLLGGSCALVGAALVGARIGRFDENGNPVIQGHTVPMSALGGFILFFGFFAFNGGSQGSIASKGDAEIVALAIVNTIISGGGGALTAMAVKRMGFKKWSLLITINGGLTGMVAICAGANVYQPYXXXXXXXXXXXXXXXXXXXXXKLKIDDPVDAVAVHLGGGFWGTLAAPLMAYDVG---IFYKWDRHAFVQFGWNXGGMLSIMVWAMGCAFIMFGAMRLAKQLRVDPEIEEKGLDIYKHGEPAYPQASYGD... 430
313 3.000e-46UniRef50_A0A2R5GCT6 Ammonium transporter n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5GCT6_9STRA  ali  30  17...............................NDLAGDLNVFFTLWATSCVFFMHAGFAMLSAGAVRTKSTTNILICVVMDCCACAFAWWLMGWALAYGEDKGSFIGT--------------------TQFVGMELGESVSYIDWLFQFAFAATAATIVSGAVAERATFESYLTYSFYLSAIIYPVVVHWVWGGGFLTNAVAGVGALDFAGCGPVHMVGGVAGAVGSYLIGPRLGRFDSDGKPHSTPLATLGTFILWMGWLGFNPG------SVLALVGNSNLAARAAVNTILSSATGGLSSLLFSTYINREWDINGALNGVLAGLVSITGGCPVVTPWGSLIIGLFGGIVYQLGSKFLLIMKLDDPLDAVAVHAITGMYGLIVVGFFAKTEFVQELAGFFYGGNGKLLGCQXXXXXXXXXXXXXXXXXXXXXXXRFNWLRISARAEEIGIDNSSHGGHAYPDFFPD.... 449
314 3.000e-46UniRef50_A0A2R5FZ34 Ammonium transporter n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5FZ34_9STRA  ali  26  8....................TTSLEDEHTIYTELREPGDTAWLISCGTLVLTMQGGFALLESGSVRLNNTVNILVKNTFDLLLGGVAYWSLGWGLAYGKSWGGFIGTSDFFPDKDLDHTM-----------------------WFFQLSFAATASTIDSGACAERMRLFVYFGLSFFMTLFTYPVVCHWVWHSEGWLY---TMGYVDLAGVSVVHLLGGGSALVCSLMLGPRMGKLGYPIPAGEPVHVLFGSMLLFFGWFGFNAGSTLGLTNGG-----HVAAGRVVFTTMIGASFGGCVGSIVGYARSKILKPGTIACAVLAGLVAVTGGAHVMTGTEAAFSGALGSAFAILSIDVLQKLKIDDAVGVLPVHFVAAFVGNFCTGLFAHNNGGLTLEGPFYGGGFKLVAVQLLGSIVICAWSIFLTYAYLKLLLLSGEIRVNPLEEMVGLDVIEH............... 448
315 3.000e-46UniRef50_O26757 Putative ammonium transporter MTH_661 n=54 Tax=cellular organisms TaxID=131567 RepID=Y661_METTH  ali  51  91....................................................................................................................................KYAPTIPEGLFAIFQMTFAAITVALISGAVVERIKXXXXXXXXXXXXXXXXXXXXXXXXXXX----XXQNLGVHDFAGGIVVHITSGIAALALALVTGPRY---DQKLMPHHLGYSVIGTGLLWFGWFGFNAGSALS-----AGSLAAN----AMIVTNTSAAAGMIGWILMDRLKTGKPTLLGALSGAVAGLASITPAAGFVDGXXXXXXXXXXXXXXXXXXXXKPAAGYDDALDVFGIHGVSGIIGTLGVGLFAVPALNSLTSGGLLTGSTSLLVSQXXXXXXXXXXXXXXXXXXXXXXXKFKGLRVEREEEIQGLDINLHEETGYR......... 405
316 4.000e-46UniRef50_A0A0K0FWR5 Ammonium transporter n=9 Tax=Chromadorea TaxID=119089 RepID=A0A0K0FWR5_9BILA  ali  29  27......................................DGVWLISCSFTIFTMTSGFGLLESGRVSSKDEVNIMVKNVIDVVFGGLSYWCFGFGFTFGDWPNPIIGLGKFFYD--------------PEDDYEPSHQAWSYATFFFQMSFATTTSTIVSAAMAERIRLRPYIIVTFFM-TIIHSISAHWVWSEHGFL---KKLGVVDSAGCSVVHLAGGVAGLVSTIYLKPRVGRFGEKHSMSNPTNALLGTFMLWWGWLGFNTGSAYGIANGKWRLAARSAMV-----TILSSIGGGCTALIVSLLTTKKCEVDLLIDGLLASLVSTTASCLCVRPMQSLLIGSIGSALAISSYPLIEKFEIDDPVGVIPVHVIGSTWGMICVGIFAQDDRFGGQSGLLYNGGIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTLGVRLSKYEEQLGADLVEHG.............. 430
317 4.000e-46UniRef50_A0A2C9D0C9 Bacteriophytochrome cph2 n=2 Tax=Hartmannibacter diazotrophicus TaxID=1482074 RepID=A0A2C9D0C9_9RHIZ  ali  26  57............................................................EAGMVRSKNSINVAQKNLLDFLFAVTAFWFAGFMIGFGPSGSLPFGMEPRYLLLNTIDSNEAA-------------------FFVFQVMFCGTAATIVSGAVAERMRLMAYVIGSCVLSLLIYPLFLHWAWGGPASAAFLGNAGFVDFAGSTVVHATGGWVSLAACLVIGARRGRFGADGTPHNPVLAITGGFFLYIGWIGFNGGSTLH---------AGASVAPIILNTILAGAVGGIAGYVQSHLSDGCILPEKPLNGMLGGLVAITAGCHXXXXXXXXXXXXXXXXXXXXANDVLEKLHIDDAVGAIGVHGFAGVAGTLGLAVLAPAGNLPTGD------WLAQLQVQALGAGVNFCWTFAAGYVLFWALKRFSILRVDAEEERIGLNMAEHG.............. 427
318 4.000e-46UniRef50_M0T2L3 Ammonium transporter n=12 Tax=Embryophyta TaxID=3193 RepID=M0T2L3_MUSAM  ali  34  7...............................TSVTESINAVYLLFSAYLVFVMQLGFAMLCAGSVRAKNALNVMLTNVVDAVVGTVSYYLFGFAFAFGGSNPFIGTS--------------------FFALHHVPNDSYDYAYFLYQWAFAIAVAGITSGSIAERTQFSAYLVYSSLLTGFVYPVVAHWVWSSEGWLGLLFGSGAIDFAGSGVVHLVGGIAGLWGAVIEGPRVGRFDAFGKPHNATLVVLGTFLLWFGWFGFNPGSYARILVPYPDAGNWTGVGRTAVTTALAGSTAGLVTLFGRRLLAGHWDALDVCNGLLGGFVAITSGCXXXXXXXXXXXXXXXXXXXXXXXXXALKLRFDDPLEAAPLHGGCGAWGLIFTGLFAKEXXXXXXXXXXXXXXXX------------------XXXXXXXXXHKLHLLRISVDEELAGLDISSHGGYAYVAHPEEHH.. 420
319 4.000e-46UniRef50_A0A126Z735 Ammonium transporter n=1 Tax=Frondihabitans sp. PAMC 28766 TaxID=1795630 RepID=A0A126Z735_9MICO  ali  50  117...............................................................................................................................................................GAFAEKMTFRGYVLFTGLWSIAVYVPLAHWEWG-GGFLGAKG-LGALDFAGGAVIHESAGAAALAAAIYFG-RRTKP--VTRPYNTPMVLFGAGILWFGWFGFNGGSALTAG---------HVAVTAVVNTQLGASAGLIVWMIIDWIRHRKPSGIGIATGAIAXXXXXXXXXXXXXXXXXXXXXATAGLLCHLAVRLKKRLHYDDVLDVVGVHMVGGFVGVLLTGIFASLAINAAGAAGGWE----QLGKQXXXXXXXXXXXXXXXXXXXXXXDHLVGLRVTDAEAAEGLDLSQ................ 393
320 4.000e-46UniRef50_R1FVV1 Uncharacterized protein n=1 Tax=Emiliania huxleyi TaxID=2903 RepID=R1FVV1_EMIHU  ali  48  132..................................................................................................................................................QGMFAAITP-----------------LLTLL----VYYPLCHWVWG-GGWLAR---LGVCDFAGGIVIHTSAGVASLVTALRLGPRVGFAGLASAPHNLPMAATGAGLLWVGWFAFNGGSALAVGS---------LAASALLSTHVAGAGGALVWLALDWGHAGRPTFVGCINGALSGLAGVTPASGYVTPSAGLVVGL-------------EYLRIDDALDVTSIHGVTGVVGSLLLGVYASSEVNPAGPDGSLD----QLRLQALGVAVAIAWSGAGTWL---------------AEELDGLDRSQHAESSY.......... 382
321 5.000e-46UniRef50_UPI000C792A1F putative ammonium transporter 3 n=1 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C792A1F  ali  28  23......................DTSIPVDDPLEGWYHDDAVWQITASMIIFNMQTGFGMLESGCVSLKNEVNIMMKNVCDVILGGVTYWAFGYGLSYGESTG----------------TSWFTAMGSWFLDESGPMQGPTFTVFLFQMSFATTATTIVSGAIAERCDFNAYCLFSLVNTVVYCVPAGWL----WGNHGFLKNLGVVDIAGSGGVHLVGGTSAFVAAWLLGPRLGRWDTAPPMGSPTNAVIGLFMLWWGWLSFNAGSTFGISGNKWRLSAK-----ACVTTLLASFSGGFTAMVQSYFCDKKQDVLTIVNGILGGLVGVTASCAVVDVFEALFIGVVGSFLANITPLLLTWLKVDDAVGATCVHGFGGAWGMIAVGLFARKDVVSIGYGIIWHGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVCPIRMAEHMELLGADYCEH............... 437
322 5.000e-46UniRef50_M2S634 Ammonium transporter n=112 Tax=leotiomyceta TaxID=716546 RepID=M2S634_COCSN  ali  31  17.................NTTPTGGNPLTTDLNAPYDKGDLCWMLVSTVLCWQITPAIGFLYAGMHRRKAAMTMIFQSLFCACAAGIQFWVYGYSLYQSHTSGPFIG-----------DLSKAGLHTVLGYPSLANADIPDILYACFGFTFVTATAMILAGAMLERGRLGPSMIFLLCWTTFVYYILAYAEWNPSGWLY---QLGVLDFAGSGPVHIASGFSALAWAIMLGPRVDPHKESLH--ARIPHFRPHSXXXXXXXXXXXXXXXXXXXXXSTANLSIRSIYIVCNTNLAASGGGLAWVALEYLFTRKFSIIGFCSGIISGLVGITPACGFVPIETAALVGALTSCASFFTVKYKHLLRVDEGLDIFAIHGMGGFVGDILTGFFASKSVSNAYEGGWWNHNWKQMGYQXXXXXXXXXXXXXXXXXXXXXXNKIPGIRATEEEELRGLD................... 442
323 5.000e-46UniRef50_A0A0V0QIC1 Ammonium transporter AmtB-like domain n=1 Tax=Pseudocohnilembus persalinus TaxID=266149 RepID=A0A0V0QIC1_PSEPJ  ali  25  5...............................EDYLIGINAAWKLNNTFIIFMMQLGFALMECGAVRGKHINSVLLKNLADVLVGGLVFWCYGYAIAYGESAGGIVGF------------TREYSGLAWKQTQSEEKQVVFFIHWINQWTIACTCTTIVSGSVAERMKISAYIIYSFVIQTFIYPVAVHWVWNEYGWLH---KMGFKDFSGVCVVHMIGGLCGGIATTIIKPRHHRFMKNFQPNNVPFIVIGTLFIWFAWFGFNCGTIVNITKQENIKTIGLVA----LNTILSASTGALTCVLWTSYQDSKVYNTRVSMGILSGLVSITGTCNNIEPLLSLIVGAIGATNYLCLSKKLVDLEIDDPLDACPVHFGCGLWGTIATGIFNND--------GIVGGDFKLFSIQLLGIICIVCYTSFIALICLLPLSYLKAIRITQEE......................... 417
324 5.000e-46UniRef50_R7UG21 Ammonium transporter n=3 Tax=Lophotrochozoa TaxID=1206795 RepID=R7UG21_CAPTE  ali  29  5......................................DASWVLTSAVIIFTMQTGFGVLESGCVHPKNEVNIMVKNALDVVFGGISFWVFGFGLSFGSDQG----------------TNAFTGVGCFFVDAADEVFGDVFAVFLFQLSFATTSTTIVSGAMAERVKLHAYLAFCIV-NTFTFSIVAHWVWSETGFLH---TMGAIDAAGCGPVHLVGGVTGLVATIILKPRSGTFDRPKKPPSPLKALLGMFMLWWGWLRFCSGSIFIVSTDEQWKSAVRAAVNTMVSSMGGGITGVM--ILSRFCQRVKYDVSTIINGIMGSLVSITAICTLCKAWESLIIGIVGALIATATDSLLWKLKIDDPVGVVPVHGACSVWGLIAVGLFVDKNGTLTLRGGLLNGDPHQXXXXXXXXXXXXXXXXXXXXTLLKILDCTLGLRFEEGDEKIGADVIEHGVS............ 405
325 5.000e-46UniRef50_UPI000C07FEFD ammonium transporter n=1 Tax=Corynebacterium sp. Marseille-P4122 TaxID=2014528 RepID=UPI000C07FEFD  ali  41  83..........................................................................................................FEFFGLNAITDEAGNYIAGA-----AGYANVID----ICFQVTFAAIAVAIISGSLANRVKFKTWLLFTALWVTFAYFPMAHMVWG-GGLLSMFGAIAPIDFAGGTVVHINAGIAGLILALIIGHSRGFMEEETKPHNMPLVMLGAALLWFGWFGFNGGSAFAA---------DGLAGLAWINTTAAACAAMLGWLLVERVRDHRSTSLGAASGVVAGLVTITPAAGTFTPXXXXXXXXXXXXXXXXXXXXKFRFRFDDSLDVVGLHLVAGLWGTIACGLFAKGLFTGGGSDG-----FKXXXXXXXXXXXXXXXXXXXXXXXXXXXKYTMGWRIKGIHEEAGIDSALHRETAYHYE....... 437
326 6.000e-46UniRef50_A0A2E7TQE1 Ammonium transporter n=3 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E7TQE1_9FLAO  ali  41  48................................DSYNPADTAWVLTSACLVLLMTPGLSFFYGGMVGKKNIISTMLQXXXXXXXXXXXXXXXXXXXXXXXXXXSFIVTHSLLGNPFSYSFFEFIEEFGSSPHKQMASTIPFVLFAIFQMKFAIITPAIITGSFAERVRXXXXXXXXXXXXXXXXXXXXXXXXHPDGMLNTYF--GVKDFAGGTVVHMSAGFAALAGAMILGKRKNK---EHTPTNIPFVILGTGMLWFGWFGFNAGSAFGVNG---------DAVLAFITTNSSSATAMLTWIFFDRINGRKVSALGACIGAVVGLVAITPAAGYVSVPEAIFFGFITSIVSNSVVNWNKMQRLDDTLDVFACHGVGGIMGMILTAIFAHGEGASLLHGGEGNLGWGIFGHHMIALVLVSVFTFGGSWLLYKLTDMIIPLRVSEASEDIGLDLSQHDEQMDPY........ 471
327 6.000e-46UniRef50_A0A164BRS7 Ammonium transporter n=25 Tax=Bacteria TaxID=2 RepID=A0A164BRS7_9SYNE  ali  49  5...RLRRFLIALLVVPAFQLLSSALLPAYAGDASLSSADNTLILTSAALVLLMTPGLAFFYGGFVQARNVLNTXXXXXXXXXXXXXX----------XXXXXXXXXXSDGGALNAVIGNPFSFAMLENVPDIWPGLAIPGLSFALFQGMFAIITPALISGALVERISFRFWCVFTPVWLLVVYAPLAHMVWGGGCLG------KDLDFAGGTVVHISSGVSALLLAGLVGWRKQWPNSVRPPHDVTQILLGTGLLWFGWFGFNGGSQLSVSG----------AELPFTTTHISAATGLVAWSLIETWRDGKPTAVGMATGAVAGLVGITPAAGFVTPAAGMAIGAITGLLCYCSVQLKVSLRFDDSLDTFAVHGVGGTVGAILTGVFASTELIATHPAAQVFGRFGLIADQXXXXXXXXXXXXXXXXXXXXXXRGLGPFRVTEDAENLGVDVREHGEEAYPE........ 441
328 6.000e-46UniRef50_A0A2J6X5S9 Ammonium transporter n=1 Tax=Caldisericum exile TaxID=693075 RepID=A0A2J6X5S9_9BACT  ali  46  30..............................................................GMVRRTSVLTIMLQSFASMGIVTTLWFLYGFSLAFGTDFHIIGGFNYLLLQNV------FMAGPNP----HYGGTIPLYAYFAFQEMFAVITPALITGAFADRVKFKSYXXXXXXXXXXXXXXXXXXX-XGGGFLQQ---IGFVDFAGGAVVHTTAGMAALASILMVGSRKFKIDE---PHNITYVALGTGLLWFGWFGFNAGSALAANTLAANAFIN---------TDIAASVALVTWLIFSWSIRKQPSIMGALTGSVAGLAAVTPVAGYVGTKFQIING.............................................................................................................................. 286
329 6.000e-46UniRef50_I4BB79 Ammonium transporter n=31 Tax=Bacteria TaxID=2 RepID=I4BB79_TURPD  ali  51  169.........................................................................................................................................ISNNVFSMFQMMFAIITPALIVGAVAERMKXXXXXXXXXXXXXXXXXXXXXXXXXPAGYMNGLGNIKAIDFAGGTVVHMSSGWSALVLCLILGKRTGFGAKAFTPHSLVMTAIGTGMLWVGWYGFNAGSALAA---------DGIAANAFTTTTLAAAVAAFVWPMLEWLVKGHPTVLGFCSGAVSGLVVITPGAGFVDXXXXXXXXXXXXXXXXXXXXXKNWLKYDDALDTFGVHGVGGTLGAILTAFFASKDVNGALAPLIEKGLVSAHXXXXXXXXXXXXXXXXXXXXXXKL---TIGLKASAEKESLGLDISEHGEEGYS......... 485
330 7.000e-46UniRef50_G0VRF5 Nitrogen regulatory protein P-II n=93 Tax=Bacteria TaxID=2 RepID=G0VRF5_MEGEL  ali  35  60............................................................ETGLTRAKNAGNIVMKNFMDFALGTVFFWFLGFGLMFGTDFHGIIGIPDPFVQNFHVADDAGF---------------PDMAFLIFQTVFCATSATIVSGAMAERTKFSVYCIYSVLISLLIYPISGHWIWGGGWLQ----ELGFHDFAGSTCVHMVGGVCALVGAWILGPRIGKYNKDGPGHSLPLACLGMFILWFGWFGFNGCSTVSMTGDETLV----SASMIFVTTNMAAAAGACTAMIVTWIHYGKPDVSMTLNGGLAGLVAITAGCDXXXXXXXXXXXXXXXXXXXXXXXXXDKLKIDDPVGAVAAHGGCGALGTILTGLFSVKD------GLLYTGETHXXXXXXXXXXXXXXXXXXXXNIVFRILNATMGLRVTAEEEINGLDLEEHGISAYAGFMITPD.. 445
331 7.000e-46UniRef50_A0A1Y1HKX8 Probable ammonium transporter n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1HKX8_KLENI  ali  24  4......ATNVTALALRVATLEVGLQELAATSTLRTLVAGHLWTLQAGIFVFLMQVGFALVEAGTVRTKNTRNIMIKNILDACISAVAFWSFGYALAYGTGNKVLGWRH------------------PDGSSSAAFFNERDKVRWFYKWTYAATTATIVNGAVAERTKFPAYLVYSFLLSGFIYPVVVHLMWSADGLLSPYTYHGYIDLAGATIVHVTGGLTSFLGAWMVGPRIGRFDIDGKPHSIAFIATGTLILWVGFYGFNGGSVYISDDLQLWL---DTIARIMMNATVSAAFSGLTVFAVSLMASRAVQPSDTFNGVIGGLVAASATASVTQTWAACIVGFLSGLAYFGGSRLFLWLHIDDPVNAAAVHLCCGCVGGLAVGLFATNDGIRAAYGLVYGGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLRSSRQAEEVGLDVAYHGGT............ 453
332 7.000e-46UniRef50_A0A2E5WX14 Uncharacterized protein n=2 Tax=Halobacteriovoraceae bacterium TaxID=2026745 RepID=A0A2E5WX14_9PROT  ali  36  70..................................................................................................................................LLKYSEAVASGPYFLFQYLFCFISVLVLWGSTLERVTMKFYGVFTFLWLLLVYCPVSRWLLNKEGWLREFG---VIDFAGGFTVHVTSGFSALILANCIGRRVDYRNKFSQP----LIFFGSFLIWIGWFGFNAGSSIAFNDSTVVAF-----ENTFVAGLVSLG----VWCLIDYIHTNRVTLTGISLGLVSGLVAITPAAGLVDVNDSIFIGLLSGVFCNYASRYMHKVKVDDTVDVFPTHGIGGVVGALATGYL----VLKGGANSYFYPNL------VACLVVAFYSMTV-TWVLVKLLRLVMEARVSRKDEEDGSDIRIFGENIVN......... 378
333 8.000e-46UniRef50_A0A2P6U541 Ammonium transporter n=4 Tax=Chlorophyta TaxID=3041 RepID=A0A2P6U541_CHLSO  ali  27  1..........................................MLLCAFQVFFMQSGFAMLEAGTIRMKNMKNIMLKNVIDACVSTVAWWALGYAFAIGE-------------------CGESAFIGYHNFFASSPSSATYWASWMFGWAFSATSATIISGAMAERARFRAYLVYTCAISAFVYPVVAHWVWSESGWLSARNTMGTMDFAGSGVVHMVGGGAALVGAVLLGPRLGRFNQDGHNASAAHMALGVFILWLGWYGFNAGSTQCFYGC------MLVAASIAVNTTLAAGAGGLTCLFLSVFFGAPGDIGPLLNGILAGAVSITAGCXXXXXXXXXXXXXXXXXXXXXXSKLLQRLRIDDPVDAAPVHFFCGAWGVLAVGFFATETFTKAAYGVFYGGSGRQLGMQLLGLVCIAAWTCALSFLLFWSLRKAGWLRVDKESEQQGLDIAQ................ 417
334 9.000e-46UniRef50_F7JVA1 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=F7JVA1_9FIRM  ali  51  3....................................SGDTGFIMLCSALVFLMTPGLAFFYGGLVRRKNVVNXXXXXXXXXXXXXXXXXXXXXXXXXGGNHAIIGDFRYFAFQGVG---------ADPG---PYADTIPHLVFAGFQMMFAVITPALITGAVVGRMRFKALXXXXXXXXXXXXXXXXXXXXGEDGFLA---ALGSVDFAGGN