current user: public

If you have questions about the server, please let us know.

Query: [E] COG0010 Arginase/agmatinase/formimionoglutamate hydrolase, arginase family, from COG1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .
# E-value Template Links and tools%idFirst MYNTLNNKEDISLVSNNFGFLRLPVHFNPVETDAEWVITGVPFDASVSGRAGTRFGAEAIRRASVNLAWEHCRFPWDFDVRERLKIVDCGDLVYSFGDNQNFVEELEAHATALLKAGKRCLTFGGDHFITLPLLRAHAKHFGKLAMIHFDAHTDTYENGSRYDHGTMFYHAPNEGLIDAAHSVQIGIRTEFDRNLPFTVLSAPQVNEESVAQTVAKIKEVIGDLPVYLTFDIDCLDPAYAPGTGTPVCGGLSTDRALKILRALKDVNIVGMDLVEVSPAYDQSDITALAGATLALEMLYMQGAKKGLast
1 0.000e+00UniRef50_A0A2G1XN31 Agmatinase n=1 Tax=Streptomyces cinnamoneus TaxID=53446 RepID=A0A2G1XN31_STRCJ  ali  29  36...........PAYSGMPTFMGVPLALNQDDLRADAAVVGCPVDVSTGHR-GAAYGPRAIRSDERYMEAY-IHSATRVNPFNVLKVVDYGDAAVDPFDITRSMEPIRGLVREIAEVGAAPIVLGGDHSLLWPSVGALSEVHGRIAVVHFDAHPDCHDEGHKATHTTPIRRLMHDEMVPGANIIQVGLRTAWMRRAGMKSHFMAEIERVGLAAVVDKVIEEAKADHVYISLDIDVLDPAFAPGTGTPEPAGLNTRELFTALRRIAETNLVGMDVVEVAPHLDPGYSTAMNARRAVFEVLTGLAMNK. 350
2 0.000e+00UniRef50_U4KNG3 Putative agmatinase n=1 Tax=Acholeplasma palmae (strain ATCC 49389 / J233) TaxID=1318466 RepID=U4KNG3_ACHPJ  ali  31  16.............................NYEEADVVIYSVPMDATTSFRPGTRFAGNAIRVDSFGVEWYSPYRDRDL---KNYKTVDTGDLDLPIGAVEDALNIVYDATKTILEDNKVPMMIGGEHLVTYPVLKAVKEKYDNLHVIHLDAHTDLREEFFGLSHATFMRQAHK--FLGDHKIFQFGIRSGDKHEFEWAKKHIHQFDFTGLDKVVEQLKDV----PVYITIDLDVLDPAVFPGTGTPEAGGMQYKELLWAIDQFEKLNIVGADIVELAPMLDPSGASTAVACKTLREMVLLLHKN.. 286
3 0.000e+00UniRef50_F6FR47 Agmatinase n=4 Tax=Actinobacteria TaxID=201174 RepID=F6FR47_ISOV2  ali  29  50..REPGLFHVNRRFSGIRTFAKLPMALTPEDLRADVAVLGVPWDSTAGGRSGTNHGPLALRKAFGRYGFPSQHLDVRVDPFDALTMCDYGDAPIQVGNTAGTFEAIRKFVGTVVTSGAIPLIMGGDHAITWPCATAVADHYGKVGIVHFDAHADVGTDMHGSSHGTPIRKLIDSGAVPGKNFVQVGLRGYWPDEHQMRTHFMAEIDRDGFDTVLERAVDEALDDHLYISLDIDVCDPAFAPGTGTPVAGGITSIDILRAVRRLAEVGIVAMDVVEVSPPYDNNGITVLLANRAIGEAMTGIAMRR. 376
4 0.000e+00UniRef50_A0A1X4XZQ9 Agmatinase n=1 Tax=Desulfurella amilsii TaxID=1562698 RepID=A0A1X4XZQ9_9DELT  ali  30  4........................YCATSSYEKSNIVLVGVPYDGTSSFRPGSRFAPNAIRENSDGIESYSPYFDKDL---REKKICDMGDIPLPFGDKELVLDIVEKFSFKLIKNKKKLLSIGGEHLISFPLIKTFSKKYENLAVVHLDAHSDLIDSYEKLSHASVIRRISE--IVGFENVYQLGIRSLNITDLNLPYR-KDNLCLFNFDKVQDYV-DKISSKPVYLTIDLDVLDPSIFPGTGTPEPGGVTYKELIDCLKKISVLNIVGCDVVELSPQYDVSGVSSIVAASVVREVLCLL..... 275
5 0.000e+00UniRef50_A0A2C9SRP5 Agmatinase n=34 Tax=Actinobacteria TaxID=201174 RepID=A0A2C9SRP5_9MYCO  ali  29  5.............FGPDITFLGVPRCDLSDYAGADIVILGAPLDGGTNYRSGARFGPSALRQACYLQDGSRPSLALRVDGLKDLRVYDAGDVMLYSGNIEQAVAMITEEVYKISAAGAIPIILGGDHTIAWPDHTGVARQHGKVSMIHFDAHADTGDIHNGVGHGTPMRRLIESGALRGDRFLQLGLRGYWPDEHGLRSYEMTEIVARGLSTCLTEAIATADCEGVFLSVDIDVCDPGHAPGTGTPEPGGFSARELLDAVRRICELPVLGVDIVEVAPPYDHADITALLGNRVVLEVISAIARRR. 315
6 0.000e+00UniRef50_A0A2H0SIE7 Agmatinase n=8 Tax=Bacteria TaxID=2 RepID=A0A2H0SIE7_9BACT  ali  26  4................PYNFGGL---NNQSYKKAKVVVLPISLEKTVSYMPGTKFGPRAIINASRYIELFDIEMGRDL---SQIGIFTLPELLFAKKSLEESIKEIKQAALNLLKDKKFILSLGGEHTISYGLISAFKEKYKDFSVLQIDAHSDLRDEYEGFSHACVMRRVRDLGI----SVTGVGIRSQDETEIGYMKK--KKIKTIFYAPMIKKIISSLS-KNVYITFDVDGLDPSIMPSTGTPEPGGLGWYEVLSLIKQVAKRKIVGADIVELSPLKGIIFPD-FLAAKLAYKIIGY...... 278
7 0.000e+00UniRef50_A0A063BM53 Agmatinase n=3 Tax=leotiomyceta TaxID=716546 RepID=A0A063BM53_9HYPO  ali  35  41.............FNGIGSFAHLNHVKCLPSEKYDIAIVGVPFDTAVSFRPG-------------------FNARANINPYQWAKIIDCGDMPLTPFHNDVAREQMTQAFRALLSRGKKLVALGGDHSLALPALRSLKEIYGPARVLHFDAHLDTWEPATHFNHGSMFWMAHKEGLLSNAKSVHAGLRTRSDTSQNWVRFTADDIDVIGTKGIIDGIMLVLGTDPVYLSVDIDVLDPAFAPGTGTPEPGGWTMRELIRILRGIEGLNLVGADVVEVSPAYGRGEETALAAAQIVYEILSSMVKR.. 348
8 0.000e+00UniRef50_H5SQH2 Agmatinase n=3 Tax=Bacteria TaxID=2 RepID=H5SQH2_ACEAU  ali  28  1MHHEPDPQEEIPPYQVPQNFGGLAPEFSR-FSAARAVVLPVPYDLTTSYRAGTRHGPHAIIEASTHLELYDEELRDEPY---RVGIHTLPPLEPSAACPEETIQRVEEAISWLLEREKFPVMLGGEHSLTLAPVRALHKKFGNFSVLQLDAHSDLRDSFQGFNHACVGRRVHELGV----NLVQIGIRAISVEEAHYHVCFDYELHRRGGAEVLEQALTKLRD-PVYVTVDLDVFDPGLMPAVGTPEPGGLDWYTVLKILRHVGEKHVLGCDVVELCPIAGMVGPD-FLAAKLVYKMLGYFLHNK. 330
9 0.000e+00UniRef50_Q2U8I2 Uncharacterized protein n=13 Tax=Eukaryota TaxID=2759 RepID=Q2U8I2_ASPOR  ali  36  42.....VDIVTGSHFSGLTTFGHLPYVNCLVDDQADIAILGAPFDTGVTARPGARFGPVGIRLGSRRLQGWNIYTGVNV-FESWAKLVDCGDAPLTRLDNTVALKQLDLAHKVISDRGRTPLTLGGDHTTTLSALRSTYDKWGPVSVIHFDSHLDTWDPKSGVNHGTFLHIAHEEGLIRNTSL-HVGIRAPNDIRCGFEIIKARDLDRVGINGIVDQIKARVGDSKVYISVDIDVLDPAYAPATGTAEPGGFTTRELLSILDALHGLPVIGADVVEVAPIYD......................... 349
10 0.000e+00UniRef50_A0A1V2YIX2 Agmatinase n=1 Tax=Epulopiscium sp. Nuni2H_MBin001 TaxID=1884656 RepID=A0A1V2YIX2_9FIRM  ali  36  1MSYTGGYVEHPFHYSGISTFAGFANKRNLD--NVDLAIMGIPFDIGTTNRPGARLGPRAVRAVS-NLAFRSDYLWTSFNLKKACNIIDYGDVAVGAKATEFMIRESYKHAKLILNSGASLVSIGGDHTIPYGPIIAASEKYGPLALLHFDSHQDSIPSHGDYSHANFAYDLAHEGCIDPSKSAQVCIRTRM-ENCGYNIIYANKVIELGPVGLANVIKSIVGNMPVYLTFDIDALDPAYAPGTGTPVCGGPSTNLIKCTLRELEGINIVAADMVEVSPTYDANEITALAAASIMQDIVYLIAKNR. 306
11 0.000e+00UniRef50_A0A2J0KVA3 Agmatinase n=3 Tax=PVC group TaxID=1783257 RepID=A0A2J0KVA3_9BACT  ali  24  6..................NFAKIDEERYSNLKDSKVVIIPVPYDATATYKKGTKLGPAAIIDASRYMEQFDEELNKETY---KIGIHTAKPLNVKRLSPKKMTLKVQDAVKSVIEKDKFPVILGGEHSISVGAVRAIAKAVDHFSILHLDAHCDLRNEYSRYNHGCFARRVIEL-----APIVQVGIRSLSKEEKDFRIISAYDI--QNDKEWIKKACDTLS-ENVYVTIDADVFDPSVVPSVGTPEPGGIGWYDAINLFKMLKKRRVIGFDAMELCPQKG-GEASDFLMAKLIYRFLGYIFDNK. 289
12 0.000e+00UniRef50_UPI0003B75FCC agmatinase n=3 Tax=Rhizobiales TaxID=356 RepID=UPI0003B75FCC  ali  31  13...............GLTSFLRAPVVEDFSKIDADIALLGVPYDGGNGWRPGTRFGPREIRNLSVRYGAWGDQSGNGYRFLENIRMVDCGDVDIAFYDFERNSRLMTSSVEAILDQGAFPVIIGGDHSVTYPNVRAFSR-FKTIDIVHIDAHMDWRDNIDGVRHAMPMRRIKELPFI--RNMVHIGIRDIDAESAGAIVITRDEVRNEGVRGILNRFPEL---GNVFVSIDIDGLDPSIAPGTGSPTPDGLLYHEVRGLLEGVAATNVVGFDLVEVNPMVDEGGRTCLLSSVMIMEFLGMIFANR. 314
13 0.000e+00UniRef50_A0A1D2W6G1 Agmatinase n=4 Tax=Methanobacteriaceae TaxID=2159 RepID=A0A1D2W6G1_9EURY  ali  31  11............PYSGIPTFYKLQHTTNL--KNVDVALIGIPFDQGTTNRSGTRFGPRAVRIASQNYGIY-MHSDEGAYDLEDVTLIDYGDVPILPTSTATNMKMIYDTFKKVIESNVFPVGFGGDHSITFPILEAF---DVDFDIVHFDTHLDFTDNVSKFSHASPIKRASGLKTVN--NITQIGIRGFTDRKANYKIITASDVFKNGIQWTLGKIPE---TENIYVTLDIDALDISAVPGTGTPEPGGLNYLQMREILQNLPKGNIIGFDVVEVNPLYDAGNITSQVASRLALDLLGSIYSK.. 309
14 0.000e+00UniRef50_A0A1Y5R764 Proclavaminate amidinohydrolase n=1 Tax=Pseudoruegeria aquimaris TaxID=393663 RepID=A0A1Y5R764_9RHOB  ali  29  1MTQHGYDGRLNLPFTGITTFARTPYLEDWAGIDADAAILGAPFDGGTQYRPGARFGPRAVREASTLFTFGHYDHEDDVYLGKDVRIVDIGDADIIHTDTIASHRNIEAGVRAILDAGALPVVIGGDHSVNIPAINAF-DDFSDIHILQIDAHLDFVDERHGFGHGNPMRRAAEKPYVSG--MTQVGIRNVSARGIGSDILSVRQARRLGARGVIERIPQ---GAQVYVTLDIDAFCPSIAPGTGTPSHGGFLYYEVLEMLQHLSRRHVVGLDLVEVAPAYDPAGVTAILAAQILMNTLGFIFHAR. 316
15 0.000e+00UniRef50_A0A0A0ATK1 Uncharacterized protein (Fragment) n=18 Tax=Amniota TaxID=32524 RepID=A0A0A0ATK1_CHAVO  ali  42  5...........................................................................TGAAPFDSLQVADIGDVNVNLYNLPDSCRLIQESYRKIVASGCVPLTLGGDHTITYPILQAVAEKHGPVGLVHVDAHTDTGDLGEKIYHGTPFRRCVEEGLLDCSRVVQIGIRGSSCRDQGFRVVLAEECWSKSLVPLMAEVRKQMGDKPVYISFDIDGLDPAYAPGTGTPEIAGLTPAQALEIIRGCKGLNIVGCDLVEVAPMYDVSGNTALLAANLLFEMLCVL..... 240
16 0.000e+00UniRef50_E8T4C8 Agmatinase n=3 Tax=Desulfurobacteriaceae TaxID=558314 RepID=E8T4C8_THEA1  ali  33  8...............................EKGKIAVVGAPYDSTTCFRPGARFGPDGIRNFSHNLEEFSPALNK---TLEELQFCDLGNVELPAP-PEQMVEHLYSFVKEV----ELPVVLGGEHSVTYPVVKALKERYGSLTVIHFDAHADLRDEYSGYSHACVMRRVAELGC----TVYQVGIRSGAREEFLYRE-TSPFVFDVELSE-----LPTLFEEPVYITVDIDYFDPAYAPGTGTPEPGGASPLEFFTTLYKLPAVKLVGFDLVEVAPPYDPSGITQALGAKVVREVM........ 261
17 0.000e+00UniRef50_UPI00041583B9 agmatinase n=1 Tax=Thermodesulfatator atlanticus TaxID=501497 RepID=UPI00041583B9  ali  28  2................PMTFLGLP----ENPAKARVVFCPAPYDATTSYLPGTRFGPRRIIEASPYLEFYDEEKDCEV--YQKAPFLTLPEEEL-PVDPEKMLKTLKSRLDPYVNAGLFPVTLGGEHTVSLAPMALLKEKYGRLCVIQIDAHADLRNEYQGFSHACTMRRALELGI----ELYPIGIRAISREEKGLKIHWARELVSK-LSEVVNEILTRIGKRPVYVTIDLDGFDPAEVPGVGTPEPGGLKWYEGLFILQAVSSLNVVGFDVVELLPK---DDRSAYFAARLIYKFLSYLF.... 280
18 0.000e+00UniRef50_A0A1M4UJA8 Agmatinase n=2 Tax=Microbulbifer TaxID=48073 RepID=A0A1M4UJA8_9GAMM  ali  31  4.FNQPIDSSRFSRESQVATMMRNVLAGPEQYDELEIGLWGCPFDLGLGARNGVRMGPAAIREASRYIRKVNPTTA--INPYKLANIADIGDPEMNMMIQSQALEDIERFVAEFTGKGIVPICAGGDHTIPLPILRGMKKGGGGISVLHIDAHADTLDGDEKICNATPFRRAVEEGLIDPTKSIQIGLRGTRFAELGYNVITMDEYEEMGRAGVIDRIKRAIGDNPCYITIDVDGLDPICCPGTGAPEPGGIMMRDMQMILRNIRQLDVIGGDVCEVMPHRDPTGMTQLNAANLIFEITCLIARKKG 323
19 0.000e+00UniRef50_UPI0009B81926 agmatinase n=1 Tax=Agrobacterium rhizogenes TaxID=359 RepID=UPI0009B81926  ali  34  309............PFAGIPTFLDAPCRPDPDFGGIDIALLGVPMDLGVTNRNGSRFGPRAVRTI-ERIGPYDHVLKC--APFSMAQIADIGDVPMSRFDLALCHQDIETFYKRLVGAGVRPLSVGGDHSISASILKAVGEK-RPVGMIHIDAHCDTAGPYEGFQHGGPFRLAVLDGVLDPERTIQIGIRGGFSYDSGMTMIHAEEVADVGMAAVIEKARQIVGDGPTYLSFDIDSVDPGFAPGTGTPEVGGLLPADVLRLLRGLQGINFVGGDVVEVAPQYDTTTNTAQIAAQVMFTILCLMVSGK. 610
20 0.000e+00UniRef50_A0A1L7WKX7 Probable agmatinase n=8 Tax=leotiomyceta TaxID=716546 RepID=A0A1L7WKX7_9HELO  ali  34  62.....DDFDGDGILQGINTFAHLDFVECMKPESSDIGIVGHPFDLGVSYRPGARFGPNGARQGARRMSPRGWDMDHNLNPYQWAKIVDCGDIANTPFDKLVAVHELEKGMQAINDRKPRLITIGGDHTISLPILRALHSTWGRVAVLHFDSHLDTWDPYSEVNHGTMLHIAHEEGLLSNNSNMHLGSRCTLFDEHGFSYIRARELDKLGVDKVVKKIVERVGDEYVYLSVDIDVLDPAFAPATGTIEPGGWTTRELLQIINGLAGLKIIGSDVVEFTPIYDNAETTGIALAQIVYEIIQWMV.... 409
21 0.000e+00UniRef50_A0A2H5VUV3 N(1)-aminopropylagmatine ureohydrolase n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5VUV3_9BACT  ali  28  4............RYAPYLSFLGLPEELRPT-SGPKIGILPIPYDLTTSYQPGARRGPIAILEASTHLETYDEELEWDPSAF--LQLETLAPVVPDTSGPEATMERIYGVACEALKTHDFLVGLGGEHSVSFPLVRAVKEKHPHVGVLQLDAHSDLRFEGSPYNHACVMHRVLDLGV----PIAQVGIRSLTAEEHEVTTVFASEAAQRPVHDFLPKVLAALPDE-VYITVDLDAFDPAIMPATGTPEPGGLSWYRALEILREVAKKRIVGFDVVELAPFPGLVAPD-FLAAKLVYKLLAY...... 291
22 0.000e+00UniRef50_A0A2W7I6S0 Agmatinase n=2 Tax=Humitalea rosea TaxID=990373 RepID=A0A2W7I6S0_9PROT  ali  39  162........TTPPTFSLPPSFLG---VSRRDQAGA-FAVAGVPLDVGTTNRAGARDAPRAIRAASRML--VDGAHPVSWREPADMPIADLGDFAIALGDIPNTHKLIERQAGGI----QHLLALGGEHGITLPLLRALSKRGGPLGLVQFDAHPDTAPDNFGFGHGCFLFHAIEEGLVDPARCIQIGIRAPMQRERGVTILTAQQVHAMGPEAVAERARAVLGEVPAYLSFDIDALDPAFAPGTGTPEIGGLASWQAQAILRGLGGLDFRGMDVVEVSPAYDVAEITALAAATVVWEYLALLARRR. 462
23 0.000e+00UniRef50_P73270 Probable agmatinase 2 n=25 Tax=root TaxID=1 RepID=SPEB2_SYNY3  ali  29  54.....FSRGELPHYAGINTFMKAPYLEDREVGKYDVAIVGVPHDSGTTYRPGTRFGPQGIRRISALYTPYNFEM--GVDLREQISLCDVGDIFTIPANNEKSFDQISKGIAHIFSSGAFPIILGGDHSIGFPTVRGICRHLGDVGIIHFDRHVDTETDLDERMHTCPWFHATNMANAPAKNLVQLGIGGWVCRERATNILTVTDITEMSLDADFAIARATDGTDCVWISFDIDCIDAGFVPGTGWPEPGGLLPREALYLLRIIRETNVCGMEVVEVSPPYDISDMTSLMATRVICDTMAHLV.... 363
24 0.000e+00UniRef50_A0A2M8IZF1 Agmatinase n=8 Tax=root TaxID=1 RepID=A0A2M8IZF1_9RHOB  ali  29  3.THGYDSGRLNLPFVGICTFGKYPYQPDWDAIAADVAVMGAPFDGGTQWRAGARMGPRAIREASTLFAFYDFEDDITYLDPAQVSVVDIGDADIIHTDTAQSHANIELGVRRMLAAGALPVVLGGDHSVNIPCIRAFDDQA-PIHLVQIDAHLDFVDERHGVGHGNPMRRAAEQPHVTG--LTQIGIRNVSAREMGSDIQSVRQVRAMGTAALLERIPA---GMRYYLTVDIDAFDPSIAPGTGTPSHGGFLYYEVLELIDGLARRGIVGLDLVEVAPDYDPSGSTQILAAQLLLNTIG....... 311
25 0.000e+00UniRef50_UPI00099D6532 agmatinase n=1 Tax=Streptomyces TaxID=1883 RepID=UPI00099D6532  ali  35  15.........PLAAFAGVPTYARLPHRTDLT--NVDVAVLGVPFDGTVTFRSGQRFGPRAVRTGSSTVGGYNPAQQ--IDPFSVLTCVDHGDVPVVPGNTQRSLAAIERAVARVVAAGAVPLLFGGDHSCTLGHLRGM-RRHGPVAVIDFDAHTDSGDNYERYSHGTWFRRAVEEELVSPEHSTLLGLRGSIDSELGAAYLTTDQVAADLASAAATA-RERAGDRPVYVTFDLDVIDPAFAPGTGCPEPGGITSREAIALLRALGPLDYVGFDVVELIAEYDPAAVTAVLAGNLGFEMLSLLARRR. 314
26 0.000e+00UniRef50_C3ZD81 Uncharacterized protein (Fragment) n=2 Tax=Chordata TaxID=7711 RepID=C3ZD81_BRAFL  ali  41  1............................................................................GAAPFDSLQVADIGDVFINMYDLKDAVKKIREAYSKIVANGCKPLTLGGDHTLTYPILQAIKTKYGPVGLVHVDAHADTSDKGEKISHGTPFRRAVEEGLLDCQRVLQIGLRGGWSRQQGFRVVQAEEIWYKSLAPLMEEVRAQMGDGPVYLSFDIDALDPAYAPGTGTPEIGGLTSHQGLEIIRGCRGLNLVGGDLVEVSPAYDPSGNTALTAANLLFEMLCGVQYRRG 243
27 0.000e+00UniRef50_UPI000DE34492 agmatinase n=1 Tax=Vallitalea guaymasensis TaxID=1185412 RepID=UPI000DE34492  ali  32  14...........................NSTYHDADIVICGVPFDGTCSNRPGTRFGPDGIRAEIDGLETYSPYQDEDMIDY---NYVDVGNIEIPIGSTSKTMGCIHENIKSILEDNKKIITLGGEHLISYPIVKAFAEKYSNLHVIHLDAHADLRSDYEKLSHATVMRRIYET--LDKGYIFQYGIRSGTKEEFQFAGEHTK-LQAFNLNGI-EKVKSMVGNDPVYLSIDLDVLDPSIFPGTGTPEPGGIDFNELINGIISLKDVNIVGADIVELSPHYDLSGVSNIVAAKTLREVAIIMSKR.. 285
28 0.000e+00UniRef50_A0A0A8JGQ8 Arginase/agmatinase/formimionoglutamate hydrolase, arginase family n=2 Tax=Firmicutes TaxID=1239 RepID=A0A0A8JGQ8_BACSX  ali  29  8............PAVGICSFGRNSICTDLDQLDADVAIIGVPYDMGTAYRAGARLAPRRIREASTNEEGF-YDHERNEVFLKGVKIVDCGDVDILHGDLTYSFKNIEEDVRKIVKKGALPVVIGGDHSITAAIGKGLNQV-GDFCVIQIDAHLDWSDGGQKLGQGSPMRRLSEMDYVNG--MAQLGIRGVDANEYGSVIKSVKQIREIGIHNIGDYIPDA---ERYYITLDIDGLDPSIAPGTGTPSAGGFLFHEIQTILETIANKGVIGFDLVEVAPDYDPSGITSHLAQQLINEFLGFIFKAK. 308
29 0.000e+00UniRef50_Q57757 Uncharacterized protein MJ0309 n=20 Tax=cellular organisms TaxID=131567 RepID=Y309_METJA  ali  33  15...........................NCPYEEAEGVIFSIPYDETTSFKPGAREGGNAIRTASWGLETYSPILDRDL---AELKYCDLKDLDL-YGSQEEIFGTIHSVSREILKENKKIIVFGGEHSITYPIIKAVKDIYDDFIVIQFDAHCDLRDEYNKLSHACVMRRVYEL----TKNIFQFGIRSGDKEEWDLARKNNLYLKDLMNKDDLEYIKSL--DKPIYVTIDIDVLDPAYAPGTGTPEPCGFSTRELLYLLEEVKD-KIIGFDIVEVSPIYDIANITAITAAKIARELMLMI..... 283
30 0.000e+00UniRef50_A0A2M7SJW3 Agmatinase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2M7SJW3_9DELT  ali  25  19................PNNFGGLP-EESSGLDTSKVVVLPIPYDQTVSYRAGTREGPRAIINASAQIELYDQELNSEPY---RVGIHTLKELEPDMSGPEGMFKRVYDTVSLFNKKKKLLIMLGGEHSLSVGAVKAFSEEYKDLSVIQIDAHADMRDTYTKYNHATVMRRVL-----DYASTVQVGIRSLSKEEMEFIVFFEKDVVK--GEGWMEEMISHLS-QHVYITLDLDVLNPGIMPSVGTPEPGGLDWHELLNIIRKVAERDIVGFDVMELCPIPGLIAPD-FLAAKLVYKMIGYLFLNR. 304
31 0.000e+00UniRef50_A0A1V6A3L3 N(1)-aminopropylagmatine ureohydrolase n=4 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1V6A3L3_9BACT  ali  26  4.........ENVHFKATYNFLGLP-EEDSRYEDAKAVIIPVPYDSTTSYRAGTREGPQAILTASRQVELFDLDLGCEPLTS---GVHTFPELETDTSGPEGTVKNVEKAFKAVFSANKLPVMLGGEHSITSGVKAAKAKYKKSLSVLQLDAHSDMRDEYENYNHACVMRRVYDL-----APVTQVGIRNTCKDEIEFFKKVKHDIWASQMADWIERVLSRLSDD-VYITIDLDALDPSIMPAVGTPEPGGMLWYQTLELLKVIDKKNVIGFDVVELCPIPG-NIASDFLAAKLVFKMLGRIFKKNG 299
32 0.000e+00UniRef50_A0A1E7ZAP5 Arginase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1E7ZAP5_9ALTE  ali  28  123.....PGPFYLSRYAGVQTFVGAPVAIYPDDLKVDVAIVGAPLDMGSYYR-GQRFGPQAIR--SGRYRG-GIDMATLVDPSKVLSIVDYGDIAIDNMSTEISIQHVRERVREIAETGTIPFIVGGDHSLEYPDVAALADVHGKFGVIHFDSHYDAGKGVHWMTHGQPVYRIVKEGHVNPENYIQVGLRGPWPRNNGMRYHTKAEVEKKGWDAVVEEALARNGPEKLYISFDVDVIDPAFIPGTGTPVPGGLTMREAIPLVRALAEHDIVGFELVELDPLLDPTYRSALNAGYIMQACLTGVAMRK. 442
33 0.000e+00UniRef50_A0A2N2D3H8 Agmatinase n=13 Tax=root TaxID=1 RepID=A0A2N2D3H8_9FIRM  ali  32  15...................FMG----SSEDIEDCDKVLIGLPMDFTTSFRPGTRMAPFRVREVSEGVEEYSIYQDRSLD---EISFYDAGDVCIPFGNVSDSLKRMELTALDLLAMKKKIFSIGGEHLVTLPIIKAYIKTYPDLLVIQMDAHADLREDYLGLSHATVMRHILQ--LVGERNLFQLGIRSGTREELQYASKSSNLYLDCFLS-VMDEVKNKVGDRPVYISLDIDVLDPAFAPGTGTPEAGGVSSRELIQMLNGLSSLNVVGFDMVEISPPFDIGDNTSILGAKIMREALLAY..... 288
34 0.000e+00UniRef50_A0A0P0Z5D7 Agmatinase n=2 Tax=Aurantimonas manganoxydans TaxID=651183 RepID=A0A0P0Z5D7_9RHIZ  ali  36  445.....PKGTRVAPYAGVPTLLDAPHRAAPDLSNLDVAMIGVPMDLGVTNRNGSRFGPRALRTM-ERVGPYNHVLKT--MPTASLKVADIGDVPFSRFDLATSHEDIERTAATIAGAGVLPLFVGGDHSITLPILRALG-ADRPVGMIHIDAHCDTSGPFDGFHHGGPFRQAVLDGVLDPERTIQIGIRGASEYESGMTVIHAEEIPGLGLDAVIARARAVVGDGPVYVSFDIDSLDPAFAPGTGTPEIGGLTTREVQMILRGLAGINMIGGDVVEVAPQYDATTNTAHAGAQMLFELLSLL..... 749
35 0.000e+00UniRef50_UPI000C1FB2B1 agmatinase n=1 Tax=Sulfobacillus thermosulfidooxidans TaxID=28034 RepID=UPI000C1FB2B1  ali  31  1..........MPRFAGTTTFMKLPLVHCP-----DITVMGAPFDGGTTMKSGARMGPKAIRDASRGLFPYHRIHR--IFLTENIKICDGGDLRVIPSNVPKTLDIMARQIEQI-SEHSLVLLLGGDHSVSLSALRALAKRTGPVSLIHFDAHSDLWHEGELYSHATVFRRAIEESLINPYTSIQVGLRGGLDHELHIQQITTEDWFRHGDEWVTTQIYQRVGNTLAYVTVDIDVVDPAFASGTGTPEAGGPSSYMVLHVLRSIRSL-VIGGDVVELAPCLDLTQSSSLFAATVAYEILFLLAQS.. 298
36 0.000e+00UniRef50_A0A1D7U3L0 Agmatinase n=9 Tax=Rhizobiales TaxID=356 RepID=A0A1D7U3L0_9BRAD  ali  43  20......GAAHDPTYAGALSFMR--RRYSKDFTGCDLVIWGVPFDLAVSNRPGTRFGPQALRRVSAIFDG-DAQYPSRIDPFEHLSAVDYGDCLLPRSDLQGCAKAIEEGAAKIIASGAHLVTLGGDHFITLPLLRAHVARHGKLALVQFDAHQDTWDDGIGISHGTFVLEAVREGLIDVERSIQIGIRTVAPRDCGIAVIDGYAAQALGVDGVVARIRQRVGHGPAYLTFDIDGLDPAFAPGTGTPVAGGLSSAQGLGMVWGIRDLDFRGMDVVEVSPPYDH........................ 293
37 0.000e+00UniRef50_A0A2E7XHY4 Arginase n=4 Tax=Bacteria TaxID=2 RepID=A0A2E7XHY4_9GAMM  ali  29  67.............YTGIPSFFNLPVALTPADLKADVAMMGAPLDTG-SGMRGAAWGPRHFRIANNYLPWGSYHLHTMVNWREDLVVVDYGDAAIDNLSGERSMKPVREIVRQIAATGAIPIIIGGDHSLEYPNVAGVADVHGKVGVIHFDAHFDAGLFGNGHTHGKPIRRLIEEGHVLGRNYIQVGLRGYWPREQGMRYHTMAEVEQDGWPAVMASVLKEAGTKYLYISLDIDVLDPAYAPGTGTPEPGGLTSRELFPLIRGLCSDNLVGFDLVEFNPLVDPGYITGLNAERAVRECLTGIAMNR. 378
38 0.000e+00UniRef50_A0A021XBK7 Guanidinobutyrase n=9 Tax=Rhizobiales TaxID=356 RepID=A0A021XBK7_9RHIZ  ali  30  7..FQPVDAAVTPRFSDVATFLR--TRRHDIVRGIDIGLCGVPFDLGLNYRSGPRQGPAGVREASRIIRRIHPVT--GVRPYDLCTVADIGDAPINPLNKDASIDQIQAYFQEVKDAGIRPIAIGGDHTIPTPILRALA-SDRPVGILHIDAHADVMDTGTKVNHATFMRRAYEENLIDPRRVVQLGLRGGDDDDKGYNIITLDEYEEMGRAAVIEKINSVLGDGPFYISLDIDSIDPAYAPGTAVPEIGGLLPRDLQVIIRSLQGKDLVGADISEVAPVYDPTGITCVTAANMMFEMLCVMAK... 312
39 0.000e+00UniRef50_A0A1E3GZ07 Proclavaminate amidinohydrolase n=15 Tax=Bacteria TaxID=2 RepID=A0A1E3GZ07_9RHIZ  ali  30  81.........ELPHFAGINTFLKAPYVENRDVAKYDAAVVGIPFDSGTTYRPGTRFGPQGVRRISALYTPYNYEM--GVDLREQMTLCDAGDVFTIPANLEKSFDQISRGVSHVFSSGALPVMIGGDHSIGFPCVRGIAECTSKIGIIHFDRHIDIQEKDDERMHTTPWFWATNLPNVSPKNLVQLGIGGWEARKRDTNVLTIDDIEKIGLEKTAEIALELAWKDAVYISFDVDSIDCGFVPGTGWPEPGGFLPREALKILGMVAAEGLCGLEVVEVSPPYDTSDITALFGVRVIVEALGSMVA... 385
40 0.000e+00UniRef50_A0A235E5Y8 Agmatinase n=2 Tax=Sphingobacterium cellulitidis TaxID=1768011 RepID=A0A235E5Y8_9SPHI  ali  32  57..........SPSYAGLSTFLRSPFLEDVEVSKYDVAFVGAPFDAGTTFRPGTRFGPEAMRQISKLYRTYHFE--AGIDLAESISMCDLGDI-YSIHNLEKHNAQLEKALHHIISNGVFPVVLGGDHSIAYGTLRGVAKAEGKVGVIQLDRHLDMQPEMDEKMHDTPLFHASKLPNIDGKNIVQIGIGGWETKKNGNTILTMADVDEYGIAKIAEIALEKAGVKAVYLTVDIDSVDSGISMGTGWPEPGGFLPREILQLVKKLAEPGLIGMELVEVSPPYDHHNQTALMGTRIICDTLSSLVVNK. 362
41 0.000e+00UniRef50_A0A1F9BW69 Agmatinase n=1 Tax=Deltaproteobacteria bacterium RBG_16_49_23 TaxID=1797840 RepID=A0A1F9BW69_9DELT  ali  25  5.......GRVNLPFTGIASFCKFPVQTDLNQLSADAAIFGVPWDEGTGYRPGSRFGPRSIREYSTRFAFHEWNIENKERDLENIQVVDCGDQDVLYLKVDETFSAITDSIKKILSRKAFPVILGGDHSVAFPVVRAF-RKFAPLHVIHLDAHLDYNDSIEGLANGNPIKRISELNFVG--RIIQIGMRGIRTRERGNKIFTMSEFRRVGVEEALSSI---PGKSNCYVTIDMDVLDPSIAPGTSSPEFDGMTYGEIKALLEGIASRKVLGFDVVEVNPFLDPIGLTQTAAAMLILEFLGAIFKS.. 314
42 0.000e+00UniRef50_A0A2H9Q9M0 Agmatinase n=4 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A2H9Q9M0_9ARCH  ali  30  9.................FTYLGLE----TDFKKSKYVILPVPYDGTASYRSGAREGPFEIINASRNLETYDSEFGDVSNL-----IYTLPELQPNLNSVEEMMLRIEETALDQLTQGKYLITLGGEHSITYGVLRAFRKCYPKLSVLHIDAHADLREDYEGLNHACVMKRSHARELYP--DTVSVGVRSVCEEEA--KCISSEKLDVYPMSEDIEEIVSKLG-KNVYLTFDIDALDPSIMPATGTPEPGGLLWYQALRLLRKVEKKNVVGFDLMELCPIPGMHAP-NFTAAKLLYKMIGYHSK... 286
43 0.000e+00UniRef50_A0A1Y4NSM9 Agmatinase n=1 Tax=Lachnoclostridium sp. An169 TaxID=1965569 RepID=A0A1Y4NSM9_9FIRM  ali  35  24.................ASFGGIPLKREFDNE--DFCVVGIPYDTCTSRRAGARFGPRAIRAGVHSIAGINEYSQDAHYVIRNLKGMDYGNIPVKNGYTEISFQVIYEHMKNILDHGCTPIALGGDHSITYPELRAYAESAGPVAIIHFDSHNDTTDTPEKFTHGTPFRRAFEDGFLDAAHSIQIGIRGYMDEENGMEVITARELHKMSPEECAERIRAQVKDAPCIVTFDVDFLDPVYTPGTGTPVAGGFTSYEAYELVRGLTGLDIRGFDIVEVTEDYDPAQITGLFAGYLVVQFLVVLSKNK. 323
44 0.000e+00UniRef50_S3CSE7 Arginase/deacetylase n=2 Tax=leotiomyceta TaxID=716546 RepID=S3CSE7_GLAL2  ali  34  72.......FDDDYPYEGIGTFAHLEYVECTE-SKFDIGIVGHPFDLGVSYRPGARFGPNGGRNGARRLSPWDMDHN-GVNPFSWAKVVDCGDIYNTPFDKLVAIHELERGMKALAADAVRLIAIGGDHTITLPILRALHSTWGRVAVLHFDSHLDTWDPHAEVNHGTMLHIAHEEGLLSNHSNMHLGSRSSLFDEHGFSYIRARALDQMGVDKVVQKIIETVGTEYVYLSVDIDVLDPAFAPATGTIEPGGWTTRELLAIIKGLAKLPIIGSDVVEFTPIYDNAETTGIAVSQIILEILHWMV.... 398
45 0.000e+00UniRef50_UPI000C0793F7 agmatinase n=1 Tax=Bacillus sp. Marseille-P3800 TaxID=2014782 RepID=UPI000C0793F7  ali  31  57.........DQPSYAGLATFLRSPYVEDVSVGEYDVAFIGAPFDAGTTFRPGTRFGPEAMRSISKLYNSYHFES--GVDLKEQLKMADLGDI-YSVHHLEKQFDQLSKAINHVVSHQTFPVILGGDHSIAYGTIRGLAEAEGKVGIIQLDRHLDLQEEMDERMHDTPLFHASQLPNVDPKNMVHIGIGGWTAKKQGHTVLTMDDVDDLGIDRIIEIALEKAGVQAVYLTVDVDCMDSGVSMGTGWPEPGGFLPREVLKLVRGLAKKGLAGLEVVEVSPPYDHNSQTALMGTRIICDVLSSLVKHK. 363
46 0.000e+00UniRef50_A0A135RTN5 Arginase n=1 Tax=Colletotrichum nymphaeae SA-01 TaxID=1460502 RepID=A0A135RTN5_9PEZI  ali  32  29....LEDLDKDLPFSQPVTFAHLEWQRCLAEKPLDIAVLGFPYDTSTSYRPGARFGPRGIRAGSSREKGRSYNTVWEVDPYEQLEIIDCGDVPITPFDASHAFKQMEQAYRQILWEHPRIISLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGYTHGTFFWHASREGCISKGTSVHGGLRTIDRDVVGFTIIEAHEIDDIGM-----------------------ILDPSIAPATGTPESGGWTTRELKRFLKGLEGLNLVGADVVEVSPPYDVAETTSVAAADLIVDILAGMTKKK. 340
47 0.000e+00UniRef50_A0A0K3CK19 BY PROTMAP:  ali  35  188MRKYPDSGDLS--FSGIVTFAHLPHSRCLDEQTFDIAVLGMPFDTSVSYRPGARFGPNAIRQGSRRHATNRYSIPWNFNPFAGAKVLDCGDVPISPYDNALAMDQIETAYSSLLARHPKIVTLGGDHTVVLPILRSLHKVYGEIAVLHFDAHLDTWNGN--LYKGAWTYQSKFEDL-------------THDSEVGFKLLTTDDIDELKPSGIIKAIKERVGNMPVYLSLDIDVVDPSMAPATGTPESGGWTSRELKSILRGLSSLNLVGLDIVEVSPGYDTNEVTGMLAADLVQEFLGMLMKGKG 503
48 0.000e+00UniRef50_Q9K6B9 Agmatinase n=96 Tax=Bacteria TaxID=2 RepID=SPEB_BACHD  ali  34  18.............................NYEKSKAVIFGMPMDWTVSFRPSSRFGPNRIREASLGLEEYSPYMDKHL---EEVAYFDAGDMLLPFGNPQRSLEMIESYVDKLLADQKMPIGLGGEHLVSWPIFKAMHKIYPDMAIIHIDAHADLREEYEGLSHSTPIRKAC--SLIGPENVYSFGIRSGMREEFQYAKDSGMYMAKFEVATPLKEVLPKLAGRNVYVTIDIDVLDPAFAPGTGTAEAGGISSKELLEAIVAIADVNVIGADLVEVAPAYDPSEKTPIAASKFVREMLLGWV.... 289
49 0.000e+00UniRef50_H0EBD0 Agmatinase n=9 Tax=Bacteria TaxID=2 RepID=H0EBD0_9ACTN  ali  35  15...........PDYAGLLSFSGLPYSEDPADLGVDAAIVGAPMDDLVSDRPGARFGPRAIRAASC---PPGPHLEAGVDAFEILEVIDFGDAPVLPADPERSHAAIEATVGQVLAAGAIPIVLGGDHSIAEPDVRACAAKHGPVGLIHFDTHTDTGRTVFGVSHGTPMYRLVESGHVDPTRYVQIGLRGYWPRERGITSLFMHDVRDRGIKAVVADAVAADGSRPVFLSVDVDVLDPAFAPGTGTPEPGGMTSADLLWACRTVAEVELVGMDVVEVLPERGSRDVTALVAERIVRETLTGVAMRR. 322
50 0.000e+00UniRef50_A0A1Z3HL76 Putative agmatinase 2 n=4 Tax=Bacteria TaxID=2 RepID=A0A1Z3HL76_9CYAN  ali  29  57.....FSRGELPHFAGINTFLKAPYLEDVRQGNYDAAIVGVPHDSGTTYRPGTRFGPQGIRRISALYTPYNFEL--GVDLREQITLCDVGDIFTIPANNEKSFDQISKGIAHIFSAGVFPIVLGGDHSIGFPTVRGICRHLGDVGIIHFDRHVDTETDLDERMHTCPWFHATNMANAPAKNLVQLGIGGWVCRERATNILTVTDITEMGLDNAATFALEHAGTDCVWISFDIDCIDAGFVPGTGWPEPGGLLPREALYLLKKIQNAPVCGLEVVEVSPPYDISDITALMATRVICDTMAHLVLS.. 368
51 0.000e+00UniRef50_G8TSM6 Uncharacterized protein n=4 Tax=Firmicutes TaxID=1239 RepID=G8TSM6_SULAD  ali  34  5.YPGIVPEEQMPRFSGRPSFMKLPWWG--KDMDVSVAVIGVPFDGGTTFQSGARMGPWAIRQASWGLYPYSRVHRISL---ADARLADAGDLRVVPMSVPDTLMLVEHQLGA-FPGGTRFLALGGDHSVTLGLLRDVVRRRGPVGLIHFDAHSDLWDEGQRYNHATVFRRAWEEGLILPDRTIQVGIRGGEADRLGILQVSTDTWLSQGTRTTIHQIRNRVGRGPVYLSVDLDVVDPAYAPGTGTPEAGGPSSHMLLSVLRGLAGLSFVGADVVELAPPLDPTIASGLVAATVAQEALFLL..... 308
52 0.000e+00UniRef50_A0A0G0AAB0 Proclavaminate amidinohydrolase n=12 Tax=Hypocreales TaxID=5125 RepID=A0A0G0AAB0_TRIHA  ali  36  53.............FGGIGTYANLPYENCDSSEGFDIAILGAPFDTAVTGRPGARFGPNYIRAASV-----DPVHDW-------ARVVDCFDAPLTWLDNRVALKTLDQAHRAISGRSPRIVTLGGDHTTTLSALRSTYKRWGQVSVIHFDSHIDTWDPYARINHGTFLHIAHEENLILNS-SIHAGIRAPNDRRCGFDTITAREFDTKGVKSIIEQIRQRVGETNVYISVDIDVLDPAFAPATGTPEPGGWSTRELMTILAGLEGLNIIGGDVVEVAPAYDNNGTTALAAVDVVQAILELMVAQ.. 362
53 0.000e+00UniRef50_A0A2A4THN3 Agmatinase n=1 Tax=Alphaproteobacteria bacterium TaxID=1913988 RepID=A0A2A4THN3_9PROT  ali  44  1MSNTEIKPEDSRAYAGILSFLRFPYSRDLD--KADIAVLGVPYDLGTTNRSGARSGPRAIREQSSLVGEYEWGWPWDYHLSDRHHLVDYGDICDFTAYPERMTAELERMAGEIISRDTALLSLGGDHFISLPLLRAHVKKHGPLALVHFDAHTDTWVDDS-YNHGTMFYHAIQEGLIDVDHSIQVGIRTPNPDTFGLQIIDAIMMNNMSNSDIAGAIHDRVGDRKAYLSFDIDFLDPAYAPGTGTPVSGGATIMQGREILRGLRGLTIVGGDLVEVAPAYDPIG...................... 284
54 0.000e+00UniRef50_A0A2G7FWS6 Arginase n=1 Tax=Aspergillus arachidicola TaxID=656916 RepID=A0A2G7FWS6_9EURO  ali  35  67.....VDIVTGSQFSGLTTFGHLPYVNCLMDDQADIAILGAPFDTGVTARPGARFGPVGIRLGSRRLQGWSIYTGVNV-FESWAKMVDCGDAPLTPLDNTVALKQLDLAHKVISERGHTPLTLGGDHTTTLSALRSTYDKWGPVSVIHFDSHLDTWDPYAGVNHGTFLHIAHEEGLIRNTSL-HVGIRAPNDIRCGFEIIKARDLDRVGISGIVEQIKARVGDSKVYISVDIDVLDPAYAPATGTAEPGGFTTRELLSILDALHGLPVIGADVVEVAPVYD......................... 372
55 0.000e+00UniRef50_A0A1W9MI09 Agmatinase n=1 Tax=Candidatus Altiarchaeales archaeon A3 TaxID=1933927 RepID=A0A1W9MI09_9EURY  ali  34  9...........................NSEKEDADVCIFGMPFDSTTSFKPGTRFGPNAIRDASYNLEFYSMALERNI---GDIKIFDAGNIGFH-TKPQDAISEISKRTNDLLKNDKFIVGLGGEHTVSYGIAHAMKEIYKDIAVIHFDAHADLRTEYEKFSHACVMNLIGSE--IGFENIYQFGIRSGEEEELKFAEKTNFYLHKYDTTQILEILDDLNISKRTYLTIDIDVLDPAFAPGVGTPEPGGITSNDMFKILNSLKKFDVVGFDVVEVNPMIDVSGITAMAAAKIVRE.......... 274
56 0.000e+00UniRef50_A0A1C6F2L2 Proclavaminate amidinohydrolase n=2 Tax=uncultured Ruminococcus sp. TaxID=165186 RepID=A0A1C6F2L2_9FIRM  ali  35  13..................TYGGLKSSTDTS--GADYTIIGIPFDIRTTYRPGTRFGPDGIRRA---FSTDSVNEAVGIDTSKYVKGVDYGNLDIWNAE-KAYLGSIPQEMKAILETGTIPIVLGGDHSITFPELLAYKDVYGPVSIIHFDSHTDTWTDKEHHDHSTPFRRAIEYDCIDPKTSIQVGMRGGFANNAGLEHIYAVDIHHMGIEKTAELIREKVGNNKVMVTFDIDFVDPAFAPGTGTPVSCGFTSRQALELIRALIGLDIVGFDLVEVAPNYDAGGITSILASRIVKEFITCVACKK. 305
57 0.000e+00UniRef50_A0A0F7RW20 Related to CAR1-Arginase n=23 Tax=Basidiomycota TaxID=5204 RepID=A0A0F7RW20_9BASI  ali  36  74..........VPAYSGVTTYAHLPTAKCLNDPNFDVAVLGIPYDLTVTYRPGARFGPNAIRQASRRQRTYSLYHGQDPY-NTGLKFLDCDDIPASPMDPALAIDQIEAGYTSLLQRHPKIVSMGGDHTIVLPILRSLYRVYGPIAVIHFDAHLDTWPPQHQIQHGTFFWQAALEGLIARNQSIHAGIRTRHDASIGFDIITSDDIDDLGIPAIISQIRERVGTMPVYLSIDIDTLDPGFAPGTGTLESAGWSPRELRRILRGLEGLNFVGFDLVEVSPSYDHAEITAYAASDLIYEFMNLLIR... 426
58 0.000e+00UniRef50_M2T571 Uncharacterized protein n=19 Tax=saccharomyceta TaxID=716545 RepID=M2T571_COCSN  ali  33  47...........AKFAGLTTYANLPYIHCLAPEGFDIAILGAPFDTAVTARPGARFGPSGIRAGSRRIGPLWSVYTGENVFFDWAKIVDCGDAPLTFLDNTVALNQLDRSHKIISSRDPKIITLGGDHTTTLPALRSAHHHWGQVSVIHFDSHLDTWDPYAGVNHGTFLHIAHEEGLIRNT-SIHAGIRGRNDIRCGFEMIKARDIDRIGVSGIIDKLKARVGDSKVYISVDIDVLDPAFAPATGTAEVGGWSTRELLSILDGLEGLDVVGADVV--APVYDNAGTTVLAAAEVVQSLIGLMVK... 368
59 0.000e+00UniRef50_D2AZZ8 Agmatinase n=1 Tax=Streptosporangium roseum (strain ATCC 12428 / DSM 43021 / JCM 3005 / NI 9100) TaxID=479432 RepID=D2AZZ8_STRRD  ali  29  29.....QRYQFVPAYSGIATFLGLPLCLTPEDLRAEVAIVGAPVDMGTGHR-GAAFGPRAIR-ASEWVVAHTPDSDTRINPFNELIVVDYGDAAVDAMSVEDSMEPIRGIVREIAETGAVPVVLGGDHSILWPDAAALADVYGKVGVVHFDAHADCAESVNGHSHATPIRRLIEDEHIPGRNFIQVGLRSLWMRARGMRSHFMAEIDRIGFPAVLDKAIAEALDGPLYLSIDIDVLDPAFAPGTATPEPPGLTTRELLPALRRICETPVVGIEVVEVAPNLDPGNTTAMNARKAIFECLTGLALRK. 349
60 0.000e+00UniRef50_A0A2H5W3Y0 Guanidinobutyrase n=1 Tax=bacterium HR11 TaxID=2035406 RepID=A0A2H5W3Y0_9BACT  ali  30  7............PYAGHVSFLGAPVWRSEEDLAADIAVLGVPIDMATTNRPGARYGPRAIREASMLY-TYDYDVDERKTILQGYHLLDCGDVPVLASELQVTFDRITAAARMLFERPLFPVFLGGDHSMTYPILRAW-PGHAPVHVVHFDTHMDVLDDGARFTHGSPFRHVMTLPFFDG--LTQVGIRGILNDEMGFTVLTTGDIKLHGPAAWTDRL---PRGKNVYISIDIDVFDPSIAPGTGTPEPGGLTYWEARLLLREVCTRNVIGLDVVEVAPPYDVAGLTAHLAARVIIDVLGYVLGNK. 321
61 0.000e+00UniRef50_A8TQE9 Agmatinase, putative n=10 Tax=Bacteria TaxID=2 RepID=A8TQE9_9PROT  ali  30  7..FQPVDAAVVPRFADVATFMRTKRHGIDP--EVDIALVGVPFDLGVNYRTGARQGPSGVREASRLIRRVHPTT--GVSPFDICNVADLGDAPVNPLDKTKSIAQIQEFYETLRDNRIVPISIGGDHTIPTPILRGLVK-DEPVGVLQFDAHPDTLAEGDTVNHATFMRLGHKEGWIDPKRTLQIGLRGSRFSEAGFTVITIDEFEAMGRAAVIAKIHEVLGDKPFYITLDIDGIDPAFCPGTAVPEIGGLIPRDLQVILRSLTGKPIIGADISEVAPCFDPTGITCVTAANMMFEMLCAMA.... 311
62 0.000e+00UniRef50_A0A179D4F8 Agmatinase n=4 Tax=Thermodesulfobacteriaceae TaxID=188711 RepID=A0A179D4F8_9BACT  ali  28  4..................TFLGLPEVR----EKARVALIPAPYDATTSWRPGTREGPRRILEVSPYLEFFDEETGSE--PHRNLGFYTFPEPEL-PVDPEKAILTIESLVCKALDEQKFPVLLGGEHTVTLAALRALKERFSSFKILQIDAHPDLRDVYQPFSHACVMRRAYEMGL----EVVAVGIRTASREEYELIVLWARDL-KRDFEAGLANLKDLLGEGPVYVTLDLDGFDPAEAPGVGTPEPGGLTWYEVLEILKLAASFRVIGFDVVELLPIPG-DPRTEYLAARLIYKFLAYL..... 281
63 0.000e+00UniRef50_A0A1W1W0G6 Agmatinase n=2 Tax=Thermoanaerobacterales TaxID=68295 RepID=A0A1W1W0G6_9THEO  ali  33  8.................FTFLGVFLGSTDNYVDSWICILGLPLDVTSTFRPGSRFAPQSIRSVSEVLEEFSPFLKRDL---KEVAFCDLGDLELVPGRIRENLTRIEEVASEVWKDGKLLLSLGGEHLVSYPLIRAARSHYPELAVLHFDAHADLREEYQGYSHATVMRLVAEE--IGPSHLYQLGIRSCTWEEWVYGSENTNLFLDH-IELPLSRLLPELKGRPLYLTLDIDVVDPAYAPGTGTPEPGGCRPQDIFSALYLLKDAHIIGLDIVEVSPAYDMGNITSILAAKLVREAILAF..... 289
64 0.000e+00UniRef50_A0A2S6UJB0 Proclavaminate amidinohydrolase n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A2S6UJB0_9PROT  ali  28  50...SLFSRGHLPAFAGINTFMKSRYCENREVGNYEAAFVGVPFDTGTTYRPGARFGPQAVRRISALYDGYC--VDGAVDLFEELDLCDAGDIFVIPGNIEKTFDQVSKGISHVFTSGAFPIIVGGDHSLGYPNVRGVAQISGNVGIIHFDRHLDTQDDMDERMHTTPWYWTVGLSNCPPKNLVQVGIGGWYARDRGTSVITMKDFEELGIQGTASLALELAWKDAVYLSFDIDSIDPAFAPGTGTPEPGGFMPREALEMVRLIAREGLCAMEVVEVSPPYDVNDNTSQLACRVILDVIGTMV.... 380
65 0.000e+00UniRef50_F6FR46 Agmatinase n=16 Tax=Actinobacteria TaxID=201174 RepID=F6FR46_ISOV2  ali  33  59.............FSGIQTFGKLPVALTPEDLRADVAVLGVPWDSTATGRTGTNHGPLAIR-ACDYKGGYHFSLDTHVDAFAELVMADYGDAPVSVGNTARTFEGIRKFVGTVVDAGAIPIILGGDHAITWPCATAVADHYGKVGIVHFDAHADTGDDMPGSSHGTPMRHLINSGAIPGKNFVQVGLRGYWPDDQKMRTHFMAEIVRDGFDKVLERAVDEALDDHLYISLDIDVCDPAYAPGTGTPEPGGITSNDILRAVRRLAEVGIVAMDVVEVSPPYDRGEITALLANRSVREAMTGIAMRR. 371
66 0.000e+00UniRef50_A0A0B8QPH7 Agmatinase n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0B8QPH7_9VIBR  ali  63  1..................................................................MAWEGNKFPWDFNVFDRVNVIDSGDLVFDSGDAEDMTQRLQAATDEILKSGKTVLALGGDHFITLPLLRAYAKHYGEMALVHFDAHTDTYAHGSRYDHGTMFYHAPNEGLISPEHSVQIGIRTEYQKEHGFNVINAMEANDLSADEIVARIKQTIGDKPVYVTFDIDCLDPAFAPGTGTPVCGGLNSDKVLKILRGLAGVNIVGMDVVEVSPPYDHADLTALAGATVALELMYAWASKN. 240
67 0.000e+00UniRef50_G2XV70 Uncharacterized protein n=27 Tax=leotiomyceta TaxID=716546 RepID=G2XV70_BOTF4  ali  35  82..................TFAHLPAVDCFDPENFDVAIVGHPFDLGVTYRPGARFGPNAARQGARRMSPFGWRIENNVNPFDWATVVDCGDISNTPFDKHLALKQLENGMKSINSRSPRAISIGGDHTITLPILRALHSTWGRVAVLHFDSHLDTWDPYTDVNHGTMLHIAHEEGLLSNHSNMHLGTRCPLMDQHGFTYIRARELDKLGIKEVVRKIVERVGDEYVYLSVDIDVLDPAYAPATGTIEPGGWTTRELLQIIGGLAGLKIVGSDVVEFTPIYDNSETTGIAVGEIIYEILQWMV.... 403
68 0.000e+00UniRef50_A0A0X8WTL5 Proclavaminate amidinohydrolase n=86 Tax=Bacteria TaxID=2 RepID=A0A0X8WTL5_9CYAN  ali  28  58.....FSRGELPHYAGINTFLKAPYLEDVRVGEYDVAIVGIPHDSGTTYRPGTRFGPQGIRRISALYTPYNFEL--GVDLREQITLCDVGDVFTIPANNEKSFDQISKGVAHVFASGAFPILLGGDHSIGFPTVRGVCRHLGDVGIIHFDRHVDTETDLDERMHTCPWFHATNMANAPAKNLVQLGIGGWQVPRQGVNILTVTDITEMGIDAAAEFALERAGTDCVWISFDIDCIDAGFVPGTGWPEPGGLLPREALALLKIVQRAPICGLEVVEVSPPYDVSDMTALMATRVICDTMAHLV.... 367
69 0.000e+00UniRef50_A0A2T2XK49 Agmatinase n=2 Tax=Sulfobacillus TaxID=28033 RepID=A0A2T2XK49_SULTH  ali  33  3.NYDPVAEHLMPRFSGPTTFMKLPSLEQVN--DPDIVVVGAPFDGGTTFRPGARMGPSAIREASSALYPYHRGHQQ--FLTHEAVVADGGDLIVVPGNIGVTLVRMTEQLDKLGEAA--VLLLGGDHSVSLAALRSLSKRVGSLALIHFDAHHDLWHDGEKYSHATVFRRAIEEGLIDPAFSLQVGLRGGLDEDLHIQQITTDDWYAHSASWLAEQIHRRVGTHVAYLSVDIDVVDPAYACGTGTPEAGGPSSYMVLQALRLIS-APVAGADVVELSPDLDVTRTSSLFAATTAYEVLFLLARARG 310
70 0.000e+00UniRef50_A0A101JHK3 Agmatinase n=13 Tax=Actinobacteria TaxID=201174 RepID=A0A101JHK3_9ACTN  ali  30  23.EPGPIDLRRNAAYSGIPTFMGLPVCLDPADLRADVAVLGVPLDSSSGHR-GAAYGPRALR--SD--ERYLFNTPTRVSPFQQLKVVDYGDAAIDIFSVEKSLPSIAATVTEVAQTGAIPVILGGDHSLMIASVGALADLYGPIGVVHFDAHPDCHEHGHRVTHGTPIWRLIEEKKIPGKNFIQVGLRTPWMRRQGLRTHFMVEIERSGFTAVLDKVIEEVLDGPVYLSLDIDVLDPAYAPGTGTPEPGGLTPRELFPAFRRIAETNVIGIDVVEVAPHLDPGYTTTMNARRAIFEGLTGLAMKK. 350
71 0.000e+00UniRef50_K0Q5S5 Agmatinase, mitochondrial n=11 Tax=Proteobacteria TaxID=1224 RepID=K0Q5S5_9RHIZ  ali  31  18.....IDPSQAPRYSDVATFMRTRRMPIDRGL--DIALVGVPYDFGSNVRPGARLGPAAVREASRFIRRFNPVTK--IDPFALVNVADVGDAAVNAHERLKSIDLIQVTFEEIHAAGAWPLSIGGDHTIPLPILRVIAK-DKSVGVVQFDAHSDTLDEGTKINHATTWRRAVEEGLVDPKRMIQIGLRGSQVSEVGMRVITIEEYEEIGRAKVIEEIGRVVGDGQTYVSFDIDGLDAACAIGTGVPEIGGLSPRDAQVIIRSLTGRQIIGADICEVAPMYDVTGHTQLVAANLMFELLCVMADAK. 322
72 0.000e+00UniRef50_A0A1Y5TSU5 Proclavaminate amidinohydrolase n=19 Tax=Bacteria TaxID=2 RepID=A0A1Y5TSU5_9RHOB  ali  28  8.SHGYEGGRLNLPFVGICTFAKGEYVADWNAIDADVAVLGAPYDFGCQWRSGARFGPRAIREASTLFSFYDFEDDITYLPAETTKIVDIGDADIIHTDTINSHANIEAGVRAILKSGALPVVLGGDHSINIPCINAFDDQ-DPIHLVQIDAHLDFVDERHGYGHGNPMRRAAEKEYVTG--LTQLGIRNVSAREMGSDILSVRHLRKLGVQGVLDRVPE---GKRYYVSIDIDAFDPSIAPGTGTPSHGGFQYYEVLEFLDGLSKRGIVGIDLVEVAPDYDHSGSTSTLAAQVLMNLIGRILHNR. 322
73 0.000e+00UniRef50_A0A0T5ZHV7 Agmatinase, agmatinase n=11 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0T5ZHV7_9CHLR  ali  29  18.PYEMHGERDLPTYVGLQTFCKRDPVGDAEELHPDVAIVGAPFDDAVSHRSGARFGPRAIRQAT--YTDGEHSLQLDVEPWAELDVVDAGDANIVPAWLERAHAVIYRKVRDVAACGAVPIVLGGDHSITWPSVTAVAEAVAPIGIVHFDAHADTAPDDWGVGHGTPMRRLIESGAVLGKNFVQVGLRGYWPQAQGMRWHKMREIEERGAEAVIDDAIAEALDGPIYLSLDVDVVDPGMAPGTGTPEPGGLLSRELLRAVRRIVGRELAGMDIVEVSPPYDHAEITAMLGHRAALEAISALAVKK. 337
74 0.000e+00UniRef50_M5BWR6 Agmatinase n=1 Tax=Thanatephorus cucumeris (strain AG1-IB / isolate 7/3/14) TaxID=1108050 RepID=M5BWR6_THACB  ali  32  43.....YGSQFDMSFSGPLSFAHLPYTKCLEAENFDIAILGMPFDSAVSYRPGARFGPYGIRSGSRRISPRGYTTAWGYNPYKDMVIQDCGDVPIVPFDMQHAMDQMQTAYSTLIKRHPRIITLGGDHAIILPILRSLHEVYGEIAVVHFDSHLDTWPGYYGINDSS-------------------GIQDIHDQDVGFSMITTDDIDQLGADGIAHKIREHVGDKPVYLSLDIDVIDPALAPATGTPEPGGWTTREVKRILRGLTGLNVIGADVVEVAPA---SETTALVAADIIHEMLSIMIGK.. 350
75 0.000e+00UniRef50_A0A2R6AY06 Agmatinase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2R6AY06_9ARCH  ali  31  18....PIDANVSPRFAQPATFARLPHQKDLT--DIDVAFVGVPFDDATSYRPGSRLGPSAVRELSRGLRTYNASLR--VAPFEVVNVVDYGDVDVVPGYVQDTFERVTDVLHKVHSAGVTPLVCGGDHSISLPSLRAAHRVHGPLYVLDFDAHFDFSDWGKKYTHSTWVRRALEEGLIS--NIVELGIRGRWAEENGIEVYTMDMIEEKGYRTILKDILGGVPGSPIYVSIDIDAVDPAYAPGTGAPEIGGFTGNQLLGCIRMLRGYKLVSLDVTEVSPLYDPTGLTSILAANVFYEAISVLALNK. 324
76 0.000e+00UniRef50_A0A1B9I708 Agmatinase n=6 Tax=Tremellales TaxID=5234 RepID=A0A1B9I708_9TREE  ali  36  77.....PPYNTEEAYWGLKTFAHTQPVRCMTVDNSDIAILGAPFDTATSWRPGARFGPGGIRNGAQRLGGANRLLGN--NPFLDYTVVDCGDSRMTFYSNDLALATLEADYRSLINRHPRVVMLGGDHTIVLPALRALNEVYGPVSVIHFDSHCDSRHPDKGLTHGDYFYFAWKEGLMSETNI-HAGIRSPSDIETNFSTILADEIEDIGWQGVVSRLKARVGDSPVYLTIDIDTLDPAFAPATGTPEIGGWTTREMIKILHGLKDLKIVGADVVEVAPAYDQAETTQIAAAGLVFELISMM..... 397
77 0.000e+00UniRef50_A0A2D6CKH3 Agmatinase n=18 Tax=Bacteria TaxID=2 RepID=A0A2D6CKH3_9GAMM  ali  31  1MNNQPVDPSVVPRFAGLATFMR--TVTREIIEEVDVGLVGVPFDLGLNHRTGARHGPAGVREMSRLIRRVHPTS--GIRPFEICNVADLGDAPVNPMSKDKSIDLIRGFFSEMKGANIVPIACGGDHTIPLPILRALA-VDQPVGILHFDAHADTLDEGDKVNHATFMRRGYEEGLIDPKRAIQVGMRGSYGYDVGYSIITMDEYEEMGRAAAIRRIHEVLKGGPVYISLDIDGLDPAYLPGTGVPEIGGLIPRDVQVILRSLQGMDIIGADISEVSPCYDPTDITCVTVANLMFEMLCIIA.... 311
78 0.000e+00UniRef50_A0A1B3NLP0 Agmatinase n=42 Tax=Proteobacteria TaxID=1224 RepID=A0A1B3NLP0_9BRAD  ali  37  42............PFSDVATFLGAPYRPDPDLGGLDVAIIGLPMDLGVTNRAGTRLGPRAVR-AIERIGPMDHVMGT--APLGMLKAADIGDVPFSRYSLESCHEDIEATFRTIVEAGVSPLAVGGDHSITYSILRAVGAR-RPVGMVHIDAHCDTSYEGSKFHHGGPFRQAVLDGVLDPQRVIQIGIRGGFSYESGMTVIHADEVDGLGIEAVIAKARAVIGDGPTYVSFDVDSLDPAFAPGTGTPEVGGLTPREALAILRGLKGADIVAADVVEIAPQYDATSNTAHCAAQVLFTELCLIAEAR. 343
79 0.000e+00UniRef50_A0A1I6L0D8 Agmatinase n=2 Tax=[Clostridium] populeti TaxID=37658 RepID=A0A1I6L0D8_9FIRM  ali  32  15...........PRYCDIPTFMRIPQYGQID--NPDIIVIGIPFDDTSSYRSGSRFGPREIRNASTCLKKYNRCL--DVDIFADSITVDYGDIPVIPGYIEKSYTLISECIKKVVHDNAIPISIGGDHGIILPELRGLKEKHGKLSVISFDAHRDCSKSHFGYGHGTTLRRAIEEELIEPSTSVILGVRGSIAQDLSFNLIDMETYIESNPKDIVKTIRETVGKNKCILTFDMDCVDPAYAPAINTPEIGGFTSRECLYMIRNLTGINIVAADLVEVNPQYDSGGITNFLAASILFEIISVIVKN.. 314
80 0.000e+00UniRef50_A0A066PKC8 Agmatinase SpeB n=19 Tax=root TaxID=1 RepID=A0A066PKC8_9PROT  ali  43  1MTQ--FQGADAPTFATFPTFLGL----DRRARDAAHVVAGIPLDVGVTNRAGTRSGPAAIRVASRMLAGHHPHYRVMVD---DMDLADAGDFAIALGDLPGSLALIEAQAAQIGH----LVALGGEHGITLPLLRALAKRGGPVGLVHFDAHADTWAENFGYSHGSVFYHALNEGLVDPRRMIQIGIRSPLLNEQGVTILSAQDVHEQGVDRVAERIRAVAGTGATYLSFDIDCLDPAFAPGTGTPEIGGLASWQAQALLRRLGGIDFVGMDLVEVAPAYDVSEITALAGATMVWEYLALLASQ.. 302
81 0.000e+00UniRef50_R7U7L0 Uncharacterized protein n=1 Tax=Capitella teleta TaxID=283909 RepID=R7U7L0_CAPTE  ali  35  2.................NTMFGLPCASDTEGLDA--CFVGVPFDAGTATKTGSKLAPTQIRVESDVVRPFN--QDTGADPHNSIRVADVGNIACSPFDIREACKTIKEKCDGIVKGGCRPIVLGGDRTITYPILQSMKEKHGPVGMIQIDAHCDTSLPGSEIWHGSPFRLAVDEGLLDCHKVWQIGIRGSWGQDKGFNVVPAFQLWYKSLAPLMRDVREKMGNTPVYLTIDIDGLDPSIAPGTGVPELGGLTSTQALEVIRGCRGLNVVGGDLVEVSPPHDLHNITSTIAAHLLFEMLCIL..... 291
82 0.000e+00UniRef50_A0A2E7NHL5 Agmatinase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2E7NHL5_9BACT  ali  31  9..FQQVDVNSVPRSAQVATLMRAQLCEGFDGL--DIALAGVPFDGGSSFRAGARHGPAQMREMSRLIRQAHYST--NIAPFEICRIGDVGDAPINPLDMSASLESIETFFSAIRXAGALPLVAGGDHTITLPILRAIA-VDAPVGLLQIDAHSDTQDRMFGYANGTPIRRAIEEGLLEPSHIIQIGIRGTWAREQGITIMTIDDVYELGTNGIMNAAREVLSDLPTYVTVDMDAIDPAFAPGVGGLEPGGMTVRDVQLLLRGMEGLDXVGADXNEVSPPLDPTGNTAVVACNLMFELLCLLAAR.. 315
83 0.000e+00UniRef50_A0A2G4JFS7 Agmatinase n=3 Tax=Thaumarchaeota TaxID=651137 RepID=A0A2G4JFS7_9ARCH  ali  32  3MEFYGDDFNDVAPFVGINTFLHLPWIRSHQELKPDVAIIGEPFDFGTTIRPGARYGPRAIRAASTIYERFNIETGAD--PFGTFRTVDYGDVQVSPGDVIESHKRMTKKVKEVLDEQGIPVMLGGDHSITFANVRAFAKKYKNIGMIHFDTHADCAPQGYKYDHGAHIRRIMEMGCLRGKNYTLVGPRGYWPADQDFQWFTMLDVEELGIDMIAKEIADRAGTDAVYLSWDIDSFDPSYAPGTGEPEPNGLTSREGMRMVRLLSKSNRFAMDLVEVAPAYDVSGITSGLGQRLIIELLAGLSLKRG 339
84 0.000e+00UniRef50_A2QGZ9 Aspergillus niger contig An03c0160, genomic contig n=67 Tax=leotiomyceta TaxID=716546 RepID=A2QGZ9_ASPNC  ali  35  45.....IDIVTGSQFSGLTTFANLPYLNCFVDDESDIAFLGAPFDTGVTARPGARFGPKGIRLGSRRLGGWSIYTG-ENAFASWAKLVDCGDAPLTWLDNTVALKQLDMAHKAHFSQIPRIITLGGDHTTTLSALRSTYEKWGPVSVIHFDSHIGGGSHYAGVNHGTFLHLAHEEGLIRNT-SIHVGIRAPNDLRCGFEIITARDLDRLGVSGLVEQIKSRVGDSRVYISVDIDVLDPAYAPATGTAEPGGFTTRELLTILDALRGMPVIGADVVEVAPIYDTAGTTTLAAAEVAHSLLALMVAQ.. 376
85 0.000e+00UniRef50_A0A0G2J7S0 Agmatinase n=5 Tax=Fungi TaxID=4751 RepID=A0A0G2J7S0_9EURO  ali  36  33MAQAPLGPEDDSQFSGLMTFANVPYVNCFVDSEADIAFMGAPFDTGVTGRPGARFGPGGIRRGSQRIGSWSVYTG-ENAFTSWASVVDCGDVPLTFLDNTVALKQLDKAHRVVSSRSARIITLGGDHTTTLPALRSTYKHWGPVSVIHFDSHLDL-SSYAGVNHGTFLHIAHEEGLVLNS-SIHVGIRAPNDIRCGFNIITARDIDRIGTSGIVEKIKKRVGNNKAYISVDIDVLDPAFAPATGTSEPGGFSTRELLTILDALADTRIVGADVVEVAPIYDTAGSTVLAAAEVAHSLLALMV.... 368
86 0.000e+00UniRef50_A0A023X876 Agmatinase: agmatinase n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A023X876_9ACTN  ali  33  9.....TSYGEKPDYAGPLTFGGVPYTQDPADLDADVAIIGAPVDDLVSDRPGTRFAPRAIRSASC---PSGANLETKVDAFAELRVLDFGDAPVVPADPVRSHAAIEETVGQALSAGTVPVILGGDHSITEANVRACAATHGPVGLVHFDTHTDTGSKVFGVSHGTIMRRLVEEGRVDPERYVQIGLRGYWPGERGITSLFMHEVRDLGIREVVGRAVVAVGAGPVFLTVDIDVLDPAFAPGTGTPEPGGMTTAELLWAAREVARREVIGADLVEVIPTVGSADVTSLAADRIVREILGGLALHR. 318
87 0.000e+00UniRef50_A0A1S8BAH6 Putative agmatinase 1 n=2 Tax=leotiomyceta TaxID=716546 RepID=A0A1S8BAH6_9PEZI  ali  34  54...........AKFAGLTTFANLPYVHCLDVEKFDIAFLGAPFDTGVTARPGARYGPGGIRIGSKRMDVWNIYTGESAY-HSWAKIVDCGDAPLTFLDNTVALKQLDTAHKILAGRAPRIITLGGDHTTTLSALRSTAEQWGPVSVIHFDSHLDTWDPKVLVNHGTFLHIAHEEGLIRNT-SIHAGIRAPVMRRCGFDMVKAREIDRIGIDGVIERLKQRVGDSKVYISVDIDVLDPAFAPATGTAEPGGWSSRELLSILDGLSGLSVIGADIVEVSPVWDVGETTVLAAAQVADSLLTLMV.... 367
88 0.000e+00UniRef50_B6HAK8 Pc16g13170 protein n=3 Tax=leotiomyceta TaxID=716546 RepID=B6HAK8_PENRW  ali  39  33.......................................GAPFDTGTSYRPGARFGPSGIRQGSRRLNLGGYNVPLQANPFSDMRILDCGDVPVTSYDNAWAIRQIEEGHNSILMRKPRVITLGGDHTITLPLLRSINKAYGPVTVIHFDSHLDSWSEVAAINHGTYFYHAAMEGLLRNDTNIHAGIRTTNDGYCGFEIVEAREIDVIGTDGIIKKIRDRVGTDPVYLSIDIDTLDPAFAPATGTPETGGWSTRELRTIIRGLDGLNFIGADIVEVAPAYDTNELSTMAAADVLYEVLTIMVKK.. 334
89 0.000e+00UniRef50_A0A1I5U9U9 Agmatinase n=3 Tax=Caldicoprobacter TaxID=715222 RepID=A0A1I5U9U9_9FIRM  ali  32  20...................FMGSRECYD----ESDVIMVGAPMDYSVSYRPGARFAPQKIREVSYAIEEYSPYVDRDL---SEVRFFDVGDLELPMGNIVSSLEIIQQAAREVLEDGKKPIFLGGDHLITYPVVKEVYEKYGDLRLLHFDAHADLREEYERNSHASVIRLCSQ--FLPSKNIFQFGIRSGTREEFKWAGENLN-FYPFEVLQPLKEVIDVLKPYPVYITLDIDVVDPAYACGTGTPEPGGCMPHEIFQAFRAMKGLNIVGMDLVEVNPVYDTAGVTSILAAKIIREAMLII..... 294
90 0.000e+00UniRef50_U5MR00 Agmatinase SpeB n=85 Tax=Bacteria TaxID=2 RepID=U5MR00_CLOSA  ali  32  4...............NIETFIGC----DNEYDEAKMVIFGAPFDSTTSFRPGTRFASKAMRSESFGIETYSIYQNKDL---EDMSIFDGGDLELPFGNPQKALDQIEEFASEIINDDKVPCMIGGEHLVTLGSVRAVAKKYPDLHIIHFDAHADLRDSYETLSHASVMHRVWD--IVGDNKIFQFGIRSGDREEWGKDHVYTSKFNFTGLEEVIEK----LKGKPVYFTIDLDVLDPSVFPGTGTPEAGGVTFMQLLGAILKVSKLNIVGMDVNELSPIYDQSGSSTALACKVLRELL........ 277
91 0.000e+00UniRef50_W0U7R3 Agmatinase n=6 Tax=Firmicutes TaxID=1239 RepID=W0U7R3_9FIRM  ali  29  57...........PTYTSHETFLRSPFCEDIKVSEYDVAVVGIPYDSGASNRSGTRLGPAGIRHASSQISPFNPDY--GVDLYENIKLCDAGDIYTLPANAEKTFDQITKGIGYIFSQGVTPIVLGGDHSTTFPTLRGISKIDGNIGVIHIDRHSDCAIQMDEKMHGTEWYHSTHLPNLSAKNLVQIGIGGNCCRDSGCTAISMEDIDKYGIDKVAELALDIAGCKAVYVSLDIDVLEAAFCPGTGTPDFGGMLPRELLRLLKLVTAPGICGMDVVEVSPPFDVSEITSLAASRCIINVLCNLALNK. 360
92 0.000e+00UniRef50_Q754M4 AFR048Wp n=1 Tax=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) TaxID=284811 RepID=Q754M4_ASHGO  ali  35  35..............AGIQTFAHLPHERCLPDLEFDIGILGMPFDMSVTYRPGARFGPEAIRRGSRQIRAHAYSPYRALNPYDWAHIVDCGDVPVVLTDNRIARDMMHRAYADVLRRSPRIIMLGGDHSVLLPALRALHDVYGPISVVHFDSHIDTWQPANPLNHGTMLWEAFQHGLLSDHN-VHVGLRSHRDDAAGFYRIHADEILDIGPQGVVDRILRVIPRGPVYVSVDIDVLDPSAAPATGTVEPGGWLPRELLRVLRGLQPLTLVGADIVEVAPAYDRADITAITAAQLVYELAASMVAS.. 353
93 0.000e+00UniRef50_A0A2N2DFA7 Agmatinase n=4 Tax=Firmicutes TaxID=1239 RepID=A0A2N2DFA7_9FIRM  ali  31  4...........................CDTYESADTVIVGVPMDFTASYRPGSRFAPQAVRNVSYVLEEYSFYLDRDL---ADYRFYDWGDINLPIGNVGESLNRINRVAARLFADGKFPVFIGGEHLISYPVISEACKKNPGLAVIQFDAHADLRSDYEGNSHATVMRKACE--VIGSGNLYQFGIRSGTREELEYAK-TNTNLYTDAVLEPLMEVAKTLAGRPVYVTVDIDVADPAFAPGTGTPEPGGISSRELISAVHALRDLDIIGMDVVEIIPSIDPSERTAVLGAKIIREAILGFTKRSG 278
94 0.000e+00UniRef50_A0A2H5YU77 Guanidinobutyrase n=4 Tax=Bacteria TaxID=2 RepID=A0A2H5YU77_9BACT  ali  33  62.............FSNSGTFLRVPFLRDRELGGQDVAFVGVPLDTGTTFRSGTRWGPEAMRRISSL--SGGANLVLGVDLVESLTMVDVGDVSVIPANIEKSFDQIDKAIGYIIERGVFPVVLGGDHSIGYPDIRGLARIDGNVGIIHFDRHSDLEYNMDERMHGTPFFHATNIPNAPPTNLVQIGIGGWTARERKATVITIDDIDRYGIERICEYALEIAWKRCVYLSFDIDCMDPAFAPGTGTPEPGGLLPREVFQMLRLIAREGLVGMEVVEVSPPYDVADVTSLLGTRVIMEVLGTLVLNR. 364
95 0.000e+00UniRef50_A0A0D2XKS3 Uncharacterized protein n=1 Tax=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) TaxID=4  ali  36  574.............FGGIGTFAHLNHVKCLPTEPYDIAIIGAPFDTAVTYRPGARFGPRSIRHASRQHSLRGYNPRADINPYQWAKIVDCGDIPITPIDNDIAQKQMTQALEQLISSKPKLFTLGGDHSLTLPALRALKKVYGDIQVLHFDAHLDTWNPHTPFNHGSMFWLANQEGLLSNHPSVHAGLRTRDDTAQNWIRFSADDIDKIGTQGIIGGIMKLLGTENVYLSVDIDVLDPAFAPGTGTPEPGGWSTREFINILRGIEDLNLVGADVVEVSPVYGAGEETTFAAAQVVYEILTSMVKR.. 899
96 0.000e+00UniRef50_A0A2I0QP90 Agmatinase n=8 Tax=root TaxID=1 RepID=A0A2I0QP90_9EURY  ali  35  9...........................NSEKEDADVCIFGMPFDSTTSFKPGTRLGPRAIRDASYNLEFYSMALERNI---RDIKIFDAGDTGF-YTNPQHAISEISEQTRELLKSDKFIVGLGGEHTVSYGIAHAMKEIYKDVAVIQFDAHADLRYDFEKFSHACVMNLIGND--IGFENIYQFGIRSGEEEELKFAEKTNFPLHKYDTAQILEILDELNIDKKVYLTIDIDVLDPAYAPGVGTPEPGGITSNEMFKILNSLKKFDIVGFDVVEVNPMVDMSGITAMLAAKIIRE.......... 274
97 0.000e+00UniRef50_A0A1C7LUZ8 Putative agmatinase 1 n=1 Tax=Grifola frondosa TaxID=5627 RepID=A0A1C7LUZ8_GRIFR  ali  36  315.WLKKYGKQIDQVFSGPLSFSHLPYFRCLEDVNADIALLGMPFDTAVTYRPGARFGPYAIRSGSRRQRDRGYTLAWRNNPYAQSKIIDCGDVPVNPFDNALAVDQMEVAYSTLLARHPRIISLGGDHTIVLPILRALHKVYGPISVIHFDAHLDTWPSYSRVTHGTFFYLAQEEGLMSNT-SIHAGIRCKLAGE-DYSAHS----------------RARVGDSPVYLSLDIDVIDPGLAPATGTPEAGGWTTREVKRIIRGLAGLNFVGADIVEVAPAYDNAEITGIAAADIVHDFLSMLLA... 631
98 0.000e+00UniRef50_A3LWL7 Agmatine ureohydrolase (Agmatinase) n=37 Tax=saccharomyceta TaxID=716545 RepID=A3LWL7_PICST  ali  35  46.......WDDLWPFQGINTFAHLDHHKCLPGNTYDVALIGVPFDTAVSYRPGARFGPRAIRAASRQTSLRGYNQRANFNPYSWAKIVDCGDLPITPMDNSIAFTQMTKGFEELLLRRPRYVALGGDHSVLLPHLRALHEVYGRINVIHFDAHLDTWSDQSEINHGSMLWKAHHEGLTSHHN-VHAGLRTEDDDSQHFIRIDADDIWLKGPQWVVQKILDTVPDDPTYISVDVDVLDPGFTSGTGTQEPGGWLPRELLHVLRSIEGLTVVGGDVVEVSPAFDTAEITSTNGAQIAFEIITSMVKK.. 373
99 0.000e+00UniRef50_A0A254WWD7 Agmatinase n=1 Tax=cyanobacterium TDX16 TaxID=1503470 RepID=A0A254WWD7_9CYAN  ali  27  44.PPTPKPAGARPLETIPDNFLGLPSRYC-DPKKARYAILPLPYDGTVSYQTGTRNGPRAIITASQQVELFDEEYCKE---FTAAGVMTCDPVAPEMAGPKEMHESVYQAARQVLAKKKFLIALGGEHSLTSGLVRAVKQKHKKLSVLQIDAHADLRAEYEGYSHAAVMRRVVEMGI----PVVAVGIRNYSLGEHQFMKKHGREVRTN--ADWLQQVVERL-TDNVYVTIDIDGFDPAYAPGTGTPEPGGLDWFQVTDLLKATAMRNIVAADVVEVLPQPGTAQ-TEFLAAKLVYKLIAHIEANR. 344
100 0.000e+00UniRef50_S8EF51 Uncharacterized protein n=3 Tax=Polyporales TaxID=5303 RepID=S8EF51_FOMPI  ali  37  15...............GLTTFAAAPPLRCDSETSYDIAVLGAPFDTTTSYRPGARFGPNGIRQGSRRIHVSSININMKSRISDDLDVVDCGDVPMVYTDNKVALRQLEAANKSIAKDGKFVLTLGGDHTITWPLLRGVHDIYGPVSVIHFDSHLDTWEPGEEISHGSYFYYAHKEGLLAPDNNIHVGIRSPNDYEVGFVISHADEMEEIGWRGVVKKIRETVGDNPVYITFDIDAVDPGSAPATGTQEIGGITTREIKKIMQGLTGLKIVGADIVEVAPGYDTAELTQIAAANIGWDILALMAK... 344
101 0.000e+00UniRef50_A9GKY1 Agmatinase n=11 Tax=Myxococcales TaxID=29 RepID=A9GKY1_SORC5  ali  38  12..............HGQTPFFRLPEAGASAYSGADAVLLGVPWDGSVTYRPGARFAPYELRRVSALVQSYHPGHGVDV--FRAIHVLDGGNVPFPPFHADSVRELIQASVDEVLAAGAVPFVVGGDHSIALPVLRALSRRHGPVTVVHVDAHLDTSTWGEPFHHGTPFRNAIEEGLIGRSALHQIGIRATWPEEAGATLYGMDRIDRDGASAIAAAIRAAAGESPVYVSFDIDGVDPAYAPGTGTPVPGGLTSREAIQLLRGLAGINLVGMDLVEVCPALDHADITLHLGAHLLFEGLALLATRKG 317
102 0.000e+00UniRef50_I4Z1M5 Agmatinase n=5 Tax=Bacteria TaxID=2 RepID=I4Z1M5_9RHIZ  ali  34  44............PFAGIPTLLDAPYRADPDFGGLDVALVGVPMDLGVTNRNGSRFGPRAVRTI-ERVGPYDHVLRC--APFSKARIADIGDVPMSRYDLALCHADIEAFYKRLVEAGVRPLSVGGDHSISSSILKAVGER-QPVGMIHIDAHCDTAGPYEGFQHGGPFRLAVLDGVLDPERTIQIGIRGGFSYESGMTVIHAEEVPRIGIEALIERTRAVVGDGPTYLSFDIDSVDPGFAPGTGTPEVGGLTPREVLELLRGLKGINFVGGDVVEVAPQYDATTNTAHVAAQVLFTILCLMVG... 343
103 0.000e+00UniRef50_Q5WB32 Agmatinase n=349 Tax=Bacteria TaxID=2 RepID=Q5WB32_BACSK  ali  34  17............................ASYEEADAVIYGMPMDWTVSFRPGSRFGPARIREASLGLEEYSPYADKHL---EEINYFDAGDIPLPFGNAARSLDIVEEYVDSLLADGKFPLGLGGEHLLSWPIFKAMYRKYPDLAIIHIDAHADLREQYEGLSHSTPIRKACE--LIGAENVYSFGIRSGMREEFAYAKEAGMHLYKFDVAEPLKNVLPHLSGRPVYITIDIDVLDPAHAPGTGTAEAGGITSKELLEA-QMLADIQIVGADLVEVAPAYDPTEQTAIAASKFVREMLLGWVHKR. 292
104 0.000e+00UniRef50_A5GWX2 Agmatinase n=487 Tax=root TaxID=1 RepID=A5GWX2_SYNR3  ali  30  60.....FSRGELPHYAGINTFMKAPYLEDVNVGEFDVAVVGIPHDCGTTYRPGTRFGPQGIRRISALYTPYNYEM--GVDLREQITLCDVGDVFTIPANNEKSFDQISKGVAHVFASGAFPILLGGDHSIGFPTVRGVCRHLGDVGIIHFDRHVDTQEDLDERMHTCPWFHATNMANAPAQNLVQLGIGGWVCRERGTNVLTVTDITEMGLEAAARYAIERAGTDCVYISFDIDCIDAGFVPGTGWPEPGGLLPREALKLLELIRNVPVCGLELVEVSPPYDISDMTSLMAARVICDTMAHLV.... 369
105 0.000e+00UniRef50_A0A2K0UGA6 Uncharacterized protein n=3 Tax=Trichoderma harzianum TaxID=5544 RepID=A0A2K0UGA6_TRIHA  ali  36  44.............FSGISTFNHLPYSRCLRSEIFDIAVVGVPFDSLTTYRSGAREGPKAIRWASRHLSGRSFHPSLHFNPYEWASVLDCGDIPVVPIDPVLAMQQMGEALVELLSRHPRLVLLGGDHSIVLPMLRALHKRQEPVALLHFDAHIDTMDPDSEIHHGTVFWQAAQEGLLLPGHLVHAGVHGHSDNSLGFLRIPVEEMDDEGADAIIKKIHDTIGEDPVYVSIDIDVLDPAFAPGTGAPETGGWTSREMMRIMTVLSKLDVVGLDIVEVTPAYDSAGGTAFAAANIAYEAISMMVQK.. 369
106 0.000e+00UniRef50_A0A2T3YXI3 Uncharacterized protein n=1 Tax=Trichoderma asperellum CBS 433.97 TaxID=1042311 RepID=A0A2T3YXI3_9HYPO  ali  37  44.............FSGISTFNHLPHSRCLRSEAFDIAIVGVPFDSLTTYRSGTREGPKAIRWASRHLSGRSFHPSLHFNPYEWAKVLDCGDIPVVPIDPVLAMEQMGEALTELMSSHPRLVLLGGDHSIVLPMLRALNRRKEPVALLHFDAHIDTMDPDSEIHHGTVFWQAAQEGLLIPGHLVHAGVHGHSDDSLGFLRISVEEMDDEGPNAIIKKIHDKIGEDPVYVSIDIDVLDPAFAPGTGAPETGGWSSRELMRVMTVLSKLHVVGVDIVEVTPAYDSAGGTAFAAANLAYESISMMVQN.. 369
107 0.000e+00UniRef50_C4JD76 Uncharacterized protein n=61 Tax=Fungi TaxID=4751 RepID=C4JD76_UNCRE  ali  34  49...........SQFSGLSTFAHVPYVNCAEKEKYDIAFLGAPFDTGVTARPGARYGPGGIRQGSTRMSAWNIYTGVN-NLLSWAKIVDCGDAPLTFLDNTIALKQLDKAHKVISSRVPRIITLGGDHTTTLSALRSTYEKWGPVSVIHFDSHIDTWDPYAGVNHGTFLHIAHEEGLIRND-SIHVGIRAPNDIRCGFDMITARDIDLIGTSGIIQKIKDRVGSNNVYISVDIDVLDPAYAPATGTAEPGGFSTRELLTIIDGLRGLPVIGGDVVEVAPIYDTGETTVLAAAEIANSLLGLMIA... 374
108 0.000e+00UniRef50_V2X2K0 Agmatinase 1 n=17 Tax=Agaricomycotina TaxID=5302 RepID=V2X2K0_MONRO  ali  37  48........TADAVFSGITTFAKLPWVQCFGKERFDIAFLGAPFDTGTSYRPGARFGPAGIRAGSRRLTLYGYNVPLGTNPFSGLRIVDCGDIPVTPYDNKYAIKQIEDGHKSLLKHHPRIITLGGDHTIVLPLLRSIYTAYGQISVIHFDSHLDTWSDQAAINHGTYFYWASQEGLIKNGSSIHGAIRTTNDDASGFLRIEAREIDIIGTDGIIQKIRETVGNAPVYLSIDIDSIDPAFAPATGTPETGGWSTRELRTILRGLDGLHIVSADIVEVAPAYDTNELTTMAAADVLFEVLTVMTK... 390
109 0.000e+00UniRef50_Q2T3W4 Agmatinase n=267 Tax=root TaxID=1 RepID=Q2T3W4_BURTA  ali  43  17.....YGSSIENTYAGVLSFMRRNYTRDLDGVDVVVSGV--PLDLATTFRSGARLGPSAVRAASVQLAELNP-YPWGFDPFDDLAVIDYGDCWFDAHHPLSIKPAIVEHARTILQSDARMLTLGGDHYITYPLLIAHAQKYGPLSLIHFDAHCDTWDAPDSLNHGTMFYKAVKDGLIDPKASVQVGIRTWNDDYLGINVLDAAWVHEHGARATLERIESIVGGRPAYLTFDIDCLDPAFAPGTGTPVAGGLSSAQALAIVRGLGGVNLIGADVVEVAPAYDQSEITAIAAAHVACDLLCLWRQRK. 316
110 0.000e+00UniRef50_A0A1B7ITN7 Agmatinase n=516 Tax=root TaxID=1 RepID=A0A1B7ITN7_9ENTR  ali  32  3.NNNYETGRLNLPFVGHCTFAKSPVCLNWEEIDADVAILGAPNDMGTQWRAGSRFGPRGIREASTLFSFYDHEDDALYLTQDQVRMVDVGDADIVHTDMVSSNANIELAVRKILASGAMPVVLGGDHSIHAPVIKAYAGR-GPIHIVHFDAHLDFVDERHGYGHGSPLRRASEMDHIVG--MTQLGIRNVSARAAGSNILSVRDVRRLGTEAVLAQIPE---GCNYYLTIDIDGFDPSIAPGTGTPSHGGFQYYEVLEIIQALAKRNIIGMDLVEVAPAYDPTGVTSILAAQLLMNSIGFIFYER. 319
111 0.000e+00UniRef50_A0A084YY28 Proclavaminate amidinohydrolase n=53 Tax=Bacteria TaxID=2 RepID=A0A084YY28_9GAMM  ali  30  4..NSYETGRLNLPFVGHCTFAKSPVCLDWNNIDADVAILGAPNDMGTQWRSGARFGPRSIREASTLFSFYDHEDDTTYLTSDQVRMVDVGDADIIHTDMEGSNANIEFAVRKILESGAMPVVLGGDHSIHAPVIKAYAGR-GPVHIVHFDAHLDFVDERHGYGHGSPLRRASEMEHIVG--MTQMGIRNVSARNAGSQILSVRDVRRLGTEGVLDCIPA---GTAYYITIDIDGFDPSIAPGTGTPSHGGFTYYEVLEIIQALSKRNVIGMDLVEVAPAYDPTGQTSILAAQLLMNSLGFIFHDR. 319
112 0.000e+00UniRef50_A0A0D6FIK0 Guanidinobutyrase n=101 Tax=Bacteria TaxID=2 RepID=A0A0D6FIK0_ALCXX  ali  37  38.....DSGTRSAPYAGMPTLLDAPARTQPDFGDLQVALLGVPMDLGASNRSGCRFGPRALR-AIERVGPYNHVLKC--APVRELRVADIGDVPMSRYSLEQSHEDIHAAYEKLVAAGVAPLSVGGDHSVTLPILRALGAR-QPVALVHFDAHCDTGFDGSRFHHGGPFRQAVLEGVLDPTRTIQIGIRGSFSYESGMTVIHAEDIPRLGVDAIIAQARAIVGDAPVYVSFDIDCLDPAFAPGTGTPEVGGVTVREAQAMLRGLAGLDIVGGDLVEVAPSYDATANTAHAGAQILFEILSLMRLR.. 345
113 0.000e+00UniRef50_A0A139AWW5 Arginase/deacetylase n=2 Tax=Fungi TaxID=4751 RepID=A0A139AWW5_GONPR  ali  36  6.........................CIDENAEKFDIGVLGIPFDTAVTYRPGARFGPAAIRTGSRRIQYAGYDTNWGFSPFSWAKVVDCGDLPITGFSNTKAYDQMYRGYLHLITRHPRYVTFGGDHSISYPILKALHEVYGPIAVLHFDSHLDTWTKEEELHHGTMFWHAWRDGLTQHGKNVHVGIRTRDDKKFGWKIIEFVEYYKLGIDGIIREIKETIGEAPCYLSLDIDVVNPGEAPATGTIEPGGFLAREIQAILRGLNGLNIVGADVVEVAPVYDHAEITATLAANLAFDMLATMVKR.. 311
114 0.000e+00UniRef50_A0A0F9QK96 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=A0A0F9QK96_9ZZZZ  ali  40  5............PFAGIKTFLKQPI-YTPDKDDGGIGIVGAPFDLGTSNRPGARFGPDAIRRASAMLEGDDPHYK--LNPVEVLDIWDCGDIDTSV-DIAACVEEIELDIHTWGLEFDQLVTLGGDHTITLPILRALHAKHGPVRLVHFDAHCDTWVGDGNYGHGSPFYYAINEGLIIPEESTQIGIRSAFAEDAGMQIFTARDVHEMGPSEIAHRTTKKGHWTPTYLTFDIDSIDPSQAPGTGTPEVGGIFTWQALAILDDITSLDWVGMDVVEVAPAYDVSEITSLTAATIIWHYLCILSQRK. 302
115 0.000e+00UniRef50_F2LTM0 Agmatinase n=7 Tax=Desulfurellaceae TaxID=117942 RepID=F2LTM0_HIPMA  ali  31  4........................YCSIHEIKKTKTVLVGVPYDGTSTYRPGSRFAPQAIREASYGIESYSPYQDKDL---RDIRFYDIGDIPLSYGDKELNLKLIEAFIIKLIMKGKKTLALGGEHLITYPLIKAYAKKYKEFAIVQLDAHSDLIDSYRGLSHATVMRRCSE--IVGFENLYQLGIRSMVEED---KLLPHRDVN-MGLFDLAEEFLKRIGDKPIYLTVDLDVLDPSIFPGTGTPEPGGITYKEILSFLKLLRQKKIIGADVVELSPHYDPTGVSSVVAASIVREILLIM..... 275
116 0.000e+00UniRef50_A0A0W0SCJ6 Agmatinase n=7 Tax=Legionella TaxID=445 RepID=A0A0W0SCJ6_9GAMM  ali  39  1MSNNDPASQKSVPYEGITTFFRSEYTRNL--QGVDLAVYGVPFDLSTFNRSGARFGPRSIRDLSCYLSILGTCWPHTYRLNEKFKIIDYGDIGFFPGQINHMLENVEGAINELCSHGIFTLGLGGDHLVAYPAIKALAGKHGKLSLIHFDAHTDTVQMPH-LTHGSMFYYAAKEGLIDPEYSVQIGIRTSVPETPKLHVITANQCFQMGSQGVVEQIKKIVGDRKCYISLDVDCMDPAFTPGTGTPMPGGLSSAMQREILWGLVGLNMVGGDVVEVSPPYDVAQTTALVGATVAIDMLHILGDAK. 307
117 0.000e+00UniRef50_A0A0U5ARI7 Agmatinase n=52 Tax=Firmicutes TaxID=1239 RepID=A0A0U5ARI7_9BACL  ali  31  5..........NPSYSG-----HAFIEAQSTYEDAKAVIYGMPMDWTTSFRPGTRFGPTRIREVSINLETYSPYADREL---EEIAFFDAGDIPLPFGSAQRSLDAIEEYVRKVVADGKFPIGLGGEHLVSLAPIKVMAEKYPDLVIVHIDAHTDLRHEMEGLSHSAIIRRALD--YVKPENVYQFGIRSGLKEEFQFAKENMH-LNKFKVIEPLKACLEELKGRPVYVTYDIDAVDPAYAPGTGTAEPGGISAADAIESIYLLSELNVVGFDLVEVSPVLDQSERTQILASKMIREVLLTMIK... 288
118 0.000e+00UniRef50_A0A0U9HJ14 Agmatinase n=8 Tax=Firmicutes TaxID=1239 RepID=A0A0U9HJ14_9THEO  ali  34  8..............SGHNGFLGAK----EDYDRAKIVIIGAPMDFTVSFRPGTRFGPERIRSVSYGLETYSVYAD---DALDDKSFCDIGDIELPFGNVKKSLDMIEEAANKILNDGKIPFFLGGEHLVTYPIVKKVAEKYPDLVVLHFDAHADLRDFGEKLSHATVLRRVSEQ--VKNKHIFQFGIRSGVKEEFLYAQQHTN-MYPLEVKTPFLQVLDSLKGKPVYITLDIDAVDPAFAPGTGTPEPGGCTSCDILEVVASFGKLNVVGIDLVEVSPASDLSDRTALLAAKIVRETIIGI..... 286
119 0.000e+00UniRef50_E9EAG6 Agmatinase n=2 Tax=Metarhizium TaxID=5529 RepID=E9EAG6_METAQ  ali  38  27.............FSGISTFNHLPHSRCLRSEVFDVAIVGVPFDSLVTYRSGAREGPKAIRWASRHLSGRSFHPSLHFNPYEWALVLDCGDIPVVPNDPVLAMEQMGEALTELLSSHPRLVILGGDHSIVLPMLRALNRRKEPVALLHFDAHIDTMAPDSEINHGTVFWLAAQEGLLRPGHLVHAGVHGHSDESIGFLRIAAEEMDDVGPAAIIQRIRNTIGDAPVYVSIDIDVLDPAFAPGTGAPETGGWTSRELMKVMTVLSDLNVVGVDIVEVSPAYDSAGGTAFAAANLAYEAISLMIQR.. 352
120 0.000e+00UniRef50_W7A3G5 Uncharacterized protein n=13 Tax=Fungi TaxID=4751 RepID=W7A3G5_COCMI  ali  34  47...........AKFAGLTTYASLPYVHCLAPEGFDIAILGAPFDTAVTGRPGTRFGPGGIRAGSRRMGPSWSIYTGENVFFDWAKIVDCGDAPLTFLDNTVALKQLDKAHEIISSRDAKIITLGGDHTTTLPALRSAHNHWGPVSVIHFDSHIDTWDPYAGVNHGTFLHIAHEEGLIRNT-SIHAGIRAPNDIRCGFDMVKARDLDRIGVSGIIETLKARVGDSKVYISVDIDVLDPAFAPATGTAEVGGWSTRELLSILDGLAGLDVIGADIVEVAPIYDPGEPTVLAAAEIVLSLITLMVK... 370
121 0.000e+00UniRef50_A0A0F9XKL2 Arginase n=1 Tax=Trichoderma harzianum TaxID=5544 RepID=A0A0F9XKL2_TRIHA  ali  36  472.............FSGISTFNHLPYSRCLRSEIFDIAVVGVPFDSLTTYRSGAREGPKAIRWASRHLSGRSFHPSLHFNPYEWASVLDCGDIPVVPIDPVLAMQQMGDGLFELLSRHPRLVLLGGDHSIVLPMLRALHKRQEPVALLHFDAHIDTMDPDSEIHHGTVFWQAAQEGLLLPGHLVHAGVHGHSDDTLGFLRIPVEEMDDEGADAIIKKIHDTIGEDPVYVSIDIDVLDPAFAPGTGAPETGGWTSREMMRIMTVLSKLDVVGLDIVEVTPAYDSAGGTAFAAANLAYEAISMMVQK.. 797
122 0.000e+00UniRef50_K5V0H8 Uncharacterized protein n=25 Tax=Agaricomycotina TaxID=5302 RepID=K5V0H8_PHACS  ali  40  69.............WNGLTSYAGAKPLRCFGDDAYDVAVLGAPFDTATSYRPGARFGPNGIRQGSRRIRIEGINVPMKLRISDHLDVVDCGDVPMVFVDNKVALRQLESGAKSIAKDGKFVLTLGGDHTITLPLLRGVAEVYGPVSVIHFDSHLDTWDEEIPVSHGSYFYYAYQEGLMAANQSIHVGIRGWEDEEVGFQISYAEDIEEVGYQGIVDRIKEVVGENPVYITLDIDVLDPSFAPATGTPEIGGFTTREIKKILHGLSDLKIVGADIVEVAPGYDTDEITQIAAANIGWEMLALMAK... 407
123 0.000e+00UniRef50_A0A2N0MJ83 Agmatinase n=1 Tax=SAR202 cluster bacterium Io17-Chloro-G9 TaxID=1926618 RepID=A0A2N0MJ83_9CHLR  ali  33  1MWPERADWQGGSSFNSLFPFMDIPATRDLS--NADYAILGLPFDGSTLLRPGARFGPRAIRAAFSLLDRYSDNPQQRDPPYSQLRVVDYGDAPLVSYHPEETLARTQQAVETLLGADVQPICLGGDHSLSLGCVRACAAKYGPLALVMLDAHPDFWTSPPNLTHSNWLRVAVEEGAVDPNRCIHVGFRTILDRASNITVVTTDDVRRLGVGHALEAIRKVVGES-LYISLDIDCVDPAFAPGTGVPEVGGFTSIEILELVRGLKGLPVVGFDVMEVSPAYDHAEITALLAATLVYEYL........ 304
124 0.000e+00UniRef50_A0A0F7SKD8 Arginase deacetylase n=1 Tax=Phaffia rhodozyma TaxID=264483 RepID=A0A0F7SKD8_PHARH  ali  36  412.WLEKFGSAGDLSFTGVPSFAHLPHIRCLEEADFDVAVFGLPFDSAVSFRPGARFGPFGIRSGSRQLPARGWNVALGTNPYSGAKILDCGDAPITPYDPALAIEQIEAAYTSLLKTHPRIVSLGGDHTIVLPILRSLHSVWGPITVIHFDAHIDTWNPQSQINHGTFFWKAYEEGLLRGNSSIHAGVRTRDYEDAGFELIHTFDIDRFGVDHIIKTIRDRVGTNPVYLSFDIDVIDPSMAPATGTPESGGWTTREIRRIIHGLKGLNFVGFDLVEVSPAYDTNELTNIAAADLIFDFLSIM..... 751
125 0.000e+00UniRef50_UPI000D80591F Arginase/deacetylase n=1 Tax=Acaromyces ingoldii TaxID=215250 RepID=UPI000D80591F  ali  37  72...NLDTPAGDSIFSGLGTFAHLPFGACLSPDSFDIAVVGMPFDTAVSFRPGARFGPSGIRHNSKRMSFRGYNVPLGVNIYEGQKILDCGDIPVTAFDNNLAVKQMQRGYTSLLQRGKKPITLGGDHTLVLPVLRSLETVYGPVSVIHFDSHLDSWDPGSTINHGTFFWHAANEGLIRNGSSTHAGIRTDTDKQCGFSLQEAHVIDDIGIKGIVKNIRKAVEGNPVYLSIDIDVLDPSAAPATGTPETGGWTSRELRKILRGLDGLDIIGADVVEVAPAYDNAALTQMVAADLVFEILGLMVKR.. 428
126 0.000e+00UniRef50_E2CP87 Agmatinase n=74 Tax=Bacteria TaxID=2 RepID=E2CP87_9RHOB  ali  34  5.FFHPISGFELPRFAGVPTFMRLPHVPLERIGDVQIGLVGTPWDAGTTNRPGPRHAPRQLRDASTMIRAQNGAT--GIRPFEMVNCADLGDVGPNPASLKDSLARITACYERLVQKSIRPLTAGGDHLCSLPILRALA-QNKPLGMIHFDSHTDLFHSYFGYTHGTPFRRAVEEGLLDPKRVVQIGIRGYDDEDRGIRVIPIEEFHARGPEDVMVEAKEIAGTGETYVSYDIDFVDPAYAPGTGTPEVGGPNSYQALQVARMLDGVNIVGADMVEVSPPFDQSGATAYLGVSIMFEILCNMALSIG 319
127 0.000e+00UniRef50_A0A2P4HD27 Protein DETOXIFICATION n=2 Tax=Quercus suber TaxID=58331 RepID=A0A2P4HD27_QUESU  ali  36  887......GTQADSVFSGISTFGRLNYHPCLDAHKYDIAFIGAPFDTGTSYRPGARFGPSGIRQGSRRLNLY------------WAKVIDCGDIPVTSYDNAYALQQIEEGHNSILKKGKRVITLGGDHTITLPLLRSMNRAYGPITVIHFDSHLDTWSHQAAINHGTYFYHAAQEGLMRNDTNMHAGIRGLSDYECGFEISEAREIDTIGTEGILKKIHDRVGHKPVYLSIDIDTLDPAFAPATGTPETGGWSTRELRTIIRGLEGIQLVAADIVEVAPAYDTNELTTMAAADVLYEVMTLMVKN.. 1210
128 0.000e+00UniRef50_UPI000688AB93 agmatinase n=1 Tax=Ensifer aridi TaxID=1708715 RepID=UPI000688AB93  ali  31  10.....TDVTVVPRFSNIATFMRSAHVPLSSEL--DIAISGVPFDLGTAFRIGSRFGPACVREQSRHVRR--IHQTFGFSPFDLCRVADVGDAPVRSFSIRDSLALIEDHFRKIKDLEITPLTIGGDHTISLPILRGIV-QHGPIGLIHIDAHSDTLDSIQGYCNGTPFRRAVEEGLVDPKRLVQIGIRETWAKANGIRMISMNEIDQRGLEAIVEETRSIVAERPCYLTLDIDSLDPSVAPGTGAVEPGGFTVREMERLLEGLMGVDLIGADIPEVSPLYDEGGRTGRVAATLAFDLLCLLAK... 312
129 0.000e+00UniRef50_A0A2H0PND1 Agmatinase n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_45_16 TaxID=1973974 RepID=A0A2H0PND1_9DELT  ali  36  1MSFKIPDARQFPRYSGVCSFFRFPL--SPQPRKVDWVLYGVPFDFGTSYRPGARFGCRSIREQSAYIKPYHLFYKEDLR--ERFSIVDGGDAPVAPYDLEKNLSLHEEFSSAWRAQDAKTFAIGGDHSISVGNMRATSKALGKLACIHFDAHTDTRLWDNAYTHASPIRRGVEEGWLDPKKSVSIGIRGPWGRDQGLEYICIEDFREKGLD-LLRAFKKKIGNDPVYLTFDIDCMDPVFAPGTGTPAIGGFTTAEIISALRVFKGIQLVAADMVEVAPGLDPTQVTSLLAAHLVFEILCL...... 308
130 0.000e+00UniRef50_F0T7F0 Agmatinase n=2 Tax=Methanobacterium lacus (strain AL-21) TaxID=877455 RepID=F0T7F0_METLA  ali  31  1MNFN--DIESRFPYIGVSTFYGYPNSKDLN--ETDVAIVGVPFDHGTTNRPGARFGPRSIRTASQNYGIYLNEFGLKRNILGGVNIVDYGDVPILPTHTKTNMKMINSTFKKIVDAGVFPVAFGGDHTVTYPIVKAFKK---PLDIVHFDTHLDFVDGTEKFSHSNPLKRVSEIENIN--NITQIGIRGFTDKNYGSKIITASEVMDRGTAWVLDQIPE---SDNIYVTLDIDVLDPSIAPGTGTPEPGGLTYNQLKDILTNLTNKGILGFDLVEVNPLFDLSEITSLTAARLCFDFLGSIF.... 306
131 0.000e+00UniRef50_Q81JT1 Agmatinase n=646 Tax=cellular organisms TaxID=131567 RepID=SPEB_BACAN  ali  35  17............................PSFEESEVVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSPYLDREL---EEVKYFDAGDIPLPFGNAQRSLDMIEEYVSKLLDAGKFPLGLGGEHLVSWPIFKAMAKKYPDLAIIHMDAHTDLRESYEGLSHSTPIRKVCD--LIGPENVYSFGIRSGMKEEFEWAKEVGMNLYKFDVLEPLKEVLPKLEGRPVYVTIDIDVLDPAHAPGTGTLEAGGITSKELLDSIVAIANSNIVGADLVEVAPVYDHSDQTPVAASKFVREMLLGWVK... 290
132 0.000e+00UniRef50_K4Z987 Agmatinase SpeB n=58 Tax=Firmicutes TaxID=1239 RepID=K4Z987_PAEAL  ali  32  13........................ICSSDDYEGAKAVIYGMPMDYTVSFRPGSRFGPGRIREASVGLEEYSPYLDRSI---EELNYFDAGDLLLPFGNAAKSLDIIGEFVGKLLSDGKFPIGLGGEHLVTWPVLQEVYKKYPDLAIIHIDAHADLREQYEGLSHSTPIRKAAEM--IGGKNVYQFGIRSGSREEWTYARENIN-FFPFDVAEPLKKVLPELAGRPVYVTIDIDVLDPSCAPGTGTAEAGGITSKELLEAVHSIARSNVIGCDLVEVAPIYDPTEQTPITASKIIREMLLGFVK... 289
133 0.000e+00UniRef50_P70999 Agmatinase n=355 Tax=Bacteria TaxID=2 RepID=SPEB_BACSU  ali  32  13........................IASRPEWEEADAILYGMPMDWTVSYRPGSRFGPSRIREVSIGLEEYSPYLDRDL---ADLNFFDAGDIPLPFGNPQRSLDMIEEYVDSILEKGKFPMGMGGEHLVSWPVIKAMYKKYPDLAIIHFDAHTDLRYEGEPLSHSTPIRKAAE--LIGPHNVYSFGIRSGMKEEFEWAKENGMHISKFEVLEPLKEVLPKLAGRPVYVTIDIDVLDPAHAPGTGTVDAGGITSKELLASVHEIAEVNVKGADLVEVAPVYDHSEQTANTASKIIREMLLGFVK... 290
134 0.000e+00UniRef50_K4LDU9 Agmatinase SpeB n=16 Tax=Bacteria TaxID=2 RepID=K4LDU9_THEPS  ali  35  18.............................SYKEARLVLAGLPLELTVSFRPGTREGPQAIRAASQGLEEYSPYLREDLN---DHLIFDCGDLALPFGNLQVAFQRIEALCRVLLADAKIPVFLGGEHLITFPVVKTLAEAYSGLKVLHFDAHADLCDDYEKYSHATVIRRVCE--IVGAGNVYQFGIRSGTKEEFEYTVFYPFEILPG-----LESCLQSLEGHPVYVTVDIDVIDPAYAPGTGTPEPGGVTPQELFRVFELLEGCRIVGCDFVELAPVYDRSGITSLLAAKLVREAL--LAFSRG 288
135 0.000e+00UniRef50_A0A1G8S5T5 Agmatinase n=4 Tax=Bacteria TaxID=2 RepID=A0A1G8S5T5_9RHOB  ali  44  28...........ASYAGALSFMR--RRYTKDLSGADVAVMGVPFDLAVSSRTGTRLGPRAVRSGSSHIA-WSAPWPWTLDPFEALSIVDYGDCELDTGYPHKVPGQITEAARAVLAQETALLSIGGDHYITYPLLKAHAEKFGPLSLIQFDAHTDTWDEPDRIDHGTMLWHATREGLVDPSTSVQIGIRTHNPEPLGFNIIDAIEVQRLGPQAVVEKVRAIVGARRCYLTFDIDALEPASAPGTGTPVIGGLSPFQAQEILRGLEGIDLVGMDVVEVAPSYDVSEITAIAAATIANDLLCLYAAAR. 319
136 0.000e+00UniRef50_A0A2E7HH87 Agmatinase n=1 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A2E7HH87_9PROT  ali  41  13..DSLYGTSDDRTYAGALSFMR--RCYTKSLVGADVVVSGIPYDIGTTNRAGTRFGPRAIRQASSHIA-WGPQWPFDFDPFHRLAVIDWGDHDFDIGCTEGMMASVEASTATFLEAGCFPMTMGGDHLVTYPLLKAVAKQHGKLSLVHFDAHTDTSKS-DKLNHGTMFWHAMRDGLIDPGRSIHTGIRMAVGWDDGFDKIGGWDAARLPAKEIGQRIRDVVGKNKAYLTFDIDFLDPAYAPGTGTPVVGGPTTMQALDILMELRGINFVGMDLVEVAPEHDNGEITSLAGASMMYHVLHLLAENR. 312
137 0.000e+00UniRef50_A0A2D9LMI3 Agmatinase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2D9LMI3_9CHLR  ali  32  12.....NSDADMPSFVGVSTFLQSPLIQTPEGLKVEVAIMGAPFDMGVVNRPGARFGPRAIRQAGYFGAPNDYHMGLQVYPTDVLSVADFGDANCPPSSLERSHEAIQAKVSQCLKAGALPIVVGGDHSITLPSATAVANHYGPVGIVHFDAHADTAPTYGGVSHSSPMRRLIEDGIVQGKNFVQVGLRGYWPREQGMRWHQMSEIETRGFDPVLDDAISEALDGPIYLSVDIDVLDPAFAPATGTPEPGGLTSVELLRAVRTIVGSETVAADVVEVAPDYGPANITAEAALRVILEILSSLANKK. 333
138 0.000e+00UniRef50_C5PF24 Agmatinase, putative n=45 Tax=saccharomyceta TaxID=716545 RepID=C5PF24_COCP7  ali  34  44.....IDIVTGSQFSGLSTFAHVPYVNCAEKEKYDIAILGAPFDTAVTARPGARYGPGGIRRGSARMRAWSVYSGVN-NLRSWAKIVDCGDAPLTFLDNTIALKQLDKAHKVVVSSVPRIITLGGDHTTTLSALRSTYEKWGPVSVVHFDSHIDTWDPYAGVNHGTFLHIAHEEGLVQN-NSIHVGIRAPLVRECGFDIVTARDIDMIGASGIIEKIKNRVGSDNVYISVDIDVLDPAFAPATGTAEPGGFSTRELLTILDGLSGLRVIGGDVVEVAPVYDTTGTTVLAAAEVANSLLGLMIAK.. 376
139 0.000e+00UniRef50_K9NHJ4 Agmatinase n=239 Tax=Bacteria TaxID=2 RepID=K9NHJ4_9PSED  ali  31  1MSNNGYSGRLNLPFVGHCTFGKSPVCTDWDALDADVAVLGVPNDMGTQWRSGARFGPRGIREASTLFSFYDHEDDVMYLTASDVRMVDVGDADIVHTDMATSNKNTEYAVRKILDAGVMPVVLGGDHSVHAPVIKAF-EGRGPIHIIHFDAHLDFVDERHGYGHGNPLRRASEMNHIVG--MTQMGIRNVSAHEAGSKILSVRDVRRLGVEGVLALIPQNI---NYYITIDIDGFDPSIAPGTGTPSHGGFLYYEVLEIIQALAKRNIVGMDLVEVAPVYDPTGMTSILAAQLLLNSIGFIFHERG 320
140 0.000e+00UniRef50_R5W6S2 Agmatinase n=1 Tax=Clostridium sp. CAG:167 TaxID=1262777 RepID=R5W6S2_9CLOT  ali  37  9...........PVYSGIHTLLGLPY--DKDAKDADVALYGMPFDISTTNRTGCRFGPEGIRQYG-QCKPYHEEL--DINIFDDFKAVDTGDFAIPLSYVDRDMDAVENQLYELLEKGVKTIGVGGDHTLSYPELLALKRKFGKVAFVHFDSHTDTWDWPDENNHGTPFRLAIQHDCIDMDHAIQIGMRGGFALEHGMQIIFGNELHEMGMSACAKRIREVVGDTPVFVTFDIDFLDPAVAPGTGTPIVGGFTTAEALQILRGLTRLNIVAMDLVEVAPAYDPTGQTQVVANEILREFLSILSYNK. 311
141 0.000e+00UniRef50_Q3IVT5 Agmatinase n=26 Tax=Proteobacteria TaxID=1224 RepID=Q3IVT5_RHOS4  ali  35  1MSVLPTDSLSTPRFVGLPSFMRLPMATELQGLDA--AIVGLPSDSGAPFRTGARFAPNALRAMSVMLRPINP-YRGHINIFEVLRVADAGDATCVPGYEIESLAALERALDAVVEAGAVPFGIGGDHSVSLAGLRAVAKRHGPLGLVHFDSHTDTWDSYKRYSAGTMFRRAIEEGIVDPARSIQVGMRGSLFQDLGLEVITCDEMFALGLPETARRIAARSAGHPAFLSFDLDFVDPAYAPGVETPECGGPTARETLSLLRSLQGLNLVGCDVVELNPSYDPGQITALLGATVMAELLAILAEAR. 314
142 0.000e+00UniRef50_A0A060S926 Uncharacterized protein n=13 Tax=Dikarya TaxID=451864 RepID=A0A060S926_PYCCI  ali  35  51........TADSIFSGITTFARLPWVKCLGREKFDIAFIGAPFDTGTSYRPGARFGPAGIRAGSRRLTLYGYNVPLAVNPFSGLKIVDCGDIPVTPYDNNYAIKQIEEGHKELLQRHPRIVTLGGDHTIVLPILRSIYSAYGAISVIHFDSHLDTWKPQ--VFGGAPSEQAAINHGTSYSSLQHGAIRTTNDDASGFQRIEAREIDTIGTDGIIKKIRETVGDKPVYLSIDIDSIDPAFAPATGTPETGGWSTRELRTIIRGLDGLHIVSADIVEVAPAYDTNELTTMAAADVLFEVLSVMAK... 382
143 0.000e+00UniRef50_A0A1Q8U0H8 Agmatinase n=3 Tax=Streptomyces TaxID=1883 RepID=A0A1Q8U0H8_9ACTN  ali  35  1MNPFAEPDVPIAAFAGIPTYARLPHSRDLT--GVDVAVVGVPFDGTVTYRSGGRLGPRAVRTASGIVGGYNPAQA--VAPFKELRCVDYGDVPVVPGNTERSHAAIERTVRRVLDAGATPLLFGGDHSCTLAHLRAFREA-GPVAVIDLDAHTDCADEYERYSHGSWLRRAIEEGLVDPSVSIQIGLRGSVDDELGLEYVTTDDVRGR-IAETAALVRERVGDRPVFLSLDLDVVDPAFAPGTGTPEPGGLMSYETISLLRQLGPLDFVGFDIMELVPAYDAGEITAVLAGNLGFE.......... 301
144 0.000e+00UniRef50_W2RVU3 Agmatinase n=3 Tax=leotiomyceta TaxID=716546 RepID=W2RVU3_9EURO  ali  35  64........DNPPLFTGITTFAHLDFSKDLPDGSFDIAFVGSPFDTGVIYRTGARFGPAGIRMGSRRLGKYSHSVELDYNPFSPFTVVDCGDAPVTPMDNRVAIKQLEQAHQIITSRHPKLITLGGDHTITLPALRNAYKQWGQLSIIHFDSHLDTNSNYSSVNHGTYFHIAKDEGLLKDDANIHAGVRLMEDRRCGFDIIKATQMETLGIKGIVERLKKRVGDGPVYISIDIDVLDPGFAPATGTAEPGGWTSREMLSIIEGLSGINLVGADIVEVAPAYDTNETTTMLAAELLYEILIVMQMS.. 397
145 0.000e+00UniRef50_A0A0P1INP9 Guanidinobutyrase n=33 Tax=Bacteria TaxID=2 RepID=A0A0P1INP9_9RHOB  ali  32  5.FFQPVSAMELARFAGIPTFMRLPSMALDHDRIAEVGLIGIPWDGGTTNRPGARHGPRQLRDFSTMIRAMNPVT--GVAPFSLVNCADLGDVAPNPVDIGDTLERVTAFYADIHDRGIAPLTAGGDHLTTLPVLRALAKS-GPLGLIQFDSHTDLFDTYHKFTHGTPFRRAVEEGLVDPKRFVQVGIRGTWGEAQGIRIIRIEELFDRGIDDVLAEVRSIVGTAPTYCTYDIDFVDPTYAPGTGTPEIGGPNSFQAQQVIRKMAGVNLVGADLVEVAPPFDPEGGTAWLGISLMFELLCVLA.... 315
146 0.000e+00UniRef50_G9A401 Agmatinase n=66 Tax=Alphaproteobacteria TaxID=28211 RepID=G9A401_RHIFH  ali  40  13..RSLHGAATDPTHAGVLSFMR--RRYSKQLKGADAVVWGIPFDAATSNRPGARFGPQAIRRASAIFD-NDPQYPFERDLFADMATIDYGDCLLDYGNHAKTPATIEREAAKILKSGAYLLTLGGDHFVTYPILKAHAALHGPLALVQFDAHQDTWDEKGRIDHGSFVGRAAREGLIDVERSIQIGIRTHAPEDCGIRIVYGYEVEEMRAEEIAETIVRHVGSHSAYLTFDIDCLDPAYAPGTGTPVAGGPSSAKILSVLRKLGALHIAGSDVVEVAPAYDHADLTAIAGSTIAMYMLGLLAERRG 318
147 0.000e+00UniRef50_A0A1Z7YUG2 Agmatinase n=1 Tax=Gammaproteobacteria bacterium 42_54_T18 TaxID=1856293 RepID=A0A1Z7YUG2_9GAMM  ali  38  26............PFQGIQSFLRLPYQRDL--EGVDISVYGIPSDISTSNRPGARFGPRAIREQSLLLGVYDPFPPHKHSLRDNMKMVDYGDLAFEFGYVEELLRVSHEHIGRMVDAGTHTLGLGGDHLVTYPAIKEHARKHGPLSLIHFDAHSD-DTNMGALHHGSMFWYACEENLIDPTRSIQIGVRHTLP-EHDFNVLSGEDIIDMKGTEIAQRIREVVGDNPCYISLDVDGMDPAFTPGTGTPVPGGLTSMQQRQILWHLKGLNVVGADVVEVSPPYDPTGQTANIAAGCAIDLMHVLAESR. 315
148 0.000e+00UniRef50_A0A2C5WUX4 Guanidinobutyrase n=9 Tax=saccharomyceta TaxID=716545 RepID=A0A2C5WUX4_9PEZI  ali  38  58.............FAGIQTFAHLPHVKCLVEDKYDIGVIGVPFDTSVSYRPGTRFGPRALRSGSSRQTPFSFNHRAGINPYSWARIVDCGDMNVSPFDNGLALRQMTEGYAELSKRKPKLVSLGGDHSIALPALRALKSAYGPINVLHFDAHLDTWHPQSFFTHGSFFWMAHSEGLIANG-SVHGGIRTRDDTEQGWFRILADDIDDIGVEGVINTIMERLGTEPVYLSVDIDIIEPGLAPGTGTPEPGGWTAREFIRILRGIEGLNVVGADIVEVSPSYDDAGTTALLGAQIAFEIITSMVKK.. 392
149 0.000e+00UniRef50_A0A2C9T1L7 Agmatinase n=14 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A2C9T1L7_9MYCO  ali  28  20........QLDLPYAGVASFGNRPFLTEPEQLDSDVAIVGAPFDVATTNRPGARFGPRAIR--STAYEPGTYHMDLGLEIFDWLEVVDFGDAWCPHGLTEQSHANIRERVHTIASRGIVPVILGGDHSITWPAATAVADVYGNVGIVHFDAHADTADIIDGNSHGTPMRRLIESGAVPGTHFVQVGLRGYWPQEQGMVWHTMQEIWDLGFKEVMRRAVALAKADKLYVSVDIDVLDPAHAPGTGTPEPGGITSADLLRMVRQLCEHDVAGVDVVEVAPAYDHAELTVNAAHRVVFEAL........ 325
150 0.000e+00UniRef50_A0A2E0BLS7 Agmatinase n=1 Tax=Rhodobacteraceae bacterium TaxID=1904441 RepID=A0A2E0BLS7_9RHOB  ali  40  2....LKGIRTSNSFSGNTTFFRRDFGT--DFGNADVVIQGLPYDLGVSNRPGARFGPRSIREASCQLA-WGEVWPWGFDPFDKIAVMDTGDIEYSYGNSKEFFRNAAKQTNKIVSAGAIPFTLGGDHSISSALLMEVSKAHGPVSLLQFDAHADTG-IGPKIQHGAMFKIAADAGTINPAKSIQIGLRTPFNSTLGFNTITAVEAMYQSSKILSERIETVIGKSACYVSIDIDCLDPSHAPGTGTPIPGGLTTLQLLEILRALGGLNIVGLDLVEVAPDYDHAQITSLAAAQICQESLCLISRTK. 300
151 0.000e+00UniRef50_A0A0F2NG66 Agmatinase n=1 Tax=Peptococcaceae bacterium BRH_c4a TaxID=1629716 RepID=A0A0F2NG66_9FIRM  ali  33  5............IFSG---FMG----SSDDYQKSRAVILGAPMDQTVSFRSGTRNGPRQIRSVSEVLEEYSPSLDRDLAEFA---YTDLGDVLIVPGKLEENLERIAKSADKVFRDGKLLIMLGGEHLVTLPAVKCAASLHSELSVIHFDAHADLREQYLGLSHATVMRRISE--VIGGDKIFQFGIRSGTREEFAYARANTNIYPELNTENIV-RVAQDLKGRPVYISLDIDVLDPAYAPGTGTPEPCGCSPDQLFSALEALSGLNVVGFDLMEVCPPYDQSERTAITAAKLVREAILLFSDKSG 287
152 0.000e+00UniRef50_I3XC91 Guanidinobutyrase Gbh n=750 Tax=root TaxID=1 RepID=I3XC91_RHIFR  ali  37  39......SGTRLAPYSGIPTFLTAPYADNPDFGNLQVGIVGIPMDLGVTNRPGSRFGPRALR-AIERIGPFNHVLGC--APVHDLRVADIGDVAFSRYRLELSHEDIEKRMNQIVDAGVVPLSVGGDHSITHPILKAVGKK-RPVGMIHIDAHCDTGYDLTKFHHGGPFRNAVLDGVLDPTRVVQIGIRGSFSYESGMTVIHAEEVTGLGIPAIIEKAKKIVGDGPAYLSFDIDSLDPSFAPGTGTPEVGGLTTREVLELIRGLKGVNLVGGDVVEVAPQYDATTNTAHAGAQVLFEILSLMV.... 343
153 0.000e+00UniRef50_M1VX99 Related to agmatinase n=1 Tax=Claviceps purpurea (strain 20.1) TaxID=1111077 RepID=M1VX99_CLAP2  ali  37  455.............FNGIGSFAHLDHVKCLPAEKYDIAIVGMPFDTAVSYRPGARFGPRAIRQASARQTSFGFNARAGINPYSWARVIDCGDVPVTPFHNDIAQEQMTQAFKALGRAKPKLVTLGGDHSLALPALRALRELYGPIRVLHFDAHLDTWNPDEPFNHGSMFWMASQEGLLSNASSVHAGLRTRLDTAQNWVRFSADALDDMGTKGLVDAIMSVLGTDPVYLSVDIDVLDPAFAPGTGTPEPGGWTTRELIRILRGIEGLNVVGADVVEVSPAYGRGEETALAGAQVVYEIVSSLVKR.. 790
154 0.000e+00UniRef50_A0A1Z9AJM6 Agmatinase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1Z9AJM6_9GAMM  ali  50  23............TFSGQLSFLR--RAYTQDIAGADLVVSGLPFDLATTFRPGARFGPQAIRAASVQLEIADHAFPFNDDPFSHLAVADYGDVDFVSGYPDQAVAVIEAHAQKLLAEDVTMLTFGGDHFVTYPLLKAHAKKYGPLSLIHFDAHVDTWDDGEQLDHGSMFLRALREGLIDPHTSVQIGIRSFSEDDYGFTVMSSPWVAENGVRATVLEIQKVVGRRKAYLTFDIDCLDPAFAPGTGTPVAGGLSSLDALTILRGLGQIDIVGMDVVEVAPAYDHSEITAIAAATLAHDFICLKAWQK. 315
155 0.000e+00UniRef50_A0A1D2R7S3 Agmatinase n=1 Tax=Candidatus Altiarchaeales archaeon WOR_SM1_79 TaxID=1849365 RepID=A0A1D2R7S3_9EURY  ali  32  6.................STFMN----FSRKFEDAEICILGVPFDVTETYRRGARFGPGSIRESSLSVEEYSQGFGLDL---GDLRIADLGDIE--AGDVKETLKGIEERISEIISKDKLPVVLGGEHLISLGAVRALKKKHEDLKIIQFDAHLDLRDEYEGLSHSTVMRRIYDICN----DLYQIGIRSGSREEFDFAKENTRIYGADDISASISDVIEKIGDKPVYVSIDIDVLDPAYAPGTSNPEPCGISTRELMDAVHKIGKLGVVGFDVVEVCPGYDKSEVTPITAAKIVREGILSFFG... 280
156 0.000e+00UniRef50_A0A0L0NGJ5 Asparagine--tRNA ligase, cytoplasmic n=1 Tax=Tolypocladium ophioglossoides CBS 100239 TaxID=1163406 RepID=A0A0L0NGJ5_9HYPO  ali  39  48.............FSGIGTFAHLEHVKCLMDPSYDIAIIGAPFDTAVSFRPGARFGPRAIRQASRQTAFRGFNPRASINPYQWAKIIDCGDIPITPFDNNIAREQMTQALTQLLSXKPKLMTLGGDHSLTLPALRALKEIYGPVRVLHFDAHLDTWNPNTQFTHGSMFWMANQEGLLSNSSSVHAGLRTRDDSSQNWVRFSADDMDEIGTAGIIAGIMDTLGTDPVYLSVDIDVLDPAFAPGTGTPEPGGWTTRELIRVLRGIEGLNLVGADVVEVSPAYGRGEETALAAAQVVYELLSSMVKR.. 383
157 0.000e+00UniRef50_D5SKW9 Proclavaminate amidinohydrolase n=2 Tax=Streptomyces clavuligerus TaxID=1901 RepID=D5SKW9_STRC2  ali  35  107.....VSTAVSPRYAQPATFMRLRHRPDP--IGHDVVVVGAPYDGGTSYRPGARFAPRAIRHESSLI--HGVGIDRGPGVFDRIDVVDGGDIDLSPFSMDLAMDTATVALTRLLERNDAFLMLGGDHSLSLAALRAVHARHGRVAVLHLDAHSDTNPPVYGYHHGTPFRWAIEEGLVDPERLVQVGIRGHYARGHGVSIVTAADFTRRSPRGIAEQIRRTVGGLPLYVSVDIDVVDPAYAPGTGTPAPGGLSSREVLTLLDVVGQLRPVGFDVVEVSPAYDPSGITSLLAAEIGAELLYQYAR... 410
158 0.000e+00UniRef50_A0A2D7HZ37 Agmatinase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2D7HZ37_9DELT  ali  43  28...SLYGTVDEAGYSGALSFGR--RRYTHDLTGADVAILGVPADLTVSNRPGTRFGPRSIRAASAHL-SWGEAWPWGFDPFRRLAVVDVGDVVFEAGYVDSLLSATEERADWILSQDVSMVTLGGEHLISLPVMRAHARKHGPLAMVHFDAHSDTWVDDLPLNHGTMFHEALEAGLIDTDHSIHVGIRTHNHEDHGIETLDGFWVDEHGAEATAARIKERVGDRKAYLTFDIDCLDPCYAPGTGTPVTGGPSTAWARRVFASLHGIDFIGMDIVEVAPDYDVAEVTSLAAATLVYDYLCLMAK... 324
159 0.000e+00UniRef50_A0A160F3E1 Agmatinase n=23 Tax=Bacillaceae TaxID=186817 RepID=A0A160F3E1_9BACI  ali  34  17............................PNFEESEAVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSPYLDREL---EEVKYFDAGDIPLPFGNAQRSLDMIEEFVDRILTAGKFPLGLGGEHLVSWPVMKAVYKKYPDLAIIHMDAHTDLREHYEGLSHSTPIRKIAE--LIGPKNVYSFGIRSGMKEEFEWAKQNGMYIAKFEVLEPLKEVLPTLAGRPVYVTIDIDVLDPAHAPGTGTVDAGGITSKELLAAIHEIARSDVVGADLVEVAPVYDHSEQTANTASKLVREMLLGWVQKR. 292
160 0.000e+00UniRef50_A0A1G5SG98 Agmatinase n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A1G5SG98_9PROT  ali  46  16MSHTLS-------FGGAASFFRVPYQTDMTGVDVVVTG--VPLDIATTNRSGARLGPRAIRNASLSLAWERP-WPWNIDPMTALRVIDCGDCEPVTDDL-LSVAHIEAHIANIIGAGAAALVLGGDHFVAYPSLRAHAAVHGPISLIHFDAHTDTWPSGNGINHGTMFYQAAHEGIVNPASSTQIGIRTTNDDTLGFHIVSAADVHQTTGRDIASQIRARVGGKPVYITFDIDCLDPAFAPGTGTPVPGGLSSFQALSIIRELKGINLVGMDVVEVAPAYDHAEITALAAAQIAVELLCLYAES.. 309
161 0.000e+00UniRef50_Q5KIC1 Arginase, putative n=22 Tax=Basidiomycota TaxID=5204 RepID=Q5KIC1_CRYNJ  ali  35  35.WNDEYANTPDLSFSGVASFAHLPHKRCLDVKDADIALLGVPFDSAVSFRPGARFGPYALRSGSRRQRPRGYNSRLEVNPYSDLSILDCGDVPVTPFDPATAVKQINSAYRSLLHHHPRIITLGGDHTIVLPILDAVHEVYGPVSVIHFDAHIDTWNPHASLNHGTFFWHAYEKGFIKPNSSIHAGIRTRDDVTAGFDLIHTFDLDDFGIDWISEKIKNRIGDGPVVISLDVDVMDPAFVPATGTPESGGWTSRELRRILHSLIGLNIVALDIVELSPAYDTNEISAIAAADMVYDFLSILA.... 378
162 0.000e+00UniRef50_A0A1Y2F5F4 Arabinogalactan endo-beta-1,4-galactanase n=1 Tax=Protomyces lactucaedebilis TaxID=56484 RepID=A0A1Y2F5F4_9ASCO  ali  37  379.SYSTDQWDFDWSFSGIETFAHLPHVKCLPDEAFDIAIIGAPFDTAVTFRPGARFGPRAIRHMSRQTTLRGFNAATGINPYKWAKIIDCGDIPITPFDNAVALKQMTLAFRRIAKDGPRLLTLGGDHSIALPALAALHKAYGPVSVLHFDSHLDTWSPATDFTHGTMFHLAAQRGYIANGTSVHAGLRTMHDQEVGFKLIEAREMDSIGADGIAANIMNVLGDRPVYLSIDIDVLDPSVAPGTGTPESGGWTTREMLRVLQALQGLNIVGADIVEVSPAHDNQG...................... 707
163 0.000e+00UniRef50_A0A2U3DXY6 Uncharacterized protein n=2 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3DXY6_9HYPO  ali  38  287............PFSGIGSFAHLSHSKCLTDPDYDIAIVGAPFDTAVSFRPGARFGPRAIRQASRQTGFRGFNPRASINPYQWAKIVDCGDIPITPFDNDIAREQMTQALKQLLSPKPKLMTLGGDHSLTLPALRALKEIHGPVRVLHFDAHLDTWNPNTQFTHGSMFWMANQEGLLSNSSSVHAGLRTRDDSSQNWVRFSADDMDDIGTQGIIDGIMRVLGTDPVYLSVDIDVLDPAFAPGTGTPEPGGWTTRELIRVLRGIEGLNLVGADVVEVSPAYGRGEETALAAAQVVYELLSSMVKR.. 614
164 0.000e+00UniRef50_Q6BVQ4 DEHA2C00792p n=2 Tax=Debaryomycetaceae TaxID=766764 RepID=Q6BVQ4_DEBHA  ali  36  108......DRYVSNPLSGFLSFAHLPLTNCFSGEKFDIGIVGATFDTGVSFRPGSRFGPLGIRMATKRMSSGSISFRKNFSLFKDGKIVDCGDPPMTPIDNRIALDQLYRAERAILKTKPRILTLGGDHTVTLSCLRAVYEKWGKVAVIHFDSHLDTIDPYQMNNHGTFFHWAAKRGLISESKNVHVGLRGYYDSAIGFERIMSRDIDDIGIAGIVKRIKDRVGDSKVYITVDIDSLDPSSAPGTGTVEPGGFSSRELLTILDKLEGLEVIGADVVEVAPPYDTNEITTMVASEVARSLLGLMV.... 431
165 0.000e+00UniRef50_UPI000C7A8967 agmatinase n=1 Tax=Nonomuraea indica TaxID=1581193 RepID=UPI000C7A8967  ali  34  2...............PARTFHDIPPSSDGRFQGSDVVVLGVPIDSGTGGRPGARFGPAAIREASALIAGNLYHVGLETEVFEHLRIVDVGDVPVTPGQHERNLDAAEKWARELMSVTDRVVVLGGDHSVLLPVLRAVADKHGPVSFVHWDAHADTWDGGPEHTHATAVRRVIEEGLTN--QVFQIGLRGYWAGEHGVEHWTMMDVDEAGLTDIVQQVIASV-TGKVYISIDIDVLDPSYAPGTGTPEPGGLTSRELLAGIRDLARTDVVGLDVVEVAPPYDHADVTALVANRCVLEFLSATAQRK. 301
166 0.000e+00UniRef50_C3MH08 Agmatinase SpeB n=93 Tax=Bacteria TaxID=2 RepID=C3MH08_SINFN  ali  36  39......SGTRLAPYSGIPTFLTAPYADNPDFGNLQVAIVGIPMDLGVTNRPGSRFGPRALR-AIERIGPYNHVLGC--APVHDLRVADIGDVPFSRYRLELSHEDIEKRLNQIVDAGVVPLSVGGDHSMTHPILKAVGKK-QPVGMIHIDAHCDTGYDLTKFHHGGPFRNAVLDGVLDPTRVIQIGIRGSFSYESGMTVIHAEEVSGLGIPAIIEKAKKIVGDGPTYLSFDIDSLDPSFAPGTGTPEVGGLTTREVLELIRGLKGVNLVGGDVVEVAPQYDATTNTAHAGAQVLFEILSLMV.... 343
167 0.000e+00UniRef50_Q7P0S6 Agmatinase n=1020 Tax=root TaxID=1 RepID=SPEB_CHRVO  ali  48  15..QGLYGSSIENTYAGVLSFMR--RNYSRDLEGVDVAVSGIPLDLSVTFRSGARMGPQAIRAASVQLAELKP-YPWGFDPFEDLAVVDYGDCWFDAHNPLTIKPSIIEHARTILASGAKMLTFGGDHYVTYPLLIAHAEKYGPLALLHFDAHCDTWPDDSPLNHGTMFYKAVKEGLIDPKKSVQVGIRTWNDDFMGLNVLGAPWVHDNGVDATIAEIKKTIGDAPVYVTFDIDCLDPSAAPGTGTPVPGGLTTAQALKIIRNLGDLNIVGMDVVEVAPSYDQSEITAIAAAHIACDMLCLMRNKK. 317
168 0.000e+00UniRef50_L0DI55 Agmatinase n=5 Tax=Bacteria TaxID=2 RepID=L0DI55_SINAD  ali  41  22..........DMPFSGPTSFFRTDVVDTL--EGVDIALIGVPTDAGLSHRPGARYGPQAVRAQSGLIRYINPYT--GVIPYEHGRVVDAGDVPFQNTLVDDIVREIFSYYTQVVAAGVVPLSVGGDHSITYPILKAVASR-GPVGLIHFDSHHDTAPPGSRFHHGAPFRNAVEDGLIDPRRTVQIAIRDPYAEAHGFTVLDMPLILREGLDAVVATTRKTIGDGPVYITFDVDALDPAFAPGTGTPVVGGLSSREAMILLQGLRGLNIVGADVVEVSPPYDPTGMTALAGAQILMELLCLASAKKG 325
169 0.000e+00UniRef50_A0A2E2E306 Agmatinase n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A2E2E306_9PROT  ali  37  42...........APFAGVSTFLDAPWHKSPDFGDLQVAMVGVPMDLGVTNRPGARFGPRAVRTI-ERIGPYNHVLKC--APVSELRVADIGDVPFSRFSLNSCHEDIEDYLAKIVAAGVIPLSIGGDHSVTLPIMKAIGKKA-PIGMIHFDAHCDTGGEFSKFHHGGPFREAVLEGVLDPERCIQIGIRGPFSVDSGMTVIHAEDVAEMGPAAVIKKARDVVRDGPVYVTFDVDCLDPAFAPGTGTPEIGGVTSREAMTMLRGLAGLNIIGGDVVEVAPQYDSTTNTAQVGAQILFEILCLM..... 340
170 0.000e+00UniRef50_A0A2B4RYE8 Agmatinase, mitochondrial n=8 Tax=cellular organisms TaxID=131567 RepID=A0A2B4RYE8_STYPI  ali  34  36.FNSPLTPDEVPRAAGFPTMLRLPMQSTADGLDA--CFLGIPMDNGSAHRTGARMGPRQIRCESCLLRPHNTHTGA--APYESLMVADVGDVSVNVFNIEANINIIHQHVASIISDGCKPLIMGGDHTISYPILKAMKEKYGPVGLVHLDAHPDTTTFGEKISNATPFRLAAEEGLLDCERVVIIGLRGSYGRNLGFKIVPAKYCWYKSMAPLMAQVRELMGDAPVYITFDIDAVDPGYAPGTGTHEIGGLTSIQALEIIRGCRGMKIVGGDLVEVSPMFDVQGATSILAANFLFEMLCVL..... 342
171 0.000e+00UniRef50_A0A2B2AR72 Agmatinase n=4 Tax=Bacillus megaterium TaxID=1404 RepID=A0A2B2AR72_BACME  ali  41  9.............YGGNPTFWRCE--QTREINGADIVVMGVPFDVGTSNRPGARYGPRSIREMSLHVG--NFYYPWSYDVKEKHKIIDYGDVGLGVQNTQFMIQDTYEHAKSILASGAKLLTLGGDHTIPYGMVRAAKEKYGKLALLHFDSHQDLASDGTQIFHGSFAHDLAEEGCIDAEKSVQVFIRTEMPNECGYNIIHANEALEMKSAELADKIKSIIGDQPVYLTFDVDSLDPAYAPGTGTPVVGGPSTYQIRSLLRNLEGLNIVAADLVEVAPMYDPAQVTPLAAATIAGDLIYLLAEN.. 298
172 0.000e+00UniRef50_Q6MHV0 Agmatinase n=16 Tax=Proteobacteria TaxID=1224 RepID=Q6MHV0_BDEBA  ali  40  5MEYKPLSGREFPRFSAIKTFFRLPYVTI--EADYEVGIFGIPYDGGVSYRPGGRFAPAKVREVSSLGRGFHMT--RMENFFENLKVADIGDCPTVPIDQKQTYEKIEKFVGEVLSHNKRFLAVGGDHSTTLPVLRALRKKYGPLAFIHFDAHLDTYPWGQEYHHGAFARHAVEEGLVDPKKMVQIGIRGPLAGKHGIRVITVDEIRNQPITEFL-KTLPTFDETPTYISYDIDNLDPSCAPGTGTPVPGGLTTYEVQRIFRALKIPNLVGGDVVEISPPFDHADITALAGMDALFEMLHLFPTKK. 315
173 0.000e+00UniRef50_A0A2P7YLX7 Agmatinase n=1 Tax=[Candida] pseudohaemulonis TaxID=418784 RepID=A0A2P7YLX7_9ASCO  ali  38  594............PFQGINTFAHLPNHHCLADRDYDVALVGVPFDTAVSYRPGARFGPRAIRAASRQTSLRGFNPRALYNPYEWASVVDCGDIPVSPMDNSLAFEQMTVGFEELLERPPRYIALGGDHLVLLPHVRALHKLYGPLNIIHFDAHLDTWDKYPSYSHGLMLWKAYEEGL-TTKNNVHAGLRTEDDDEQGWLRLSADDVWIHGADYIVKQILKRVKNSPTYISVDIDVLDPAFASGTGTQEPGGWLPRELIHILRGIEQLLIVGADVVEVSPAYDHAEVTATNGAQVAYELITSMVKN.. 912
174 0.000e+00UniRef50_A0A2T3BAW9 Uncharacterized protein n=2 Tax=leotiomyceta TaxID=716546 RepID=A0A2T3BAW9_AMORE  ali  35  114.....TDLDYDLPFSNIVTYAHLPWERCFNLAHFDIAIVGFPFDTTVSVKPGARYGPRGIRAGSTKERTYNVNYGLDWAT-NWAKIIDCGDVPVTPYDNAHAFIQMEQGYRQLLHKHPRLISLGGDHSIMLPILRSLKSVYGPISVIHFDSHLDVVSEQSKFTHGTFFWHAAQEGCIANS-SVHAGLRTENDQEVGFSIIHARDIDDIGVQGIIDKIVAAVGDKMAYISVDIDVLDPGAAPATGAPEAGGWSTREFKRILEGLQDLNIVGADVVEVAPDYDTNEITSIAAADMIIDIISAMVKK.. 451
175 0.000e+00UniRef50_I2JQM8 Arginase family protein n=1 Tax=Brettanomyces bruxellensis AWRI1499 TaxID=1124627 RepID=I2JQM8_DEKBR  ali  37  25............PFTGIPTFAHLNTTKCLPESXYDIGIIGVPFDTATSYRPGARFGPQAIRLASQRQNSRGFNTRAGINPYQWASLVDCGDIPVTPMDNKVALDQMTAAFEELLAHPPRYVALGGDHSIILPHLRALHEVYGKIAVIHFDAHLDTWTEQSKFTHGSMLWMAKKEGILSDDYNVHVGIRTDEDDDQGWLRFSADDVWKQSLDQIVASIKKRIPAHPVYISVDVDCMDPGFTPGTGTIEPGGMMPREVIYLLRHL-DLDLVGADVVEVAPAYDQAEITATNAAQVVFELVTTMVKR.. 352
176 0.000e+00UniRef50_I4Y8K0 Putative agmatinase n=1 Tax=Wallemia mellicola (strain ATCC MYA-4683 / CBS 633.66) TaxID=671144 RepID=I4Y8K0_WALMC  ali  41  32...........PLFADIVSFAHLKHQHCLLDEKFDIAVNGLPLDTSVSYRTGARFGPSGIRQGSRRQDPENWSHYWKQNPYKRIKVIDCGDVPVIAVDNNMAYKSIEAAHDTLLNRHPMLLTFGGDHSVELPILRSLKKVYGPIALIQIDSHIDTWSSGKKYSHGNMLWHAHEEGLLS--SSIQAGIRTRDNEKFGIEMLTIDAVDEMGTKGISERIKERIGDKPAYITFDIDSLDPAFAPATGTPEPGGLTTREAKAILRGLEGLNLVGADIVEVSPAYDTSELTQMVAAEVAYELLNLL..... 351
177 0.000e+00UniRef50_A0A1Y5TLV9 Agmatinase n=13 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y5TLV9_9RHOB  ali  45  30.............FGGALSFLR--RRYTKDLSGVDLAVTGVPFDQAVTNRPGTRLGPRAIREAST-LQAFDAPYGWGYSPLEEFDVIDYGDLAFDYAKVADFPQALTDHIAPILAAGAGTLVLGGDHFISFPVLRAHAAKFGPLSLIHFDAHSDTWDDMTRIDHGTMFYKAVKLGLIDPARSVQIGIRTDNPDTLGVNIIDARAVHERGASWVASRVKNIVGNHPAYLTFDIDCLDPAFAPGTGTPVWGGLASWQAAAILRELAGVHLTGGDVVEVSPPYDVGNATAVAGAHVAMEILALYCWTR. 320
178 0.000e+00UniRef50_A0A163JWG2 Uncharacterized protein n=1 Tax=Absidia glauca TaxID=4829 RepID=A0A163JWG2_ABSGL  ali  36  2....PVSDVTSEVFMGLGTFAHLPYERCLSNSAADIAVVGIPFDTGTSYRPGARFGPSGIREGSRRIVAGTYNVPLSIDPMTGLTMVDCGDIPVTPFDNDKAMEQIFDGYLSLLQRHPRLLTLGGDHTIVLPILRALHHHNGPVSVIHFDSHIDTWTPYQNLNHGTYFYFAAKEGLISPDANIHVGIRSADDARCGFQLVEAAEIDVIGTQGIINRIRKTVGDNDVYLSLDIDVLDPSFAPATGTPETGGFSTRELRRIIQGLEGLNLVGADVVEVAPAYDTNQLTAMAAADII............ 325
179 0.000e+00UniRef50_A0A0F4Z477 Agmatinase n=31 Tax=Fungi TaxID=4751 RepID=A0A0F4Z477_TALEM  ali  36  74..............GGLASFAHLPYVPCFSIDRYDIAILGAPFDTATSYRPGARFGPHGIRDGSRRIRGYHWNVYTGQNPFEWAKIVDCGDAPLTFFDNTVALKQLGKAHKIISGRQARILMLGGDHTTTLAALRSTIDHWGVVNVIHFDSHIDTWNEYAAVNHGTFLHIAHEEGLISNDSSIHVGIRAPNDAQCGFDIITARDIDDIGVKGIIKRIKERVGDGKVYISVDIDVLDPAFAPATGTAEPGGWTTRELLSIIDGLSGLKVVGADVVEVAPAYDNTGTTCIAAAEVARSLLTLMV.... 397
180 0.000e+00UniRef50_A0A0D5L6C9 Agmatinase n=54 Tax=root TaxID=1 RepID=A0A0D5L6C9_9BURK  ali  36  1MTQTDLSQMQMPRFAGIPTFMRVPFARDP--QDYDIALAGVPYDGGVTARPGARFGPREIRNMSTMMRAIHHVMR--FNPFEACRVADIGDVPFHLYDIERAHADIRAFFEPVFRAGKRALIAGGDHSITFPIFQAIGAAQTPLALVHIDAHTDTWDAYSKFTHGAPFRRAVEAGLLDPTRTIQIGIRGRYSLDHGMRVVFIEEFEALGPAAIAAEARRIVGDMPVYLSLDVDGLDPVFTPGTGTPEIGGLTTRETLALLRGLDGLNWVGGDVVEVSPPYDPSGNTALVAATLMYEMLCLFAR... 313
181 0.000e+00UniRef50_A0A2C5YQ83 Uncharacterized protein n=1 Tax=Ophiocordyceps camponoti-rufipedis TaxID=2004952 RepID=A0A2C5YQ83_9HYPO  ali  38  46.............FSGIGSFAHLDHVKCLVDPSVDIAVIGVPFDTAVSFRPGARFGPRAIRHSSRQTAFRGFNPRAGINPYDWAKIIDCGDMPITPFDNQIALEQMTQAFRELGKRKARLVTLGGDHSLALPALRALKEIYGPVRVLHFDAHLDTWDPYSQFTHGSMFWMASQEGLLSNSSSVHAGLRTRSDGSQNWVRFSADDMDEKGTSGIIDGIVKTLGTDPVYLSVDIDVLDPAFAPGTGTPEPGGWTTRELIRVLRGIEGLNLVGADVVEVSPAYGRGEETALAAAQVVYEMVTSMVKR.. 372
182 0.000e+00UniRef50_A0A0C2JA98 Uncharacterized protein n=1 Tax=Sporothrix brasiliensis 5110 TaxID=1398154 RepID=A0A0C2JA98_9PEZI  ali  34  24.EHHIEDLDVDLPFSQPVTFAHLEWQRCLADKPLDIALLGFPYDTSTSYRPGARFGPRGIRAGSAREKGRSYNTVWGVDPYEQLEIIDCGDIPITPFDAAHAFKQMEQGYRQVLWKHPRIISLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGYTHGTFFWHASREGCIAKGTSVHGGLRTIDRDVVGFTLIEAHEIDEIGMEGIVARTRAAVGDTPTYLSIDIDVLDPSIAPATGTPESGGWTTRELKRFIKGLEGVNLVGADVVEVSPPYDVAEVTSIAAADLIVDILAAMVKSK. 361
183 0.000e+00UniRef50_O42887 Putative agmatinase 2 n=13 Tax=Dikarya TaxID=451864 RepID=SPEB2_SCHPO  ali  40  61.......WEFDYQYSGISTFAHLPHVRCLVEEDFDIAIIGVPFDTAVSHRPGARFGPKGIRSASRQMAIRGFNPSLNVNPYEWAKILDCGDIPVSSYDNQLAVRQMTEGYIDLLSRHPRLITLGGDHSIGLASLRALGHFYGNVSVIHFDSHLDTWNPRADFTHGTMFWMASKEGLINNGTSIHAGLRTYDYEEVGFTFIEAQEIDEIGVNGIVERIKQVVGDTLVYLSIDIDVVDPGLAPGTGTPETGGWTTREMKSILRKLDGLNLVGAEVVEVSPPYDRAESTSLAASDFIFEILSSMVK... 405
184 0.000e+00UniRef50_I2K389 Arginase family protein n=20 Tax=saccharomyceta TaxID=716545 RepID=I2K389_DEKBR  ali  34  126.............FGGLVSFAHLPYANCFDDEKFDIAVVGAPFDTGTSYRPGTRFGPTGIRMGSRRLAPYSVYSGFNPY-SNWAKIVDCGDPPVTPLDNRIALDQIYRAERAIRNKAPKVFTLGGDHTITLPAVKAAYEKYGKISVIHFDSHLDTWNPYGGNNHGTYLHWAHEKGYXS-DNCIHAAIRGPYPGDCGFDRILARDIDKIGADGIIKKIKERIGDAPVYITVDVDSMDPAFTPATGTVEPGGWSSRELLTVLDGLEGLNVVGGDVVEVSPPYDSAEITSLAAAQVADSIISLMVLK.. 448
185 0.000e+00UniRef50_A0A1H9BWP0 Agmatinase n=5 Tax=Streptomyces TaxID=1883 RepID=A0A1H9BWP0_9ACTN  ali  38  16.PRAQVRSGVSPRYAQLATFMRL--RHDPAPVGRDVVVVGAPYDGGTSYRPGARFAPRAIRHESCLI--HGTGIDRGPNVFELIDVVDGGDIDLSPFSMDLAMETATEALTALLDDNAAFLMLGGDHSLSLAALRAVRHKHGKVAVLHLDAHSDTNPPVYGYHHGTPFRWAIEEGLIEPAHMVQLGIRGHYARGHGVRVITAQECADRPLADVAAEIRAVVGDLPLYVSVDIDVVDPAHAPGTGTPAPGGLTSREVLSLLTLVGDLNPVGFDVVEVSPPYDHSGITALLAAEIGAELLYQYAR... 323
186 0.000e+00UniRef50_A2QBG2 Aspergillus niger contig An01c0490, genomic contig n=149 Tax=Eukaryota TaxID=2759 RepID=A2QBG2_ASPNC  ali  36  33.......WGEDWAFSGITTFGHLEHVHCLPDTPFDIGIIGTPFDTAVSYRPGARMGPRAIRTASRHIPSRAFHAAAQINPYSWAKVLDCGDIPVTPFDNAVAIHQMTEAYRELGSRKPKLITLGGDHLVALPALRALRESYGPMALLHFDSHLDWTSMQSQFNHGSVFWNAMKEGLISNSSSLHAGINTDDDDKQGFLRIAADEVDSIGAAGIIDRIHQHIKDQPVYMSIDIDVLDPAFAPGTGAPEPGGWTTREMIKILRGVMDLNIVGADIVEVAPAYDPGGETAYLAANLAYELVTGMVAR.. 363
187 0.000e+00UniRef50_H2C483 Agmatinase n=2 Tax=Metallosphaera TaxID=41980 RepID=H2C483_9CREN  ali  34  16.....IDALKSPRFSQVSTFARLPLC---GEERPKAVFIGIPFDDATTYRPGARFGPMGVRDGSRLLRPYNPF--QGVYPFDELNACDAGDVDTVPGHIEDTMKKVEEGLLNILVF-STPFIVGGDHSITLPVLRAVHKVHGRVNLIHMDSHYDFWDWGKKYDHGTWLRRALEEGLL--EEVVQIGIRGSDSKRLGITSFSIREV-KKNWGEVMDRVKAL--RGPTYVSFDIDVVDPAFAPGTGTPEVGGLTSFEALELVRGLP-VELVGFDVVEVSPPYDVSELTTMLASNLIYEAMSLKARRRG 316
188 0.000e+00UniRef50_F8JCJ5 Agmatinase n=3 Tax=Hyphomicrobium TaxID=81 RepID=F8JCJ5_HYPSM  ali  41  18.SPSPYCLSSEQTYSGTHTFLRSPRVKQAKAG--DFAVLGVPLDIATSNRPGARLGPDAVRCASAQLA-ELKAYPGGFNPLSYVNVVDLGDAWLDYGFPQTIPAAIEDAATKVVETGAFLCSLGGDHFISYPLLKAHAKVHGQLTLIHFDAHTDTWTPRVGLNHGTMFAQAIDDGLIDPAKSSQIGIRTWVDDPKGMNIFDNMVVADKGASAVASMVKALAGDNPCYLTVDIDCLDPAFAPGTGTPVTGGLMPRELLAMLRQLDGLKIVGCDVVEVAPSYDQGGVTALAAATVVYEQACRVARQNG 325
189 0.000e+00UniRef50_A0A1L3SYR8 Agmatinase n=2 Tax=Rhizobiales TaxID=356 RepID=A0A1L3SYR8_9RHIZ  ali  42  13..RSMTGSASDPTYAGALSFMR--RRYTKNVKGADAIVWGIPFDAAVTNRSGARFGPQAIRRAAAIFD-NDPQYPFHRDLFADLAVVDYGDCLLDTGNHQKTPGKIERDAAKLLKSGAFLLSLGGDHFVTWPLLKAHAARHGKLALVQFDAHQDTWDDGKRIDHGSFVARAVRDGVIDPERSIQVGIRTHAPEDFGIEILHGYDLDEMKAADIAKAIVERTGGAKTYVTFDIDCLDPAFAPGTGTPVAGGPSSAKMLSVLRQLGDLDMVGADIVEVAPAYDHADITAIAGATVAQHYLGLLAEKK. 313
190 0.000e+00UniRef50_A0A0J6VZ56 Agmatinase n=98 Tax=root TaxID=1 RepID=A0A0J6VZ56_9MYCO  ali  29  9.............YAGMASFGHRPFLTETEQLDSDVAIVGAPFDIATTNRPGARFGPRAIRA--TAYEPGTYHMDLGLEIFDWLEVVDFGDAYCPHGQTEVSHANIKERVHAIASRGIVPVILGGDHSITWPAATAVADVYGNVGIVHFDAHADTADEIEGNSHGTPMRRLIESGAVPGSHFVQVGLRGYWPQEQKMTWHTMQEIWERGFKAVMADAVALAKADKLYVSVDIDVLDPAHAPGTGTPEPGGITSADLLRMVRQLCEHDVAGVDVVEVAPAYDHAELTVNAAHRVVFEALAGMAARR. 316
191 0.000e+00UniRef50_UPI0005D25114 agmatinase, mitochondrial n=1 Tax=Takifugu rubripes TaxID=31033 RepID=UPI0005D25114  ali  36  47.YNEPPSAEVVARVSGIPTMARLPYRETADGLDA--AFVGVPIDTGTSNRPGARFGPRQIRVESAMLRAYNSGTRA--APYQSIRVADIGDVNVNLYDLQDTCRRIRDAYRTILAAGCTPLTLGGDHTIAYPILQAVAERHGPVGLVHVDAHADTSDLGEKIAHGTPFRRCMEEGLLDRERVVQIGLRGSWSRAQGFRVVPVEECWYRSLTPLMAEVRSQMGAGPVYLSFDIDALDPGFAPGTGTPEIAGLTPIQGVEIIRGCRGLSLVGCDLVEVSPAYDT---TVPAAAR.............. 340
192 0.000e+00UniRef50_A0A1C5VKZ9 Guanidinobutyrase n=2 Tax=uncultured Ruminococcus sp. TaxID=165186 RepID=A0A1C5VKZ9_9FIRM  ali  37  1MFDKIISEETRSRENNIKTLFGLPYKQDIDGE--DFVVLGVPYDTSVTNRTGCRFGPRAIRNA-YGAGRLSYEQDNSYKV-ANLKGMDMGDIGVVLGYVEETMELIRESVRKVLDAGAVPIVLGGDHLIAYAELKAYSEKYGKVAMVHFDTHEDTWDYGDRYNHGTPFRNAIEDDILDTEHSIQVGIRSGYAQDHGMKVITARELHKIGIKETCRRIKEQVGDAKVFITFDIDFLDPVYAPGTGTPMPGGFSTYEACEIIRGLAGLDIVGFDLVEVMENYDPAGITAINAVAILKQFVILLSKKK. 316
193 0.000e+00UniRef50_A0A1Y5SQ85 Guanidinobutyrase n=41 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y5SQ85_9RHOB  ali  34  5.FFHPVSGFDLPRFAGVPTFMRLPYVPHERYSDVQIGLIGVPWDSGTTNRPGPRHGPRQLRDASTMIRAQHPTS--GMRPYETVNCADLGDVGPNPADILDSMTRITAFYDQVLAAGITPLTAGGDHLTSLPVLRSLAKVHGAMGMIHFDSHTDLFHSYFGYTHGTPFRRAVEEGLLDPKRVVQIGLRGTMAAANGIRLILIEEFHDRGVADVMAEARDIAGDGSTYISYDIDFVDPTYAPGTGTPEVGGPNSYQALQVVRELEGVNIIGADMVEVSPPFDPSGGTAFLGMSIMFELLCVMAAQ.. 318
194 0.000e+00UniRef50_UPI000A07371A agmatinase n=1 Tax=Streptosporangium amethystogenes TaxID=2002 RepID=UPI000A07371A  ali  39  1....................MGLPYE--PAPQGADLVIVGAPYDGGTSYRPGARFGPRAIREESALL--HGTGLDRGPSVFGAIGAVDAGDLDLNRFSMESAMSTATERLTELAERNQALLMLGGDHSMTLAALRAAHKVHGPVAVLHLDAHSDTYPPGGRYHHGTPFRWAIWEKLVDPARMIQVGIRGHFARARGVRIVTAPDIDRIGVGSLMSMIQECVGDGPLYVSCDIDVVDPAFAPGTGTPSPGGLSSRELLAILRGIGDLQPIGCDVVEVAPAYDHGGATALLAAEIGYELIYQYARSR. 291
195 0.000e+00UniRef50_A0A1V5LV76 Guanidinobutyrase n=1 Tax=Firmicutes bacterium ADurb.Bin419 TaxID=1852892 RepID=A0A1V5LV76_9FIRM  ali  34  6.SNISDLYNSTPRFCGLPTFMRLPEYKDID--KSDVVIVGIPFDDTSSYRTGSRFAPRFIRNVSTCLKKYNRFF--DVDIFGSGIISDYGDIPVIPGYIEKSYNLITDELSKIVDKGAVTIAIGGDHGILLPELRAFKEKYGKLSVISFDAHRDCSHFGQPYGHGTTFRRAIEEELIDPHSSIIIGVRGILPKELGFELIDMESFYASNIADIGNTISKVIGQKPCFVTFDMDCIDPAYAPGVNTPEICGFTSRECLFLIRQLEGLSIVGCDLVEMNPQYDYGEITAYLAGNIIFELLSIILKNK. 315
196 0.000e+00UniRef50_C3MMG9 Agmatinase n=45 Tax=TACK group TaxID=1783275 RepID=C3MMG9_SULIL  ali  30  4.....IDALKSPRFTQISTFGRLPI--CGRDEEIKAAFLGIPFDDAVTYRPGARFGPMGIRQGSRLLRPYNQFLDT--YPFDKLNACDMGDINIIPGYIEDTMNIIQTNLYEIISKNLVPFIAGGDHSITLPVLRALHKKYGKINIIHLDSHYDFWDSYWGHTHGTWLRRAIEEGLIKEA--IQGGIRASDKERLGVKSFTIRDL-KYNLDSVIREINSLSG--PTHVSIDIDVVDPAFAPGTGTPEVGGLTSFEIIEIIRKLRFDKLVGFDVVEVAPPYDVSEITTMLAANIIYEGMSVLSLN.. 304
197 0.000e+00UniRef50_UPI0004898695 agmatinase n=1 Tax=Rhizobium leguminosarum TaxID=384 RepID=UPI0004898695  ali  35  8..FTPTDANRIPRFAEVATFMRTKALPLERADEVNVGVVGVPFDLGSSYRAGSRHGPAAIREASRVLRLVNGHT--GVAPFEIARIADLGDAKIHPLNFDQSIEIITRCFLQLSKMAVRPLVLGGDHTISLPILRGLVQR-EKVGMIHFDAHSDTSDEGMKISQATPFRRAVEEGLLDPERVVQIGLRGQWARSVGMTLITIDDFEERGRSAVIEEIRDIVGTWPAYLSFDIDCLDAVFCPGTGVPEPGGVSMRDALVMLRGLRGIDLIGADICEVSPHFDVGGITSLHAAHLGFEMLCLLAESAG 318
198 0.000e+00UniRef50_Q7VRG4 Agmatinase n=4 Tax=ant, tsetse, mealybug, aphid, etc. endosymbionts TaxID=84563 RepID=SPEB_BLOFL  ali  57  3...TLMHKHDDSLFSNSFGFLRLPLEFYPYTRHNDWVITGVPFDIATSGRSGSRFGPASIRKASINLAWENCRWPWNFDIRQKLKIIDCGDLIYKSGNVQDFTNILQKHIENLLRFRKKILLLGGDHYITLPVLRAYSKFFGTISIIHFDAHADYYDNNNQYDHGAVILYALHEKLINPNRSVQIGIRTEYDKNFGFTVLDAEYVNTTAVHVLINQIVSVIQNRPVYLTFDIDCLDPSVAPGTGTPVIGGLTTSCALQIIRGFQKLNIIGIDIVEVAPVYDCAQITALAAATLGLEML........ 297
199 0.000e+00UniRef50_A0A1W6JYS4 Agmatinase n=1 Tax=Acidianus manzaensis TaxID=282676 RepID=A0A1W6JYS4_9CREN  ali  32  4.....IDPSKSPRFAQISTFARLPICK---EEDVRAVFVGVPFDDATTFRPGARFGPSGIRQGSRLLREYNQFLDT--YPFEKLNMCDQGDINAIPGFLDDTMKIIENGIYEIISKNRVPFIAGGDHSITLPVLRAMRKKYGKVNLIHLDSHYDFWDTYWGYTHGTWLRRALEEGLLN--EVVQAGIRASDKKKLGIKSFT---INEMKEKIEEIISIINSLNGNTYISIDIDVVDPAFAPGTGTPEVGGLTSYEIINFIRKL-KTKIIGFDVVEVSPPYDVSELTSMLAANIIYE.......... 294
200 0.000e+00UniRef50_A0A2R8CES8 Agmatinase n=3 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A2R8CES8_9RHOB  ali  43  21...GPDGTHVEMPYSGIRTFLR--RRPSVDMTGVDIGVYGIPFDLTTSGRPGARLGPSALREASAQLA-WGEVWPWGFDPFDILSVVDCGDVPFRRGQVEQMRDSAVAMARHISGAGAGTLMLGGDHCTTYTAIKAHAERHGPLALVQFDAHRDTQKS-NWFDHGTFVHHAMQDGLIDPEHSVQIGIRTHYDNDDPIKVLYRDWMHDHGWRGALEKMRQVVGNRPAYLSIDIDSLDPAYAPGTGTPVVDGLTPNDIIQFLRGSVDVNFVGMDIVEVSPPYDHADITALLGASLALEYICARAARR. 318
201 0.000e+00UniRef50_A0A1G7QV34 Agmatinase n=1 Tax=Desulfovibrio legallii TaxID=571438 RepID=A0A1G7QV34_9DELT  ali  37  3....PVNSLESPRFCGIRTFMRQ-PAAAAGAAPADVSIIGVPFDSGVSYRPGTRFGPAAVREASTLLKPYSPEL--DVDVTEAFSIADHGDIDTIPGYMEESFTAITAGLLPFFRANTLPVILGGDHSISLANLRAVKEAQGPVALLHFDAHSDTLPSYYGYNHGTPFYWAISEGLILPERSVQIGIRGPWPRQQGLRIIMGHEAHALGLEAVIREALARVGDAPVFLSFDVDFLDAAYAPGTGTPEVEGFTTYEAMTLVRGICSHRTIGMDLVEVLPDKDAAGITALAGASVIFAFL........ 304
202 0.000e+00UniRef50_A0A1I1HD76 Guanidinopropionase n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1I1HD76_9RHOB  ali  34  5.SFRPPSGFDLPRYAGVPTFMRLPYVPDPRLAEVQVGLIGVPWDSGTTNRPGPRHGPRQLRDMSTMIRAQNGAT--GVRPFERINCADLGDVSPNPADIQDSMARITTFYDAVREAGVLPLTAGGDHLTSLPVLRALSKPA-PLGMIHFDSHTDLFKDYFGYTHGTPFRRAVEEGLLEPKRVVQIGIRGDFADAVGIRVIPIEEFHARGPEDVMTEAKEIVGTSPTYISYDIDFVDPAFAPGTGTPEVGGPNSHQALLVARLLEGVNIAGADLVEVSPPFDPSGGTAFLAVSIMFEILCNMA.... 315
203 0.000e+00UniRef50_B9WIN5 Arginase, putative n=4 Tax=Saccharomycetales TaxID=4892 RepID=B9WIN5_CANDC  ali  35  27............PFQGIATFAHLEHFQCLSEKQFDIGIIGVPFDTAVSYRPGARFGPRAIRDASQRLRGFNPKALFDPY-QSWAKIIDCGDIPVTPMDNSAAYKQMSEAFKDLLNNTEIPIALGGDHSVLLPHLRALHRIYGPLNVIHFDAHLDTWSEKNDINHGSMLWKAYEEGLTTKHNI-HVGVRTRDDDEQNFVRIEADDIWLKGPQWVVDKILTTIKDTATYISVDVDVLDPGFTSGTGTQEPGGFLPRELIYLLRSIEGLTVVGADVVEVSPAYDIAEITATNGAQIAYEILTSMVKR.. 345
204 0.000e+00UniRef50_A0A1Y2NJ92 Guanidinobutyrase n=132 Tax=root TaxID=1 RepID=A0A1Y2NJ92_STRPT  ali  34  32............VFGPETSFLGLPRCEQSPYAGADVVILGAPFDGTTSHRPGTRFGPQAIRR-TDYLPPYRPHLGLGVDPFTELKIVDAGDVPTPPGETERAHQLLERTVSEVVAAGAIPFTLGGDHSIAWPTMRGIAGRRGPFSVVHFDAHADTSDFGAEYGHGTVMRRLLESGTVPGDRFTQIGLRGYWPAGLGVRSITMSELRSRGLDTCLDDVLDQIGPGPLYLTIDIDVVDPGMAPATGTPEPGGLTSRELLDAVRTCAQRDLVGAEIVELSPPYDPGEITAYLANRIVLEVLSGMAWKR. 342
205 0.000e+00UniRef50_A0A0H4W4P5 Guanidinobutyrase n=48 Tax=cellular organisms TaxID=131567 RepID=A0A0H4W4P5_9BORD  ali  38  10..........LPRYSGMPTFMRVPQA--APQDDFDIALAGVPFDGGVTLRPGARFGPREIRNMSSMTRA--IHHVTGFNPFAVCKVADIGDVPFTFGQLEAAHADIRRFFAPLFAAGKKVLVAGGDHSITFPIFQAIAPR-QPLGMVHIDAHTDTWDEGSKFSHGSPFRRAVEAGLLDPRRTIQIGIRGRYSLDHGMRVVFIEEFDAAGVQAIVREARRVVGPGPAYLSVDVDGLDPVYAPGTGTPEIGGLSTRETLALLRGLDGLDFVGADVVEVAPPYDPSGNTALLGATLMYECLCLLARS.. 309
206 0.000e+00UniRef50_Q3J2B4 Agmatinase n=10 Tax=Rhodobacter TaxID=1060 RepID=Q3J2B4_RHOS4  ali  45  17..RGPRGYAYENAFAGATSFLR--RRYTKDLTGVDLAITGVAFDQAVTNRTGTRFGPRAIREAST-LQPYDRPFGWGFDPLEELTVVDYGDLAFDYARTAEFPARLTAHVAGILAAGAGALTLGGDHSITLPILRAHAAVFGPLSVVQFDAHSDLWDDPGRIDHGTFMYKAVKEGLVDPARSVQVGIRTDTPDWLGMNVIDARTAHEQGPAAVAARVHAIVGHHPTYLTFDVDALDPAFAPGTGTPVWGGLASWQAAAILRDLAGLNLVGGDVVEVSPPYDPSGITAVAGAHVAYELICLYGWRR. 318
207 0.000e+00UniRef50_UPI000D7FEAFF Arginase/deacetylase n=1 Tax=Tilletiopsis washingtonensis TaxID=58919 RepID=UPI000D7FEAFF  ali  36  40..........MPPHGGVRSFAGLPWTSCLHNEQVDVALLGMPFDGGVSYRPGARFGPKAIREASRRQRTNSWSLEYEQAPYEALFFMDCDDVPITPYDPAVALAQMEAAYVTLLQRTPLVIVLGGDHTVVLPILRALHKTYEPIAVLHFDAHLDTWTPQSRINHGSFFARAADEGLIDRNASVHAGLRCRHDDQVGFERVMTSDLDLLGREGVIERIRSRIGDRPVYLSIDIDVLDPSAAPGTGTLETGGWTTRELHGILRGLRGLNWIGADIVEVSPPYDHAEITAYAASDLVFEIANLFA.... 371
208 0.000e+00UniRef50_A0A0K2SLE4 Guanidinobutyrase n=2 Tax=Limnochorda pilosa TaxID=1555112 RepID=A0A0K2SLE4_9FIRM  ali  38  1MKYRPVTEEMQPRFVGLQTFMQMPHNRQTD--GVDVAIVGLPFDTGGTYRVGARFGPAAIRAASQMLHPYNPAT--GVDLTERLSAVDYGDLRVVPGAVERSHALLADGLEPLHRNGLRVIGLGGDHSVSLPHLQAAASVHGPLALIQFDSHSDLWDEGERRNHGTVIRRALEEGFIDPSASIQVGLRGAFSREFGFAVLSTADLRHRPLREAPRKIRERVGERRSFVTFDVDFVDPAFAPGTGTPEVGGFSSWETLELLRGLSGIEFVGFDVVEVIPAYDHASITALLAATVVHEMLGLVA.... 310
209 0.000e+00UniRef50_P0DJQ4 Proclavaminate amidinohydrolase n=47 Tax=Actinobacteria TaxID=201174 RepID=PAH_STRC2  ali  37  4.....IDSHVSPRYAQIPTFMRLPH--DPQPRGYDVVVIGAPYDGGTSYRPGARFGPQAIRSESGLI--HGVGIDRGPGTFDLINCVDAGDINLTPFDMNIAIDTAQSHLSGLLKANAAFLMIGGDHSLTVAALRAVAEQHGPLAVVHLDAHSDTNPYGGRYHHGTPFRHGIDEKLIDPAAMVQIGIRGHYARGHGVRVVTADEFGELGVGGTADLIREKVGQRPVYVSVDIDVVDPAFAPGTGTPAPGGLLSREVLALLRCVGDLKPVGFDVMEVSPLYDHGGITSILATEIGAELLYQYAR... 307
210 0.000e+00UniRef50_C0RIC4 Agmatinase n=613 Tax=root TaxID=1 RepID=C0RIC4_BRUMB  ali  42  13..RSLTSAATDPTHAGVLSFMR--RTYSKSLKGAEAVVWGIPFDAAVSNRPGARFGPQAIRRASAIFD-NDPQYPFERDLFENLAVIDYGDCLLNYGNHTKTPSTIEREAAKILKSDAFLLTLGGDHFITWPLLKAHAAKYGPLALVQFDAHQDTWDDGRRIDHGSFVARTARDGIIDPDLSIQIGIRTHAPEDCGIRIIYGHEVEDMPAAAIADAILKRTNGRKAYLTFDIDCLDPAFAPGTGTPVAGGPSSAKMLSVLRKLTALDFVGADVVEVAPAYDHADITAIAGATIAMYYLGLLGERK. 313
211 0.000e+00UniRef50_A0A0U3B3E2 Uncharacterized protein n=3 Tax=Lacimicrobium TaxID=1751872 RepID=A0A0U3B3E2_9ALTE  ali  50  24..............................DAQTQVVIAGIPFDLATSGRPGARFGPAAIRQASVNLGWEKKRHPWPFALRDALNIADIGDLAFSHGDARGAMEAVREHVSQVVRSGAIPFMLGGDHLITLPALQAVHAKHGPVAVVHFDAHSDDYAGGSEFDHGSVFYHARKQGLLQDEKVIQIGIRT----EQGFKVLCADELWHSKAEEVVARIKNTVGDAPVYLTFDIDCLDPVYAPGTGTPVSGGLSGPFVLELLRKLHGLNWVGMDLVEVSPPYDQSQITSLLAATMMTDMLCLLACQQ. 297
212 0.000e+00UniRef50_A0A1E3QKG1 Uncharacterized protein n=8 Tax=saccharomyceta TaxID=716545 RepID=A0A1E3QKG1_9ASCO  ali  39  51.......WGEDWPFSGLSSYAHLPYHKCLPDTDFDIGIIGVPFDTATTYRTGARFGPKGIRAASRQTKLRGYNPRAGINPYDWAKVIDCGDIPVTPMDNNLALRQMTVGFEELLEAGARLVAMGGDHSILLPHLRALKKAYQEIHVIHFDAHLDTWSPQSEFTHGSMLWMAAKEGLINANNNVHLGLRTDEDEDLGFTRISADDIHQSGVNYVVDKILETIKNKPVYLSVDIDCLDPGFAPGTGTIESGGLLPRELIYILRKLEGLNLVGADVVEVNPAFDHSEVTTTNGAQVVYELVTSMVKR.. 388
213 0.000e+00UniRef50_A0A0B7G0F3 Agmatinase n=76 Tax=Dikarya TaxID=451864 RepID=A0A0B7G0F3_THACB  ali  34  44.WAEKYGPQEDLPFSGPLSFAHLPYSKCLDVANFDIAILGVPFDSAVTYRPGARFGPYGIRSGSRRISPYGYTTAWGYNPYDNTTIMDCGDVPTIPFDIPMAMDQIDTAYSTLIQRHPRIMTLGGDHAIILPILRSLHSIYGEIAVIHFDSHLDTWPVQGLYTHGTMFWTAMNEGLIAKGNSIHAGIRCMNDQQVGFSMITTDDIEELGTGGIIEAIKRRVADKPVYISIDIDVVDPGLAPATGTPEPGGWTTREVKRILRGLAGMNIIGADLVEVAPAYDTNESTTIVAAGIVHDLLSVLIGR.. 390
214 0.000e+00UniRef50_A0A1F3SVX8 Agmatinase n=1 Tax=Bdellovibrionales bacterium GWB1_55_8 TaxID=1797386 RepID=A0A1F3SVX8_9PROT  ali  40  2.........TSPRFSGPTTFNRLPYVPDFEGKDVDVVLLGIPFDGGTSFRPGSRFAPRAVREASVLSRNYHPEMA--VHVYERLNVVDGGDVSVNPLNFQKTMASIEAEVTRVRRAGARSICVGGDHSVLLPELRALHRTRKKTALIHFDAHTDTADWGEKYHHGTPVRRAIEEGILRGSRVFQIGIRGPFVRESGIHVLGIDDFHDRKYRAFFSKLKKAAGRSPCFLSFDVDVLDPAYAPGTGTPVVGGMTSFDALRALRGLAGLNIAAADVVEVSPPYDHAQLTSLVGAAVIFEILALMA.... 312
215 0.000e+00UniRef50_A0A1I6GFN6 Agmatinase n=5 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1I6GFN6_9RHOB  ali  45  28.............FSGAPSFLR--RTYTKDLSDVDLAITGIAFDQAVTHRPGTRFGPRAIREASC-LQPYDPPYGWDFDPLSEFAIIDYGDMPFDYANVAQVPSLIEAHFARILHAGPGTVALGGDHFMTLPILRAYAAKYGPLAVIQFDAHSDLWDDMSRIDHGTFMYKAVKLGLVDVARSVQVGIRTECDDYLGMTYIDARACHERGTADVVAQIKQIVGAHPTYVTFDIDALDPAFAPGTGTPVWGGLASWQAAAMLRDLAGINMVGGDIVEVSPPYDTTGATAVAGAHIAMELCCLALWNR. 319
216 0.000e+00UniRef50_U1MUQ6 Uncharacterized protein n=4 Tax=root TaxID=1 RepID=U1MUQ6_9MICO  ali  36  49......DDPGLPRYAGIATFALLPQLH--EVEHADVAVVGIPFDSGTSFRPGARFGPAHVREHSRQLHPYHQVHES--FPFRDQQVVDGGDLRVGPYDIEAAVEAIHEQARALVQGGTTVVAIGGDHTIALPLLRAAAERHGPLAVLHFDAHLDTWDTLHGIWHGSPFRRAAEEGLLDLERCQHVGIRGGDDARVGFAIIRSDDFARHSPEQLAERIRDRLGTGQVYVSIDIDVLDPAHAPGTGTPEVAGISTRELFGVLRELRGLDIVGGDVVEVLPAHDHAGITGLAAAHTVWELLALI..... 349
217 0.000e+00UniRef50_A0A1Y0EBE9 Agmatinase n=13 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1Y0EBE9_9RHOB  ali  44  28.............FGGAVSFLR--RAYSKELSGVDLAVTGIPFDQAVTHRPGARFGPRAIREASC-LQPYDPPYGWDFDPLSEFSIVDYGDMAFDYASVAGVPALVEAHIARILAAGAASITLGGDHFITLPILRAYAAKYGPLSVIQFDAHSDLWPDMARIDHGTFMYKAVKLGLVDPARSVQIGIRTQCDDYLGMRYIDARSCHARGVADVVAEMRGIVGDHPTYVTFDIDALDPAFAPGTGTPVWGGLASWQAAALLRDLAGINMVGGDIVEVSPPYDTTGATAIAGAHVAMELCCLALWNK. 319
218 0.000e+00UniRef50_UPI0007131E7B agmatinase n=2 Tax=Rhizobiales TaxID=356 RepID=UPI0007131E7B  ali  34  1MSVLPVDSLETPRFCGVPTFMRLPQATSLKELDA--AIIGLPSDSGGPYRTGARFAPNAVRAMSVMLRPINP-YRGNLNIFEALRVADVGDANVVPGYEIQSLERIEESVSALVSAGIVPFGIGGDHSITLAELRALAKVQGPISLVHFDSHTDTWDSYQKYSAGTPFRRGVEEQIIDTASSIQIGMRGSLFQELGYEVLTTDEALDLGPRALADRIASRVAGKPVFISFDMDFVDPSAAPAVQTPEAGGPTARETLQIIRALHGIDLVGCDVVEANPLYDSTGITALLAATIMAEFLALLASRR. 314
219 0.000e+00UniRef50_A0A166S1B9 Arginase/deacetylase n=3 Tax=Fibularhizoctonia sp. CBS 109695 TaxID=436010 RepID=A0A166S1B9_9HOMO  ali  37  38.WLSKYGKPIDMPFSGPLSFSHLPYSVCLEDESADIAILGFPFDTAVSYRPGARFGPFAIRAGSRRQRTQGYSLSWGMNPFDEATVIDCGDIPISPFDNALALDQMEVAYSTLLNRHARIVSLGGDHTIVLPILRSLNKIYGPISVIHFDAHLDTWPGYQGINHGTFFAVAQEEGLISNT-SIHVGVRCEHDQSVGFELITTDDIDDLGIPEIIRRVRARIGDSPVYLSFDIDVIDPGLAPATGTPEAGGFTTREVKRIIRGLAGLNFVGADIVEVAPAYDHADITGIAAADLVSDFLSMF..... 375
220 0.000e+00UniRef50_A0A2C9D6R5 Agmatinase n=4 Tax=Rhizobiales TaxID=356 RepID=A0A2C9D6R5_9RHIZ  ali  41  18..PTILGGATEPTYGGTLSFMR--RMLSRELENVDAVVWGIPFDSAVSNRSGARFGPQAIRRASAIFDG-DPNYPFGFDIFEELAVVDWGDCSLDYGRPQDARLQIEAQAGEILDAGCHLFTLGGDHYVTWPLLRAHAERFGPLSLIQFDAHQDTWDDDDRVDHGAFVAWAVRHGIIDPSTSIQVGIRTHAPEDCGLEILYGHDIDRLGIAGVLDRICNRVGDNRAYMTFDIDCLDPAFAPGTGTPVSGGLTTREMIALITGLEDIDFVGGDVVEVAPAYDHADITAIAASTVAQSYLGLLAAKK. 319
221 0.000e+00UniRef50_A0A060T991 ARAD1C42174p n=8 Tax=Saccharomycetales TaxID=4892 RepID=A0A060T991_BLAAD  ali  38  24.......WGTDWPFSGISTFAHLPTEKCLPDESFDIGVIGVPFDTAVSYRPGARFGPRAIRAASRQTSLRGFNARAGINPYAWAKIIDCMDMPVTPVDNKIALTQMTAGYKELLKRPPRLITLGGDHSIVLPALRAYHEVYGPITVIHFDAHLDTWWGDTEFTHGSMFWMAAQEGLLDKDHCVHAGLRTRSDDQSGFARIGSDEIMG-DVQGVVSKILDRVPKDPVYISVDIDVIDPGMAPGTGTPEAGGWLTRELIQVIRGLSGLNIIGADVVEVSPAYDHAEITALAGAQIAYELITSMV.... 351
222 0.000e+00UniRef50_UPI000852C38D agmatinase n=1 Tax=Vulcanisaeta thermophila TaxID=867917 RepID=UPI000852C38D  ali  32  9....PIDALKSPRFTQIITFARLPFTRNLRDNNVLGVFLGVPFDGGATFYVGARFGPQYIRSESRILRPYNAEL--DVYPFKVLRAVDYGDVDVIPVSITKTLDGIEEVVKDVINQGATLFIAGGDHSITLGVLRAIGKMFKPI-LLHFDSHLDYWDEYEKYTHGTWVRRAIEEGLI--AQVVQVGIRGTQYDKSDFRVIMMREVEERGIEWLISELRSL--EGNVYVSFDIDVVDPAYAPGTGTREPGGFTSNEVLRIIRSLAKINLVGFDVVEVAPPLDVANITSLLAANILYQAMSVKSK... 314
223 0.000e+00UniRef50_A0A1Y5R7U2 Guanidinobutyrase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A1Y5R7U2_9PROT  ali  36  5.YPEFADPKVRPRYTGIPTFMRTPYAEDWTGL--DIGLIGVPFDGGVTNRPGARHGPREIRNQSSLIRR--INHATKIDPYALCRIADLGDAWVEPFELKGAHDEIAAFYKAVQAAGIVPVSAGGDHSVTLPIFRAIA-ADRPVGMVHFDAHCDTGDDYSKFHHGAPFRRAVEEGLLDPKRTIQIGIRGSFSHESGMRVIYIEEFHEIGVKGAIAEARRVVGDGPVYVSFDVDGLDPVYAPGTGTPEVGGFSTLEAQLMIRALGDLDIIGGDVVEVAPPFDPSGNTALVGATIMYEILCAHARRNG 319
224 0.000e+00UniRef50_A0A160T3Q5 Proclavaminate amidinohydrolase n=45 Tax=Bacteria TaxID=2 RepID=A0A160T3Q5_9CHLR  ali  41  16.............YAGVPTFMR--QTPTRDLSGVDVAIVGVPFDSGTSFRGGTRFGPRHIRAAS--LALWGTHHIHGVAPTDALTIVDYGDVEIEMAYIEKSMDFITTEVGAALAQGAMVVALGGDHSISLPLLRAQAAAHGPLAVVHFDAHTDV--EPGGYEHGTVFRHAIEEGLIDPTAYIQVGIRGSLARRLGARVLTIDDCFEMGIPAVIEAIRETVGDRRVYVTLDIDATDPAFAPGTGTPEPGGFSSYQMLQLMRGLKGLNLVGMDLVEVSPPYDQSDVTAILAANLVFEYLCLVALRR. 315
225 0.000e+00UniRef50_A0A168NCE5 Uncharacterized protein n=11 Tax=Mucorales TaxID=4827 RepID=A0A168NCE5_ABSGL  ali  38  57..........MPSFAGISTFAHLPYLQCFEEEDYDIAVIGAPYDIGVTFRTGARFGPSAIREGSKRIKGFNYEIK--VNPFSWAKLVDCGDIPFEPFDAEHAMGQIEAHAKYVLQRPPKPVTLGGDHTILLPVLRAMHAAYKPITVIHFDSHLDTWAPQSRFNHGNPLYHAAKEGLTTNGTSMHVGIRSSRDEALGFRMVKANDIFTMGVEGMVERIKEVIGDTLLYLSIDIDVIDPSMAPATGTPESGGLLTRELKYILRGLNGYDIVGMDVVEVAPAYDTAQLTSFLAADLIYEIMSMMVKR.. 383
226 0.000e+00UniRef50_A0A1J8QFH2 Uncharacterized protein n=1 Tax=Rhizopogon vesiculosus TaxID=180088 RepID=A0A1J8QFH2_9HOMO  ali  35  427.SRAKYGAQTDLGYTGPLSYSHLPYTRCLDDTTFDIAVLGMPFDTATSYRPGARFGPYAIRSGSRRQSPGGYALNWMTNPYNHATVIDCGDVPVNPYDNALAIDQMETAYTTLLSRHPRILTLGGDHTIVLPILRSLHQVYGPISVIHFDAHIDTWPEQSKVTHGTFFTLAFEEGLMSNT-SIHAGIRNEHDEEVGFELIMADDIDDLGTDEIIKHIRQRIGNSPVYLSFDIDTIDPGQAPATGTPEPAGWTGRETKRILRGLAGLNFVGADIVEVAPAYDNADITGILAAGLADDFLTLFV.... 765
227 0.000e+00UniRef50_A0A0M6YD72 Agmatinase n=8 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0M6YD72_9RHOB  ali  42  21...GPDGTFVEMPYSGIRTFMR--RRPSLDFETADLAVYGIPFDLTTSGRSGARLGPSALREASTQLA-WGEVWPWGFDPFDRLSVVDAGDIPFRRGQVQQMLDSATEFARRICAGGASTIMLGGDHCTTYTALKAHAEKHGPLALVQFDAHRDTQESDF-LDHGTFVYHAIREGLIDPSRSIQIGIRTYYEDNDPMTVLYRDWLHEHGWRGALEKIRALVGDRPAYLSIDIDSLDPAFAPGTGTPVVDGLQPNDIISVLRDTVDINFVGMDLVEVAPPYDLSGSTALLGASLILEYICARAARN. 318
228 0.000e+00UniRef50_A0A1W9HT52 Agmatinase n=1 Tax=Proteobacteria bacterium SG_bin7 TaxID=1827384 RepID=A0A1W9HT52_9PROT  ali  40  1MEYKPLSGREFPRFSGIKTFFRMPVADI--DADYDVGIFGIPFDGAVSYRSGCRFGPSKIREVSSLGRGY--HWGREINFFEKIKVADIGDSPTVPVDQKLCFERVEKFVADVLKNKKKFISVGGDHSTTLPILRQLKKKYKPLRLVHFDAHLDSYPWGFEYHHGTFVRHAVEEKLIDPKISHQIGIRGPLADDLDFNVHTVDDIRD-DFKKVLKD-LDKFGDEPTYISFDIDCLDPAYAPGTGTPVIGGLTTYETQKILRNFKIKNLVGADIVEVSPPYDHADITALAAVDTMFEILSIYADSK. 310
229 0.000e+00UniRef50_A0A1L9SLM0 Uncharacterized protein n=5 Tax=leotiomyceta TaxID=716546 RepID=A0A1L9SLM0_9EURO  ali  37  44.............YSGISTFGHLPHKRCLPYERFDIGVIGVPFDTAVSYRPGARFGPRAIRAASRHLPSRGFSTYSGLNPYSWAKVLDCGDVPVNPFDNDLALRQMTEALEELSAKRPKLLILGGDHSIALPALRAMNKAYGPVAVVHFDAHLDTLHPQTEFTHGSMFWQAGNEGLVLNDSSIHAGLRTIRDDEQGFLRLTTEDIDDIGPQGIVDRIIERVGTRPVYLSIDIDVLDPSIAPGTGAPEPGGWTMREMNRIIRGMDKLNIVGADIVEVSPAFDHTENTAFAAAQLGYEIILNWVKK.. 400
230 0.000e+00UniRef50_A0A088U2K6 Agmatinase n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A088U2K6_9BURK  ali  36  5.FPQPLDAADIPRFAGIPTFMRLPLFDDPAQLQ--IALVGVPWDGGTTNRAGARHGPREVRNQSSLMRRVHHVSR--IAPYDLVRVGDLGDAPTNPIDLLDSLARIERFFRRIDAAGAVPLSVGGDHLVTLPIFRALAAR-RPIGMVHFDAHSDTNDRYNRYTHGTPFRRAIEEGLLDPQRTVQIGIRGAFARDCGIRVIAMEEFTALGVAATLAEARRVVGSGPTYVSFDVDVLDPAFAPGTGTPEIGGMTTLEAQHLVRGLQGLNLVGADVVEVSPPFDAGGATALVGATMMFELLCILA.... 311
231 0.000e+00UniRef50_C5BAV1 Agmatinase n=22 Tax=Proteobacteria TaxID=1224 RepID=SPEB_EDWI9  ali  71  9.........DNSLVSNAFGFLRLPLDFMPYDGDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEGKRWPWNFDMRDRLKVVDCGDVVFSFGDAQEMSDNLQAHAERLLASGKRCLTFGGDHFITLPLLRAHAKHFGKMALVHFDAHTDTYAHGSKFDHGTMFFHAPNEGLIDPQHSVQIGIRTEYDHDNGFTVLDAAQVNDRSVEDVLAEVKRIVGDLPVYLTFDIDCLDPAHAPGTGTPVIGGLTSDRALKLVRGLQDLDIVGMDVVEVAPAYDQSEI..................... 284
232 0.000e+00UniRef50_A0A0G3XWG0 Guanidinobutyrase n=83 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0G3XWG0_9BACI  ali  37  2..QYPLTPDVKPEFCTTGSFMRLP----ADRENAKLAILGMPFDTAASFRVGARFAPQAIRQASMTLFPYHPIHK--VYPFEDTNGIDIGDVSVIPNNIHKSYELMENAVFDLMKKGIVPIGLGGDHSVTLASLRAAAKVYGPVALIHFDSHTDTWDTYEKYWHGSPFVRAHEEGLLIPDKVFQIGIRGTLNHKLGYNVITTQELAKRSLNDIAQEMKETIGETPCFLSFDIDFVDPSCAPGTGTLEVGGFSSRETLDIVRSLTDFNYIGFDIVEVLPAYDPAQITALLAATLVHEFASIVA.... 305
233 0.000e+00UniRef50_A0A2H0WI42 Agmatinase n=2 Tax=Bdellovibrionales TaxID=213481 RepID=A0A2H0WI42_9PROT  ali  38  7..FQPLSGREFPRFSAIKTFFRLPVVEIK--EKFDVALFGIPYDGGVSYRPGARFAPTEVRNASSL--GRGFHWNRELNIFEQLKIADVGDCPTVPIDQNQTYEKIEKFVGSILKTNKKFVAVGGDHSTTLPVLRALKKHYKPLAFVHFDAHLDTYPWGCEYHHGAFARHAVEEGLVDPKKMLQIGIRGPLAKKHKVQVKTVDDVRAGSLDQFL-KTLPTFDNTPTYISFDVDCLDPAFAPGTGTPVVGGLTSYETQRILRALKIPNLVGGDVVEICPPADHADITSLVGVDVMFEMLCLM..... 311
234 0.000e+00UniRef50_A0A069DLT8 Uncharacterized protein n=7 Tax=Bacillales TaxID=1385 RepID=A0A069DLT8_9BACL  ali  35  1MYRPLTEKGK-PAFGGIRTFMHLPHIKTLD--HVDYAIIGNPFDTGAGYAVGTRFGPSAIREMSQRIRTTNPA--QGIDSSEYLSGIDYGDLSIYPGYIEQTYETVQEQLAPIYDKGIVPIILGGDHSISYPHVKAAAAQYGPISLVHFDSHSDAWEPMDRFSHGNMFYHGAKEGWINTQTSIQMGMRGHSSRALGFDLLTTDDVKRMGTEQLCQRVKDRVKDTPVFLTFDIDFLDPVFAPGTGTPEVGGFTTYEAIQMLRGLAGINIIGCDLVEVLPDRDPTRVTALNAATIVSEFITLLAIRR. 310
235 0.000e+00UniRef50_A0A1Y4NS07 Agmatinase n=1 Tax=Lachnoclostridium sp. An169 TaxID=1965569 RepID=A0A1Y4NS07_9FIRM  ali  37  30................PGTFGRLPYMRTL--EDVDYVVVGIPFDTLTSNRPGTRFGPKAIREA---YGGINYVYGTDVYAAETLSGVDYGDIQVQNGDTKQSFENIKAEIGKILEAGVIPVALGGDHSITYAELLAYRDVYGPVSLIHFDSHTDTWGGEESLTHANPFRNAILTGCIDPKTSIQVGMRGIMKSEHDYDFIFATDLHKMGVYEAAKKIREKVGNNKVMVTFDIDFVDPAIAPGTGTPVPGGFTSWETLELVRAITGLDVVGFDLVEVAPNYDPTENTQLLANKLVGEFITAIAAKK. 325
236 0.000e+00UniRef50_A0A284R5A1 Related to agmatinase n=1 Tax=Armillaria ostoyae TaxID=47428 RepID=A0A284R5A1_9AGAR  ali  38  100........TADAIFSGITTFAKLPWVQCLTKEKFDIAFIGAPFDTGTSYRPGARFGPAGIRTGSRRLTLYGYNVPLESNPFSGLKIVDCGDIPVTPYDNKVAIKQIEEGHKALLKHHPRVITLGGDHTIVLPLLRSIYSAYGPISVIHFDSHLDTWSDVAAINHGTYFYWASQEGLIKNGSSIHGAIRTTNDDDAGFKRIEAREIDVIGTDGIIKKIRETVGDAPVYLSIDIDSIDPAFAPATGTPETGGWSTREIRTILRGLDGLHLVGADIVEVAPAYDTNELTTIAAADVLFEVLTVMAK... 448
237 0.000e+00UniRef50_A0A2V8C9B5 Agmatinase n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8C9B5_9BACT  ali  36  1MTHQPRASFKSPRFAQPATFMRLPHVDDPHGL--DVAIIGVPFDGGTSYRPGSRYGPREIRNQSSLIRSYSYFQR--VAPFERLNVADAGDIDAPPVSIEKCYAVVEERIGATVEAGARPIVIGGDHSISLPVLRALARRHGPLGLVQFDAHIDTWDEYGKYFHGTPFRRAIEEGLVDGRRFIQVGIRGPMYREHGITVIDIDQLKDRGVAWAIAEIRRVV-TGPAYMTYDIDSVDPAFAPGTGTPEIGGLTSHDAQRLVRGLAGLTLLGGDIVEVAPVYDPGQITSVLAANLMFEFLCALA.... 308
238 0.000e+00UniRef50_A0A0T8FRU1 Formimidoylglutamase n=136 Tax=Bacteria TaxID=2 RepID=A0A0T8FRU1_STREE  ali  36  3...YPLSPDVKPEFCTTGSFMRLP----AERENAKVGLVGMPFDTAASFRVGARFAPQAIRQASMTLFPYHPVH--DVYPFDDTNAIDIGDVPVIPHNIHRSYELMEEAVGALMDRGIVPIGIGGDHSVTLASLRAAAKRYGPVAMIHFDSHTDTWDTYEKYWHGSPFIRAYEEGLVDPKKVFQIGIRGTESKDLGYHVVTAGELERQGFSVILEQMKTAIGETPCFLTFDIDFVDPSCAPGTGTLEVGGFSSRETLQMIRSLTGFNYVGFDLVEVLPSYDPTQITSLLAATIIHDFASLVAVK.. 307
239 0.000e+00UniRef50_A0A125STW8 Guanidinobutyrase n=9 Tax=Bacteria TaxID=2 RepID=A0A125STW8_9CYAN  ali  38  9..YQPANSLESPRFSGVRTFARLPYVQDPA--DVDVAIVGLPFDTGATFKVGARFGPEAVRGASALLRPYNPEL--DVMVFETLSCVDYGDAPVVPGFIEDSLDAIARTIQPLAEAGVIPLSIGGDHSVALGELRALAAVHGPLALVHFDAHGDYWDSYHKYTHGTPFRRAVEEGLIVPEASVQLGMRGPTPRRAGFTVLTTTQLMRHTPEEIGALVREKVGDRKAFLSFDVDFFDPAFAPGTGTPEVGGPTSFQGLGYLRACTGLTWVGGDVVEVLPAMDHSQVTAHLGAQIGYEFLSLVALSK. 317
240 0.000e+00UniRef50_A0A268E999 Agmatinase n=1 Tax=Bacillus sp. 7586-K TaxID=2021690 RepID=A0A268E999_9BACI  ali  35  11...........PPFAGIRTFMKLPHTNDL--ENVDFAVIGVPFDTGAGYAVGTRFGPAAIREMSQRLRPINPALNM-IELSKYMNGIDYGDLTVHPGYIEYSYEEIEAQLEPIFEKGIIPILLGGDHSVSLPHIRAAAKKYGPVSLVHFDAHSDTWDPKKKYSHANMFSLGADEGVIDPHTSIQMGMRGGGPNALGYEVLSTDDVKKLTVSELCEKVKQRVKNRPVFLTFDVDFLDPVYAPGTGTPEVGGFTTYEAMQMIRGICGINIIGFDIVETLPDRDPAKVTALNAATITHQVLSIIAMKK. 311
241 0.000e+00UniRef50_A0A2W1HEY8 SpeB, Arginase agmatinase formimionoglutamate hydrolase, arginase family n=1 Tax=Pyrenophora tritici-repentis TaxID=45151 RepID=A  ali  38  444..........DSIFSGISTFGRLPYHPCLSDVDYDIAFIGAPFDTGTSYRPGARFGPSGIRQGSRRLNLYGYNVPLKANPFSWAKVIDCGDIPVTSYDNAYALQQIEQGHNLLLSRAPRMITLGGDHTITLPLLRSVHREYGPITVIHFDSHLDTWSEQASINHGTYFFHAAQEGLLANDTNIHAGIRTTNDGYCGFEIVEARAIDKIGIDGIVKKIRDRVGERPVYLSIDIDTLDPAFAPATGTPETGGWTTRELRTIIRGLEGINLIGADIVEVAPAYDTNELTTMAAADTLYEVMTLMVKK.. 776
242 0.000e+00UniRef50_A0A2T9XAG4 Agmatinase n=1 Tax=Acidianus hospitalis TaxID=563177 RepID=A0A2T9XAG4_9CREN  ali  36  1MSIQYLPKSGLYVSTGLNTYARLEYTKDVS--DANIAIIGVPWDDLATSRPGARYGPLGIRNASSFILPNRYNYVLDINPFEVTKIVDYGDVEVHAGYIEDMFNEVEKEVKEMLKKNVIPVVLGGDHSISLPIIRGLSSKYKKVAVIHVDAHHDSLDYGKKYDHGTIFRRGVEEGVIIGESSVHYGVRVFSSKELGYDLLTMKIIDEEGLSKTVEQLKRKVGDQPVYLSIDIDVMDPAYAPGTGYPDPGGLTSREILEFVRKLYGLNIIGMDVVEVSPPYDVAEITSTLAASIVFEGLSIISKN.. 314
243 0.000e+00UniRef50_A0A1V6QBE5 Uncharacterized protein n=2 Tax=Penicillium TaxID=5073 RepID=A0A1V6QBE5_9EURO  ali  36  491......GTQADSVFSGISTFGRLPYFPCLEAEKYDIAFLGAPFDTGTSYRPGARFGPSGIRQGSRRLNLYGYNVPLQANPFDDMRIMDCGDVPVTSYDNAWAIQQIEEGHNSILMRKPFVITMGGDHTITLPLLRSINKAYGPVTVIHFDSHLDSWKPVAAINHGTYFYHAAMEGLLKNDTNIHAGIRGPSDYECGFEIVEAREIDTIGTDGIIKKIRDRVGTDPVYLSIDIDTLDPAFAPATGTPETGGWSTRELRTIIRGLDGLNFIGADIVEVAPAYDTNELSTMAAADVLYEVLTIMVKK.. 828
244 0.000e+00UniRef50_A0A268K8G3 Agmatinase n=7 Tax=Bacillus TaxID=55087 RepID=A0A268K8G3_9BACI  ali  35  2..QYPLTPDVKPEFCTTGTFMRLP----SNRENAKLAIVGLPFDTAASFRVGARFAPQAIRQASMTLFPYHPIHK--VYPFDACNAIDIGDVSVIPHNIHRSYEVMEKAVMELMEQGIIPIGLGGDHSVTLANLRAAAKIHGPVALIHFDSHTDTWDTYEKYWHGSPFIRAYEENLLIPDKVFQVGIRGTSSSDLGYHVITTPELKDRGFENVVKEMKEKIGDTPCFLSFDIDFVDPSCAPGTGTLEVGGLNSFETLQIIRSLTDFNFIGFDLVEVLPPYDPTQITSLLAATIIHDFASLVALK.. 307
245 0.000e+00UniRef50_A0A2T7NAZ9 Uncharacterized protein n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7NAZ9_POMCA  ali  34  31..NYPLSANEMPRSGGIASMMRLPVQATTQGLDA--CFVGVPLDSGTSNRSGARLGPRHIRQESSLLRQANPMLGT--IPFDSIQVADVGDVCMNIYDLPTAVKQIKAAFDKLIVNGCVPLTMGGDHTISYPILQAIKDKYGPVGLVHVDAHADVNDTGAKIAHGTPFRRAFEYGSLDGRRVIQIGLRGTWSTEQGFRVVPASDCWNKSLKPLMTEVRSMMGSGPVYLSFDIDSLDPCFAPGTGTPEIAGLTIYQALEIIHGCQGLNIVGADLVEVSPPYDVGSMTSLTAANLLFEMLCVVQLSK. 339
246 0.000e+00UniRef50_A0A2E2X200 Agmatinase n=4 Tax=Rhizobiales TaxID=356 RepID=A0A2E2X200_9RHIZ  ali  42  15....LTGAATDPTHAGALSFMRRKYTKSLD--GVDVAVWGIPFDAAVSNRPGARFGPQAIRRASAIFD-NDPQXPFERDLFENMAVIDYGDCLLDYGNHQETPGRIQSEAAKILGAGAFLLTLGGDHYVTWPLLKAHVDKHGPLALVQFDAHQDTWDDGERIDHGSFVGRAAKQGLIDTSKSIQVGIRTHAPEXCGIRMIYGHEVEDMSAQEIADAIIEHTGGXPVYLTFDIDCLDPAFAPGTGTPVAGGPSSAKALSILRKLGALDIRGADVVEVAPAYDHADVTAIAGATIAMYMLGLLAEKR. 313
247 0.000e+00UniRef50_A0A1Z5HDB5 Guanidinopropionase n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1Z5HDB5_9GAMM  ali  35  9.FYIPIDGTKTPKFAGIATFMKLPYLALEDAEYVDIGLIGVPWDGGTTYRSGARLAPRQVRDASTFMR--NMHNTLKIKPYELCNCADLGDANINAVNLLESLQWVEDFYHQVLSKDIVPLSVGGDHLVSLPILRALAKN-QPVGMVHFDAHTDMFSGFSGNSHGTPFYHAINEGLLDPKRIVQIGIRGLWGLEKGVRIIDMEECTDLGTEGILIEIKKVIGDDETYLSFDIDCLDPAFASGTGTPEIGGFTSIEAQHLIRGLHGSNLIGADLVEISPPYDQSSNTALVGATLLFEILCLLADRK. 320
248 0.000e+00UniRef50_Q32C02 Agmatinase n=1171 Tax=root TaxID=1 RepID=SPEB_SHIDS  ali  70  1MS-TLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNHSVQIGIRTEFDKDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEI..................... 284
249 0.000e+00UniRef50_A0A2A4ZGQ4 Agmatinase n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2A4ZGQ4_9RHOB  ali  40  4.YNQPISGNDLARFSGPGTFMRLPQATSLDGL--DVAVLGIPIDIGTSWRSGTRFGPKQIRAESAMIRPYNMATGA--APFDXLQVADIGDLAINTFSLPDSXRIIXXSYDAILXXXVXPVAMGGDHSITLPILRXXAXXXGPVAXVHIDAHADVNDFGEXETHGTVFRRAXEEGLIXXDKTYQVGLRGTEAAGWGFQQFPASELWHRSLNNLGAEIRRDIGDRPVYVTYDIDSLDPAYAPGTGTPEIGGLTTPQALELIRALRGVNIVGCDLVEVSPPYDTTGNTALTGANLLYELLCVL..... 309
250 0.000e+00UniRef50_A0A0M9VQ94 Agmatinase n=1 Tax=Malassezia pachydermatis TaxID=77020 RepID=A0A0M9VQ94_9BASI  ali  40  28.........PDFYFSGVSTFAHLPHEKCLVQEDFDVAVLGVPLDTAVSYRPGARFGPRAIRAGSARFRSFNPALGVNPYV-SKTKFLDCGDIPVTPFDNELAFQQIEDAYDDLLKQHPRMAVMGGDHSIALPILRSLNKVYGPVSVLHFDSHLDTWAPNSGYTHGTMLYHASQEGLVSNTSM-HVGLRGLRDASLGFTYLETWEVDQLGLDGTVAAIRERLGDSPVYLSIDIDVLDPSIAPGTGTPVSGGLTSRELRSIIRMLSGINLVGCEVVEVSPPYDTNGVTALAAAELLYELMSVMA.... 375
251 0.000e+00UniRef50_A0A099KGZ3 Agmatinase n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A099KGZ3_COLPS  ali  46  13...ELLGTEIEPTFSGILSFLR--RNYSKDLTHAEVAVTGIPYDLALSNRSGARLGPRAIRAASSNLAWGTVAH-WGIDPFETLPVVDYGDCGIDTSMPEQVPQDIEEHISHILDQDCATLCLGGDHFITYPILKAYAKKFGEISLIHFDAHYDTWDTKGKIDHGTMFYHAAKQGIVSPERSVQIGMRTAIDDTIGFNVINNHAVHSQQPEEISAQIKKIVGDNPCYLTFDIDCLDPVYAPGTGTPVVGGLTTYQAQRILRGLEGINLIGMDLVEVSPAYDHAEITSLAGASLALDLLCLYA.... 310
252 0.000e+00UniRef50_A0A1X6ZLI4 Agmatinase n=1 Tax=Roseovarius albus TaxID=1247867 RepID=A0A1X6ZLI4_9RHOB  ali  45  12..NHKFGMGYEPTYSGANSLFR--RQYSRDLQGVDIVAWGVPYDLSVTNRPSCRFGPRGIRAASTNVTWDGGPWFWDFDPFEKLHMVDYGDCMFDPGFPMEIPEVIYQEAMSILQSDAFLLTMGGDHSVTYSVLKAQAERHGPISLIQIDAHSDTWEEPKRFDHGSMFYHAAQEGILAPETSVQAGLRTYNSSTHGFTTLTAEFVHEQGVAATVAKIKEVVGDLPAYLTFDIDALDPAFAPGTGTPVCGGLSSWQAISLIRKLAGVNLIGADMVEVSPPFDHAEITSLAGATLLLEMVCLIASQK. 313
253 0.000e+00UniRef50_Q9I6K2 Guanidinopropionase n=69 Tax=Proteobacteria TaxID=1224 RepID=GPUA_PSEAE  ali  35  1MSNQPLDAAEIPRFAGIPTFMRLPAFTDPAALQ--VGLIGVPWDGGTTNRAGARHGPREVRNLSSLMRKVHHVSR--IAPYDLVRVGDLGDAPVNPIDLLDSLRRIEGFYRQVHAAGTLPLSVGGDHLVTLPIFRALGR-ERPLGMVHFDAHSDTNDRYFGYTHGTPFRRAIEEGLLDPLRTVQIGIRGAFARECGIRVIHMEEFVELGVEATLAEARRVVGAGPTYVSFDVDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLDLVGADVVEVSPPFDVGGATALVGATMMFELLCLLAES.. 313
254 0.000e+00UniRef50_D3F8N5 Agmatinase n=6 Tax=Bacteria TaxID=2 RepID=D3F8N5_CONWI  ali  36  9..YGPPDASLAPRYTGIRTFARCPHATDWA--NADVAVLGVPFDTATSYRPGARFGPAAIRDQSQLIRPWHAAL--EVDVFATLSVLDGGDLTVTPGNAARTAEQIHAGLRPVLEAGATPLVLGGDHSIVLGELRAQAERHGPVGVVLLDAHADTWDEYERYFHGTPFRRALEEGLIDPRRSLLAGMRGPTPREWGFEIVTCDELRTLTPAEYGRRVRERIGDGPTFLSFDIDVLDPAFAPGTGTPEIAGLLPHEAVAFLRALAGIRFTGFDVVEVSPQFDPGQVTALHAASIGFELLALCA.... 315
255 0.000e+00UniRef50_V5FMH2 Uncharacterized protein n=1 Tax=Byssochlamys spectabilis (strain No. 5 / NBRC 109023) TaxID=1356009 RepID=V5FMH2_BYSSN  ali  36  34..YKIEDLSVDLPFSQPVTFAHLEWQRCLAHSHSDIAILGFPYDTSTSYRPGARFGPRGIRAASSREKGRSYNSPWGVDPFEQLSIIDCGDIPITPFDAEHAFKQMEQGYRQILYHGPRVLSLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGYTHGTFFWHASREGCISKGTSVHGGLRTEIDQDVGFTLIEAQEIDEIGMEGIINKVRATVGDTPTYLSIDIDVLDPSIAPATGTPESGGWTTRELKRFIKGLEGVHLVGADVVEVSPPYDVAETTSIAAADLLVDILALMVKDK. 370
256 0.000e+00UniRef50_A0A2H3JBH6 Arginase/deacetylase n=3 Tax=Agaricomycetes TaxID=155619 RepID=A0A2H3JBH6_WOLCO  ali  40  48.WLNKYGKQADQVFSGPLAFSHLPYSLCLEDTTADIALLGMPFDTGVTYRPGARFGPYAIRSGSRQRETRGYTLAWKVNPYEGSKIIDCGDVPVSPFDNALAVDQMEVAYSSLLARHPRIITLGGDHTIVLPILRALHKVYGPVSVIHFDAHLDTWTEQSRVTHGTFFYLAQEEGLMTNT-SIHAGIRCENDKAVGFQLISTDDIDDLGVAEIIKRIRARIGDSPVYLSLDIDVIDPGLAPATGTPEAGGWTTREVKRIIRGLAGLNFVGADIVEVAPAYDNAEITAIAAADIVHDFLSMF..... 388
257 0.000e+00UniRef50_A0A2B7WII0 Agmatinase n=3 Tax=Pezizomycotina TaxID=147538 RepID=A0A2B7WII0_9EURO  ali  38  43......GKQADSVFSGISTFGRLPYFPCLDQESFDIAFLGAPFDTGTSYRPGARFGPSGIRQGSRRLNLYGYNVPLAANPFSDIKVLDCGDIPVTSYDNTWAIQQVEEGHNSLLMRKPRIITLGGDHTITLPLLRSINKAYGPVTVIHFDSHLDTWKPVAAINHGTYFYHAAQEGLLRNDTNIHAGIRGLSDYECGFEIVEAREIDTIGTAGIIKKIRDRVGTNPVYISIDIDTLDPAFAPATGTPETGGWSTRELRTILRGLDGINFIGADIVEVAPAYDTNELSTMAAADVLYEILTMMVKK.. 380
258 0.000e+00UniRef50_A0A0J0XTK7 Arginase/deacetylase n=10 Tax=Agaricomycotina TaxID=5302 RepID=A0A0J0XTK7_9TREE  ali  38  23.WQEKYGGTPDLAFSGVAGFGRLPWERCLEKPGYDIAVLGMPFDTSVSYRPGARFGPHAIRSGSRRHGPFLIPWGTSVTQDTGLQVVDCNDVPISPYDNALAIDEMQVAYATLLNRHPRILTLGGDHTIVLPILGALTDVYGPISVLHFDAHLDTWTERHKVTHGTFFWKAYELGYINDKTSAHAGIRTLHDEAVGFQVFTTDDIEEMGPEGLAKKLKKRLGSGPVYLSFDIDTIDPSMAPGTGTPESGGWTTREVKRIVRSLVGLNIVGADIVEVSPAYDTNELTAMAAADLAQEFLALMAAK.. 366
259 0.000e+00UniRef50_A0A093YKB5 Uncharacterized protein n=2 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A093YKB5_9PEZI  ali  38 1197.............FSGISTFAHLPHQKCLPDELYDIAIIGSPFDTAVSYRPGARFGPRAIRAASRQTANRGFNPRAGFNPYSWATIKDCGDIPINPFDNELALRQMTEAFAELASQNPRLITLGGDHSLALPALRALNQIYGPVAVLHFDAHLDTWHEQSHFNHGSMYWIASNEGLVANGSSVHAGLRTRDDTRQGFFRISADDIDDIGPAGVAKLILEKIGTEPVYLSVDIDVVDPGLAPGTGTPEPGGWTSRELIRILRNVEGLNVVGADIVEVAPAYDRGEQTALVAAQVAYEILTSMVKR.. 1521
260 0.000e+00UniRef50_U4LG95 Similar to Putative agmatinase 2 acc. no. O42887 n=2 Tax=Pezizomycotina TaxID=147538 RepID=U4LG95_PYROM  ali  36  45....PNWWNDIVPYGGINTFAHLPHVFCLSQETFDIALIGAPFDTATSYRPGARFGPRALRAGSRQIPAASYNALTGVNPYSWAKITDCGDIPLTSFSSELALAQMTSAFEEIMTHKPLLVTLGGDHSIILGALRAVNKIHGQVAVLHFDAHLDTWDPGTPFTHGTMLNLAGREGLISNNSNVHAGLRTRDDTEQGWLRIGSEDIDDLGAKGVVEKIVQRLKGKKVYLSFDIDTLDPAVAPGTGTPEVGGWTMREVKRILRGIEDVELVGMDIVEVAPAYDNGEITALAGAQVVFEVLSGYVKK.. 370
261 0.000e+00UniRef50_A0A1G7QVI1 Agmatinase n=1 Tax=Desulfovibrio legallii TaxID=571438 RepID=A0A1G7QVI1_9DELT  ali  38  6...QPPSAASSPRFCNTGNFMRLPRMADPTGM--DFAVFGIPFDTGSSYRTGSRFGPAAIRNISSMIKPNHVIF--EVNILNELRGGDFGDVNIVPGYIEPSYAAITEFMTPLLAAGVTPLALGGDHSITLAELRAIAARHGKVSLLHFDSHLDLNTFGQPYNHGTPFRRALEEGLIDPATSIQVGMRGSLAAELGFKVLPAHVMREMGLAEVIKAILERLGRTKVFCTFDVDFVDPAYAPGTGTPEVGGFTTWEVLRLVRALNEVHFVGFDIVEVLPAIDPAELTPYVAANLGFEFLSILAWRK. 313
262 0.000e+00UniRef50_A0A021X7H5 Guanidinobutyrase n=673 Tax=root TaxID=1 RepID=A0A021X7H5_9RHIZ  ali  36  5.FHQPVDAAKVPRFAGHSTFMRLPAVETAVGL--DIALVGIPWDGGTTNRAGARHGPREVRSASSLMR--STHHASKTQPFTIANIADVGDLPINPIDLMDALKLIEGGMRTVIEAGALPLAVGGDHLTTLPVLRAVAAS-GPVGLIHFDAHSDTNDTYFGYTHGTPFRRAIEESLIDPRRTVQIGIRGDWAVKQGIRIIYMEEFVERGVAAVMAEARQIVGDAPTYVTFDIDSIDPSMAPGTGTPELGGFSTREAQHLVRLLEGVNIVGADVVEVAPPFDLAGMTSLAGATIMFELLCVMAR... 312
263 0.000e+00UniRef50_A0A212K565 Guanidinobutyrase n=44 Tax=Bacteria TaxID=2 RepID=A0A212K565_9DELT  ali  38  1MS--PVNSLQSPRFCGIRTFMRQP-AATGETPQADVSIIGVPFDSGVSYRPGTRFGPAAIREASTLLKPYSPELDVDVN--ESFTIADHGDIDTIPGYMEDSFAAITSSLKPFFASKTLPVILGGDHSISLANLRAVHAAHGPVALLHFDAHSDTIPSYYGYNHGTPFYWALKEGLILPQHSTQIGIRGPWPRQQGLRIIMGHEAHAMGLEAVIREALARIGDAPVFLSFDIDFLDAAYAPGTGTPEVEGFTTYEAMSLVRGICKRRAVGMDLVEVLPDKDVAGITALAGASVI............ 300
264 0.000e+00UniRef50_A0A1A8LME6 Agmatinase n=8 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1A8LME6_9GAMM  ali  53  1MNPSPL---MPSLFGDISTFMGVPKATDPQATDAEVVVSGVPFDLACSGRSGTRMGPNAIRQSTANLIWEGKRWPWDFALPERLNVCDAGNVDYAYGEPESLVDNLETHAMRWLKAGKKMLTLGGDHYITLPLLRAHAREHGPLALIHLDAHTDTYEHGTRFDHGTIFHHALKEGLLVPEHSLQIGIRSYDRHNHPFEVLEADWVNEHGAAAVLERIRARVGHHPVYVSLDIDGLDPAYAPGTGTPVCGGMSTDFMLKVIRGMVGMDLIGMDVVEVNPAYDHGEITSLAAATLGLEFLYVLAASK. 304
265 0.000e+00UniRef50_A0A225B0U1 Putative agmatinase 2 n=10 Tax=Pezizomycotina TaxID=147538 RepID=A0A225B0U1_9EURO  ali  36  55.............FSGVSTFAHMKPVKCLPDARYDIAIIGAPFDTAVSYRPGARFGPRAIRAASRQLPGTSFNARAGINPYSWATLLDCGDIPITPFDNALASRQMYEAFLELGNQRPKLVTLGGDHSVALPALRALYQIYKPITVLHFDAHLDTWNEQSRFNHGSFFHIASSEGLISNTTSAHAGIRGVDDSEQGFMRIHADDIDDIGTRGVIDAIIERIGEQPVYLSVDIDVLDPATAPGTGTPEPGGWTTREMIRILRGIEKLNVVGADIVEVSPSYDVGETTALAAAQVAFEIITSMVK... 384
266 0.000e+00UniRef50_A0A2V6T5F6 Agmatinase n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6T5F6_9BACT  ali  35  1MPPEPIDSMIYPRYSGIATFMRLPHLQDTREL--DVAFVGVPFDTAAGYRVGARLAPRAIRNASSQVRIHHPIY--DLTVHKAIRIADYGDVRTTPFEIERTFAWITEEFDAIYGNGCRTIAVGGDHGITYPILRAVARRHGPLAIVHIDAHTDTHDTQHKLTHATTFRRAHEDGLLQPGKVVQMGIRGSWSKEH-YRMMPAHELHRRDMDGVVAEVREIVGAAPVYFTFDIDGMDPSCAPGTGVPEIGGLTNWQVMQIIRGLVGLNLVGADLVEVSPPCDTNDITSITAAHMLFEIASVFAANK. 311
267 0.000e+00UniRef50_A0A1S7HLM1 (ZYRO0G05610g) n=17 Tax=saccharomyceta TaxID=716545 RepID=A0A1S7HLM1_9SACH  ali  38  27.......WSEDWPFSGLQTFAKLPFHRCLEPTEFDIAIIGVPFDTAVTFRPGARFGPQAIRRASRQNELRGFNARAGINPYDWATVVDCGDVPVTPMDNQLALKQMNEAYKELLAAPPRFMTLGGDHSVILPVLRALHAHYGPIAVVHLDSHLDTWSPTSEFTHGSMLWLAAREGLLAKGHCVHAGIRTREDDRVGFHRIHADEMMDLTPRGVARKIKSFIKGMPVYLSVDIDVLDPSAAPGTGTVEPGGWLTRELIAVLRNLEDLPLVGADVVEVSPPFDHADVTAMAAAQVAYEIVTSMVK... 358
268 0.000e+00UniRef50_A0A124BXJ8 Similar to An14g05950 n=1 Tax=Aspergillus niger TaxID=5061 RepID=A0A124BXJ8_ASPNG  ali  36  43......GTQADSVFSGISTFGRLPYFPCLEAERYDIAFIGAPFDTGTSYRPGARFGPSGIRQGSRRLNLYGYNVPLQANPFSDMRILDCGDIPVTSYDNAWAIQQIEEGHNSVLMRKPFIITLGGDHTITLPLLRSINRAYGPVTVIHFDSHLDSWKPVAAINHGTYFYHAAMEGLLKNDTNIHAGIRGPSDYECGFEIVEAREIDTIGTDGIIKKIRERVGTEPVYLSIDIDTLDPAYAPATGTPETGGWSTRELRTIIRGLDGLNFIGADIVEVAPAYDTNELSTMAAADVLYEVLTIMVKK.. 380
269 0.000e+00UniRef50_A0A1C5VFB2 Guanidinobutyrase n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1C5VFB2_9FIRM  ali  39  8......NSLKSPRFAGVKTFMRMENIQTTD--DVDFVVVGIPFDTCATFRVGTRFGPAAIREMSAVVAPYNPILEVGI--FDYCSGVDYGDVGSVPGYVEESFEVITEGMLPIFEKGVIPIAMGGDHSVTLPELRACAKVNGPVALIHFDAHFDTIDQYFGYTHGTPFYHAAKEGLVDTSKSIQVGIRTKNSSDLGYDYIYAADCHKMTCEEIIKRIKDRVGDAKAFLTFDIDFLDPSCAPGTGTPIPGGFTTAQALEIIRGLKDLNIIGYDVVEVSQPYDPNGITAIAAAGLMQEFMSHIAWKK. 313
270 0.000e+00UniRef50_A0A094GW84 Uncharacterized protein n=2 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094GW84_9PEZI  ali  38  395.............FSGISTFAHLPHLKCLPEELYDIAVIGSPFDTAVSYRPGARFGPRAIRAASRQTANRGFNPRAGFNPYSWATIKDCGDIPINPFDNELALRQMTEAFVELAHRKPRLITLGGDHSLALPALRALNQLYGPVAVLHFDAHLDTWHEQSQFNHGSMYWIASNEGLIANGSSVHAGLRTDDDDRQGFFRISADDIDDIGPAGVAKLIVEKIGTEPVYLSVDIDVVDPGLAPGTGTPEPGGWTSRELIRILRNVDGLNVVGADIVEVAPAYDRGEQTALVAAQIVYEILTSMVKR.. 719
271 0.000e+00UniRef50_A0A094IAD1 Uncharacterized protein n=4 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094IAD1_9PEZI  ali  38  607.............FSGISTFAHLPHLKCLPEELYDIAVIGSPFDTAVSYRPGARFGPRAIRAASRQTANRGFNPRAGFNPYSWATIKDCGDIPINPFDNELALRQMTEAFVELAHRKPRLITLGGDHSLALPALRALNQLYGPVAVLHFDAHLDTWHEQSQFNHGSMYWIASNEGLIANGSSVHAGLRTRLSGDQGFFRISADDIDDIGPAGVAKLIVEKIGTEPVYLSVDIDVVDPGLAPGTGTPEPGGWTSRELIRILRNVDGLNVVGADIVEVAPAYDRGEQTALVAAQIVYEILTSMVKR.. 931
272 0.000e+00UniRef50_D5DRS1 Agmatinase n=130 Tax=cellular organisms TaxID=131567 RepID=D5DRS1_BACMQ  ali  38  1MPYQPKNSFESPRFCGPRTFMRLPYVEQVNSEM-DFIVTGIPFDSGQSFRTGARFGPEAIRDFSILLRPYNPEQK--INIFDYISGVDYGDLSVVPGYILETYKKIEEGLTPVVNEGIIPISLGGDHSMTLGELRAIAKKHGPVALLQFDAHSDTWDSYQKYNHGTVFRRAIEEGLIDVSRSIQIGMRGGDAKNLGLALYATNEYKKLGVERMLDIIHERVGEGPVFLSFDIDFLDPVYAPGTGTPEVSGASIDDALQFVRGLTNIDFVGFDLVEVLPAYDHGQITAAAAANIVYEFITLIALRK. 313
273 0.000e+00UniRef50_A0A0P9CCP6 Uncharacterized protein n=2 Tax=Bacillales TaxID=1385 RepID=A0A0P9CCP6_9BACL  ali  37  1....MSDVRTYPRFEGIHTFMRFNYEPSPQP--VDVVLLGAPFDTAASYRVGARFGPEAIRRVSSLLRPANMYHR--IRPDDSLRIVDGGDAMVIPGNIERSYASITERVSSWLAEGATPIMLGGDHSIALAELRALAGKYGPVAMIQFDAHGDTSDEYEKDTQATPFRSAVEEGLLNPAKSTQIGMRGTVYRQLGFDVVTMEQVRERGLKPVMQAAQLRAGNTPVFVSFDIDCLDPAYAPGTGTPEIGGFTTFEAQHMIHQLVGLNCVGFDVVEVLPSQDVSEITALAAATVAFEFLTLIAVNN. 307
274 0.000e+00UniRef50_Q4WHD9 Agmatinase, putative n=118 Tax=Pezizomycotina TaxID=147538 RepID=Q4WHD9_ASPFU  ali  37  44............TFSGIASFAHLKPVKCLPDERYDIAVIGAPFDTAVSYRPGARFGPRAIRAASRQMAGTSYNTRAGINPYSWATVKDCGDIPITPFDNGLAERQMYEAFLELGSRKAKLVTLGGDHSIALPALRALYQIYKPITVLHFDAHLDTWNEQSHFNHGSFFHKASREGLICNSTSAHAGLRTPNTPEQGFMRIHADDIDELGPMGIVDKIIERIGRDPVYLSVDIDVLDPSTAPGTGTPEPGGWTTREFIRILRGIEKLNIVGADIVEVSPSYDNGETTALAAAQVAFEIITSIVK... 383
275 0.000e+00UniRef50_D7CX25 Agmatinase n=6 Tax=Bacteria TaxID=2 RepID=D7CX25_TRURR  ali  37  1MPRYPPDAMVYPRFEGIRTFMRLPHVTDLAGAGIDAAIVGAPFDTGGTYRVGARFGPAGIRHESMLLRPYHPELRVDV--TEQLSLVDYGDLPVTPGYLSESHAQLERGAAELVAAGVTPFFLGGDHSVSLPLLRAVAQRHGPVGLVHIDAHSDLWEGYGKDTHGTPFRRALEEGLLEPARSIQIGLRGYSAEDHGFEMVTAPELHRVGVQEVARRVRARAGTGPLYLSFDIDALDPTFAPGTGTPEVGGLSSVQALALLRALAGLPFVAYDLVEVMPPYDVAGTTCLLAANLVYEMLALEACRR. 314
276 0.000e+00UniRef50_Q6CIB4 Guanidinobutyrase n=10 Tax=Saccharomycetales TaxID=4892 RepID=GBU1_KLULA  ali  39  33.......WGEDWPFSGIQTFAHLPHHKCLIDKKFDIGVIGVPFDTAVSFRGGARFGPQAIRKASQRQTSRGFNFRADINPYDWASVVDCGDVPVTPMDNCLALKMMTAAYENLLSHEPRFVTLGGDHSIILPALRALRKTYGRLAVIHFDSHLDTWSDTSEFTHGSMLWIAHNEGLLTENNNIHAGLRTDDDDKVGFHRIEADEIMDGGIKSIVEKIKSKIPSDPVYISVDIDVLDPSAAPGTGTMEVGGWMTRELIRIIRELEDLNLVGADIVEVSPPFDPTEITSLAGAQIAYELITNMVKK.. 363
277 0.000e+00UniRef50_A0A1G6MW86 Agmatinase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1G6MW86_9BACL  ali  36  1MSSYRPDYTKAPRYTGIRTFMKL--GLDLKMDGSDVAVIGLPFDTGASFRAGARFGPAAIREMSVLLRPAHSFHK--INPFEHVRCVDYGDLPLLPGYMEDSFDIIRDTYRRLAREKVIPVGLGGDHSVTLAELRGLADVYGPLSLVHFDAHGDTWDEYWGYTHGTPFRRALEEEIIDPHHSVQIGLRGTEAAELGFEVIAADELHTLHPTDLRRRIENRVGDRNAFLTFDIDFFDPAYAPGTGTPEVGGFTSHQGLTFVRHLPLLNYVGFDLVEVLPAHDHSQNTALLGAAVVYEFLALIALN.. 310
278 0.000e+00UniRef50_Q8KZT5 Guanidinobutyrase n=458 Tax=Bacteria TaxID=2 RepID=GBH_ARTS8  ali  38  13...GPIDSSRIPRYAGAATYARLPRLDQVS--KADVTVVGVPFDSGVSYRPGARFGANHVREASRLLRPYNPA--WDVSPFENIQVADAGDMAVNPFNINEAIETIQQNALDLTANGSKLVTLGGDHTIALPLLRAAAERAGPIAMLHFDAHLDTWDTYFGYTHGTPFRRAVEEGILDTEAISHVGTRGPDDHRFGFGIVTSADVYYQGVLETVAKIRDRIGNRPLYISVDIDVLDPAHAPGTGTPEAGGITSRELLEIIRGFRGMNLVGADVVEVAPAYDHAEITGVAGSHVAYELVTLMADN.. 320
279 0.000e+00UniRef50_A0A225AKU7 Putative agmatinase 2 n=3 Tax=Dikarya TaxID=451864 RepID=A0A225AKU7_9EURO  ali  36  31......DLDKDLPFSQPVTFAHLEWQRCLAEEPLDIAILGFPYDTSTSYRPGARFGPRGIRAGSSREKGRSYNTVWGVDPYEQLQIIDCGDVPITPFDAAHAFKQMEQAYRQILWKHPRILSLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGYTHGTFFWHASREGCISKGTSVHGGLRTIDRDVVGFTLIEAHEIDEIGVHGIVEKVRKAVGDTPTYLSIDIDVLDPSIAPATGTPESGGWTTRELKAFLKGLEGINLVGADVVEVSPPYDVAETTSVAAADLLVDILAGMTKS.. 362
280 0.000e+00UniRef50_A0A0J6NP84 Agmatinase n=43 Tax=Proteobacteria TaxID=1224 RepID=A0A0J6NP84_9NEIS  ali  49  14..QGLYGSSIENTYAGVLSFMR--RNYSRDLTGADVVVSGIPLDLSTTFRSGARLGPQAIRAASVQLAELSP-FPWGFNPFDELAVVDYGDCWFDAHNPLTIKPSIIEHARTILASGAKMLTFGGDHFITYPLLIAHAEKYGPLALLHFDAHCDTWPDDEPLNHGTMFYKAVKEGLVDPRKSVQVGIRTWNDDFMGMNVLDAPWVHDNGVDVAIARIKEVIGDSPVYLTFDIDCLDPAFAPGTGTPVPGGLSSAQALKIVRNLGDLNIVGMDVVEVAPAYDNSELTAIAAAHLACDMLCLMRNKK. 316
281 0.000e+00UniRef50_A0A1G8M7E4 Agmatinase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1G8M7E4_9BACI  ali  34  2..YKPKDSSKSPRYTGVRTFMRLEQIQTT--EGVDFVVAGNPFDTAVSNRIGARGGPQHIRNFSVLLRPYNP--DQGINIFDYCSGVDYGDFEIVPQNIHRSYDIVGEQLAPIIEKEITPIILGGDHSVSLGHLRAFAKKYGPVALVHFDSHSDTWDNYEKYMHGTPFRRAVEEGLIDTSHSIQVGLRGPDPEELGFKTIPMREVRKLGKDEVLRQIHERAGNKPVFVSYDIDFVDPAFAPGTGTPEVAGPDSFEALEYVRELYGLNIKGFDLVEVLPEYDSDDITAALASTIAFEMITLVAMQK. 310
282 0.000e+00UniRef50_A0A0L0HPL8 Agmatinase n=6 Tax=Fungi TaxID=4751 RepID=A0A0L0HPL8_SPIPN  ali  37  57........TADSVFSGITTFAHLPSERCWKDKDYDIAILGLPFDTATSYRPGARFGPAGIRQGSKRLVLYGYNVPQNVNPFSWAKIIDCGDVPVTPYDNALAIEQMQYGHKELLHRTPRLVTLGGDHTIVLPILRSIASAYGPVSVVHFDSHIDTWSEQGAYNHGTYFYHASQEGLIKNGSSIHAGPSDYDNDACGFHIIEARDIDEIGTKGIAERIKKAVGDNLVYLSIDIDVLDPAFAPATGTPETGGWTTRELRTIIRSLDGVKLVGADVVEVAPAYDTNELTTMAAADVLFEVISLMVKN.. 382
283 0.000e+00UniRef50_A0A2V9RIE8 Agmatinase n=4 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9RIE8_9BACT  ali  35  15..PRPVDALVYPRFSGIPTFMRLPHVTDPSEL--DVALIGIPFDGGTTYRPGPRFGPRNVRVQSAMIRPWNPVLK--VDPFEKLRVGDFGDLSINPLSIEDTYRRITEQLGEVLRADARTICVGGDHSILLPILRAIHRHFGPVAFIQFDAHGDTWYFGSPHSHGTPVKYAVEEGLLEPGCALQVGLRGEFARKHGIAMITSEEFHEGGI-ELMKRHLRKHRNKNVYVTLDIDVVDPAFAPGTGTPQVGGFSSAQILSAVRALHGLHIVGCDLVEVSPPYDNGEITSLLAANLIYELLCLF..... 318
284 0.000e+00UniRef50_A0A0B7JEV9 Agmatinase n=82 Tax=root TaxID=1 RepID=A0A0B7JEV9_PHOPO  ali  65  3...TLANYPDYSLYANAFGFLRQPLNFSPLESDADVIITGVPFDMATTGRSGSRMGPGAIRQISTNLAWEGKRWPWSFNLLKSIKIADCGDLVFDCGDAGQMCERLEAHATGLLEQGKTLLTFGGDHFVTLPLLRAHAKQFGKMALIHFDAHTDTYDQGSKFDHGTMFYHAPKEGLIDPTHSVQIGIRTEHSDKLGFNVISADTANDWSVAQIVEKIKATVGDMPVYLTFDIDCLDPAYAPGTGTPVCGGITSDKALKIIRGLQGINLVGMDVVEVAPAYDHAD...................... 283
285 0.000e+00UniRef50_A1CGK0 Arginase family protein n=64 Tax=Dikarya TaxID=451864 RepID=A1CGK0_ASPCL  ali  34  27..HPIEDLDKDLPFSQPVTFAHLEWQRCLASSHLDIAILGFPYDTSTSYRPGARFGPRGIRAGSSREKGRSYNTVWGVDPFEELSIVDCGDIPITPFDAAHAFKQMEQGYRQVLWKHPRIISLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGYTHGTFFWHAAREGCINKGASVHGGLRTFSPKDYGFHRIEAHEIDIIGVEGIIKRTVDVVGDNPVYLSIDIDVLDPSIAPATGTPESGGWTTRELKRYIKGLENLNLVGADVVEVSPPYDTAETTSVAAADLIIDILAAMAKNK. 363
286 0.000e+00UniRef50_A0A1B8EI92 Uncharacterized protein n=168 Tax=Fungi TaxID=4751 RepID=A0A1B8EI92_9PEZI  ali  39  53.............FSGISTFAHLPHQKCLVHPEYDIAIIGSPFDTAVSYRPGARFGPRAIRAASRQTANRGFNPRAGFNPYSWATILDCGDIPINPFDNELAYRQMTEAFSELASQKPRLITLGGDHSLALPALRALNELYGPVAVLHFDAHLDTWHEQSHFNHGSMYWIASNEGLIANGSSVHAGLRTRDDDRQGFFRISADDIDDIGPAGVAKLIVEKIGTDPVYLSVDIDVVDPGLAPGTGTPEPGGWTSRELIRILRNVEALNVVGADIVEVAPAYDRGEQTALVAAQVVYEILTSMVKR.. 377
287 0.000e+00UniRef50_M2SP37 Uncharacterized protein n=6 Tax=leotiomyceta TaxID=716546 RepID=M2SP37_COCSN  ali  34  23.SHPIEDLDVDLPFSQPVTFAHLEWQRCLADKPLDIAILGFPYDTSTSYRPGARFGPRGIRAGSAREKGRSYNTVWEVDPYEELAIVDCGDVPITPFDAAHAFKQMEQGYRQVLWEHPRIISLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGYTHGTFFWHASREGCISKGTSVHGGLRTEIDKDVGFGIIEAHEIDDIGMNGIIEKTLSFVKDTPTYLSIDIDVLDPSIAPATGTPESGGWTTRELKRFIKGLEGINLVGADVVEVSPPYDTAEITSIAAADLIVDIMAAMAKSK. 359
288 0.000e+00UniRef50_A0A2E6VUY7 Agmatinase n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E6VUY7_9DELT  ali  38  5.NFSPVDGRVYPRFSGIKTFYRLPFLPDASLQAADVALLGAPFDGGTSYRPGARFGPEKIRSMSSLGRGHHPEH--DVNIFKGMKVGDAGDCPVTPQDISKTHAQIKERVAEVLKAGTFPMVVGGDHSTTIGTLDALVAHHGPLGIIHFDAHTDTYPWGCDVHHGTFMRLGKERGWFRENAVVQVGIRGPFSTEYGYRVFTVDDVKQQGVGAVVQHI-QQLDDGPFFISFDIDCLDPSCAPGTGTPVPGGLSTWEAQQILRATSHINVVGADLVEVSPPYDHHDITALTGVTVIWEILSAVAARLG 317
289 0.000e+00UniRef50_Q10088 Putative agmatinase 1 n=319 Tax=Eukaryota TaxID=2759 RepID=SPEB1_SCHPO  ali  35  40.FPGDGETQADSVFSGIATFGRLPYWKCLNDKSFDIAFLGAPFDTGTSYRPGARFGPSGIREGSRRLNLYGYNVPMETNPFNWAKIVDCGDIPLTSYDNAVAIKQIENGHFELLTRKPRVITLGGDHTIVLPILRSVSRAYGPVSIIHFDSHLDSWKPVGSINHGTYFYHASQEGLVSNDSNIHAGIRTTNDADCGFEIIEAREIDTIGIDAIIKRIRDRVGDGIAYLSIDIDVLDPAYAPATGTPESAGWTTRELRTILRGLDGIKLVGADIVEVAPAYDFAEVTTLAAADILFEVMSIMVK... 379
290 0.000e+00UniRef50_A0A1Q7L3V1 Agmatinase n=22 Tax=Bacteria TaxID=2 RepID=A0A1Q7L3V1_9BACT  ali  36  13..PEPTDALTYARFTGIPTFMRLPHITEPRELE--VALIGVSFDGGTTYRPGPRFGPRHIREQSAIIRPWNPVLK--VNPFAKHRTADFGDLSVNPLSIEDTFGRIERGIRPLLDAGVRCVCVGGDHSISLPILRAVAKKHGAVSLIQFDAHNDLWDEYSKYSHGTPFRRAFEEGLLQDGDVLQVGLRGQVYGEEDFRMVTAEEFHEKGMATVRSHLRAF-RRKPVYVTLDIDVVDPAFAPGTGTPQVGGLTSVQILELVRALRGLNIVGCDLVEVSPPYDNGEITSLLAANLLFELLCVL..... 316
291 0.000e+00UniRef50_A0A291B6D7 Agmatinase n=12 Tax=Bacteria TaxID=2 RepID=A0A291B6D7_9BACT  ali  60  7...TLANFPDYSLYANAFGFLRQPLVFQPQGFDADVVITGVPFDMATTGRSGSRMGPGAIRQASINLAWEGKCWPWDFSLTKEIKIADCGDLVFNCGDAAQMCERLEAHASSLLAEGKTLLTFGGDHFVTLPLLRAYAKQFGEIALIHFDAHTDTYDMGSQYDHGTMFYHAPNEGLIDPYSSIQIGIRTEHGYTLGYQVVDATKANDWPVNKIVDTIKNRVGNHPVYLTFDIDCLDPAYAPGTGTPVCGGLSTAKILQVIRALQCINLIGMDVVEVAPAYDHAELTSLAAATIATDLLHVWA.... 305
292 0.000e+00UniRef50_A0A1C3JG26 Guanidinobutyrase n=45 Tax=root TaxID=1 RepID=A0A1C3JG26_9VIBR  ali  38  2....PNPNQTLPRYSGIATFMRCDYVPDL--QDVDIALVGVPFDGGVTNRTGTRHGPREIRNQSSLMRI--INQATGVAPFELCRVADVGDVPDSPFELVKAHQSIELFFKQIKASGALPIAAGGDHSISLPILRALA-QDGPVALIHFDAHCDTGDNYSKFHHGSPFKIAVEENLIDPKRTIQIGIRGRFSHETGMRVLYMDECVELGVEGILQQIKQTIGDTPAYVTFDVDCLDPAFAPGTGTPEVGGFTSIEALQLIRGLQDVNVIGADVVEVSPPFDPTGNTALVGATIMFELLCIAAQSR. 308
293 0.000e+00UniRef50_A0A1Y5PFU5 Guanidinobutyrase n=57 Tax=Bacteria TaxID=2 RepID=A0A1Y5PFU5_9MYCO  ali  38  16...GPVDATEYPRYTEPSTFARLPRI--SEVPGADVRIVGVPFDSGVSYRPGARFGPSHVRAASKLLRPFNPAL--GVAPFAAQQVADCGDIAVNPFNIDEAIAAIDTAMTDLRKDGSTVLTIGGDHTIALPILRSLARDHGRVAVLHFDAHLDTWDTYSPYTHGTPFRRASEEGLIDMERSLHMGIRGPLYSKLGFQVIRSDDYEFDGVASIVERMRKRLDGGPVYVSIDIDVLDPAHAPGTGTPEAGGLTSRELLNTLRGLVGLDIVGADIVEVAPAYDHAEITGIAAAHVGFELLSVLAANR. 323
294 0.000e+00UniRef50_A0A2H5Z7S5 Guanidinobutyrase n=5 Tax=Bacteria TaxID=2 RepID=A0A2H5Z7S5_9BACT  ali  38  25...........PRFSGMRTFARFPYSRSLD--RVDVAIVGIPFDTGVTYRPGARFGPAAVREHSSRIEQYHPVLGVDV--LAELSVIDYGDLPVVAGYTERSFQLIEEGIGSLVESGVIPIGIGGDHSISLPELRAVARRYGPVALVHFDSHVDTWDWETKYNHGTPFRRAVEEGLVDPGRSIQIGIRGSLSRELGFEVWTAREVRRAGLARMCEAIHRRVGASPVFLSFDIDFLDPVFAPGTGTPEVGGFATWEAQELLWGLVGLDIVAADLVEVLPDRDPADVTALNAANLIFDMVAVIAATR. 324
295 0.000e+00UniRef50_UPI0004AF33E4 agmatinase n=4 Tax=cellular organisms TaxID=131567 RepID=UPI0004AF33E4  ali  38  1..........MPRFGGIATMMRLPHLPSAEGL--DVAFVGVPLDIGTSNRPGARFGPRAIRAESPLLRPCN--LGTGDSPFKRLRVADLGDVAVNPYNLQDSVMRIERYYEALLAHGCIPVTLGGDHTIALPILRAMARRHGPVALVHVDAHADVNDEGEKIAHGTPFRRAVEEGLLTCDKVFQIGLRGYTPDEFGFHVIPAAQCWSRPMDDVVARIRAQVGDHPLYISFDIDGLDPAYAPGTGTPEIAGLSSVQALQLIRGCAGMNIVGADVVEVSPPFDCGGMTALTAANLAFELLCAVPSR.. 300
296 0.000e+00UniRef50_Q2NRD3 Agmatinase n=372 Tax=Bacteria TaxID=2 RepID=SPEB_SODGM  ali  72  9.........DNSLVSNAFGFLRLPLEFNPYATDADWVITGIPFDMATSGRAGCRHGPAAIRQVSTNLAWEGCRWPWDFDVRKRLKVVDCGDLVYEFGDAQDFCDKLQDHAERLLAAGKRMLSFGGDHFVTLPLLCAHAKHFGKMALVHFDAHTDTYANGSKFDHGSMFYHAPNEGLISPAHSVQIGIRTEFERDNGFTVLDAGQVNDRSVDDILAQVKQIVGNLPVYLTFDIDCLDPSAAPGTGTPVIGGLTSDRALKLVRGLQPLNIVGMDIVEVAPAYDQAQITALVAATLALEMLYIQGAKRG 305
297 0.000e+00UniRef50_A0A076K4V5 Agmatinase SpeB n=32 Tax=cellular organisms TaxID=131567 RepID=A0A076K4V5_9RHOB  ali  38  33MPNQPISGNDLARFAGPQTFMRLPEAQGPAGL--DVVIMGIPMDIGTSWRSGTRFGPKQIRQESAMIRPYN--LQTGAAPFDSLQVADMGDVAINTFSLAESLRIIESAYDGLHDYPVVPATLGGDHSLTLPILRSIAKKHGPVALVHVDAHADVNDEGERETHGTVFRRAYEEGLLVPDLVYQIGLRGYTAEDWGFNMITAPEIWHKSLTPLGQEIRQAIGDHPCYLTYDIDSLDPAYAPGTGTPEIGGLTTPQAMELIRALRGLNIVGFDMVEVSPMYDTSGNTALTAANLMFEILSIL..... 339
298 0.000e+00UniRef50_A0A0D2WMM6 Uncharacterized protein n=2 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2WMM6_CAPO3  ali  38  434..NQPLGGNEMPRFAGIASMMRLPVSPLPLPASVQAAFVGVPFDLGTSNRVGTRYGPRAIRAESVLLRPYNMATRA--APFECLQVADAGDVPINTYNLAESIKIIEQFYSDILQHNCVPMTLGGDHTITLPILRAIVKKHGPVGLVHIDAHSDTNDKGEKIAHGTTFRRCVEEGLLDTKRVVQIGLRGDWGRKQGFRVVQAEECWYRSLAPLMAEVRAAMGSGKVYVSFDIDGLDPSVAPGTGTPEYGGLTAHQGLEIARGVRGLNIVGCDLVEVAPQYDTSGNTALLGANMLFEMLCSL..... 741
299 0.000e+00UniRef50_W4FKT9 Agmatinase n=2 Tax=Aphanomyces astaci TaxID=112090 RepID=W4FKT9_9STRA  ali  36  137...GPVDAQVMPRFGGAPTFARLPRLDQVTF--CDVAILGLPYDSGCTYRPGARFGPSAVRQASRILRPYHTTLK--VNAFHDQQCVDAGDVCCNPFNVTETMTTVVDHVSELLQSRPRIVAVGGDHSISYPLLKAHCEAYGPVALVHFDAHLDTWDAYFGHTHGTPFLRAAEEHLFRPDASMHVGIRGPRDATLGFSMLNMDAIEDMGVAGVVKQIRDRVGQHPIYLSIDIDVLDPAFAPGTGTPEAGGLSTRELFGMLRGLRGLNVVGADVMEVAPAYDHAEITALAAASIVFELISLMA.... 443
300 0.000e+00UniRef50_A0A151MJ81 Serine/threonine-protein kinase PINK1, mitochondrial n=1 Tax=Alligator mississippiensis TaxID=8496 RepID=A0A151MJ81_ALLMI  ali  37  540.FNIPPSAESVARPVGVCSMLKLPVQTSAEGLDA--AFVGVPLDTGTSNRPGARFGPRHIRAESVMVRRYNPSTRA--APFHSLMVADLGDVNVNLYNLQDSCRQIREAFRKIVATGCIPLVLGGDHTITYPILQAVSEKHGPVGLVHVDAHTDTGDKGEKIYHGTPFRRCVDEGLLDCKRVVQIGIRGSSSRDQGFRVVLAEDCWMKSLVPLMGEVRKQMGDKPIYISFDIDGLDPAFAPGTGTPEIAGLTPAQALEIIRGCKGLNIVGCDLVEVAPIYDASGNTALTAANLLFEMLCAL..... 845
301 0.000e+00UniRef50_A0A2H5YY37 Guanidinobutyrase n=7 Tax=Bacteria TaxID=2 RepID=A0A2H5YY37_9BACT  ali  40  14...........PRFSGLRTFARFPHTT--ELEGVDIAVVGLPFDTGVTYRPGARFGPAAIREQSSRIECYHPVL--DIDVTDVVSVIDFGDAPVVPMETETSYASITATLQPLAARGIVPIGLGGDHSVSLPELRAVATRYGPVALVHFDAHVDTWDWGNRYNHGTPFRRAVEEGLIDPERSIQIGIRGPLSRELGFEVWTARQVRQASVSQVLGAIWRRVGTHPVFLSFDIDFLDPVFAPGTGTPEIGGFTTWEAQEFLWGLVGLRIVGADLVEVLPDRDPSGVTALIAANLVFDIIAVIAASR. 313
302 0.000e+00UniRef50_A0A257WCW3 Agmatinase n=2 Tax=Bacteria TaxID=2 RepID=A0A257WCW3_9BACT  ali  41  4............PFSGIATFARAPYATSPT--GADVAILGIPYDSSTSNRSGTRFGPRAIREQSLLL--WGYNNAQQVAPFKELKLVDLGDADVIPVDILATHRAIESAAKRVIDQPATLITLGGDHSISLPLLRAHHAKYGPLAVVHFDAHPDTWDPGHKYSHGTPFVRALEEGLIDRDAYVQIGIRGLDALNLGARMITVDEFRMRDVADILAELQGRIGSRSTYVSLDIDCVDPAFAPGTGTPEVGGLTSYEILQLVRGLKSLNCVGFDLVEVSPPYDHAGITAILAANLAFEFLSLVALQ.. 302
303 0.000e+00UniRef50_C7D719 Agmatinase n=57 Tax=root TaxID=1 RepID=C7D719_9RHOB  ali  37  1MPNQPISGNDLARFAGPQTFMRLPEAETPEGL--DVGFIGIPMDIGTSWRSGTRMGPKQVREQSAMIRPYNIQTGA--APFDALQCADLGDVAINTFSLSDSLRIITETYDKHLKHNFIPMTLGGDHSLTLPILRSIAKKHGPVALVHVDAHADVNDEGERETHGTVFRRAYEENLITPSKVYQIGLRGTEAEGWGFNTVLAKDLWHKSLTPLAKTIKDAIGDQPCYITYDIDSLDPAYAPGTGTPEIGGLTTPQAMELIRGINGLNIVGCDLVEVSPPYDPSGNTALTGANLMFELLSIL..... 307
304 0.000e+00UniRef50_Q1I7X5 Agmatinase n=507 Tax=root TaxID=1 RepID=Q1I7X5_PSEE4  ali  52  14..DSLYGTSAESTYAGITSFSR--RRYSRDLRGVDVVVSGVPFDTATSNRPGARFGPRAIRTASVQQAWA-RHWPWAFDPFDHLAVIDYGDCAFDNGTPESVPDSIQAHAERILDAGCAMLTLGGDHFISYPLLKAHARRHGPLALIHFDAHSDTWPDEEGIDHGTMFWHAAREGLVDPAHSVQIGLRTTNDDSQGFAILDARQVHRQGTEAIVAAIRQRVGERPVYLTFDIDCLDPAYAPGTGTPVCGGLSTLQALEILGGLRGINLVGMDLVEVAPAYDHADITALAGATLAMEMLCLYAAR.. 314
305 0.000e+00UniRef50_E1BLC0 Agmatinase n=53 Tax=root TaxID=1 RepID=E1BLC0_BOVIN  ali  38  51..NQPPSPEFVARSVGICSMMRLPVQATPEGLDA--AFVGVPLDIGTSNRPGARFGPRRIREESVLLRTTNPSTGA--VPFQFLRVADLGDVNVNLYNLQDSCRLIRADYQKIVAAGCVPLTLGGDHTITYPILQAIAEKHGPVGLVHVDAHMDMADKGEKLYHGTPFRRCVDEGLLDCKRVVQIGIRGSSSRSQGFRVVLAEDCWLKSLVPLMGEVRQQMGGRPIYISFDIDGLDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDPSGNTALVAANLLFEMLCVL..... 355
306 0.000e+00UniRef50_A0A1V5FZ74 Agmatinase n=15 Tax=Proteobacteria TaxID=1224 RepID=A0A1V5FZ74_9PROT  ali  42  26...SPYGTLAEPTYSGVTSFLRRPYRKDLR--DADVAVFGAPFDLATTNRPGARLGPRAIRSASASLA-WCPPYRWGFDPLERLQVVDFGDLYFDPGRPAEIPERLYQQVRDILAHSVTPLALGGDHFVSFPILRALSEQHGAIALIHFDAHSDTWDDDGRVDHGTMFFHAARLGYVDPAVSVQLGMRTFNEETHGFLVWDADRLHRDGIDAALQAIHARVGQRACYVSFDIDFLDPAFAPGTGTPVCGGFSTHEALRLIRGLAGLNLIGMDVVEVAPAYDHAEITALAAASVAHELLAVLASRR. 325
307 0.000e+00UniRef50_UPI0009FBD015 agmatinase n=1 Tax=Paracoccus sp. S4493 TaxID=579490 RepID=UPI0009FBD015  ali  35  8.NNKPIDVDSLPRFSAPATFMRLPHTETAKGL--DIGIFGVPFDGGTTNRPGARHGPREIRTASSMQRTYN--LATGVEPYEICNFGDIGDVPINPLDQHHSLIEIQSFCEEIIRENCLPIAVGGDHLVSLPLLRALGD--PSLGLIHLDAHSDTGDYDTKYSHGTPFRRAIEERLLDPQKIVQVGIRGSSSEEQGITIIGMDQFHQLGVEGVSAMIREVVGNAPVYLTFDIDCFDPAFAPGTGTPEAGGLTSYEGLNLLRRMRGLNFQGADLVEVCPPLDSSGITSILGATVLFEICCLLAESR. 316
308 0.000e+00UniRef50_Q90XD2 Agmatinase, mitochondrial n=34 Tax=Euteleostomi TaxID=117571 RepID=SPEB_CHICK  ali  39  29.FNVPPSAEFVARPVGVCSMLRLPVQTSAEGLDA--AFVGVPLDTGTSNRPGARFGPQQIRAESVMVRRYNASTGA--APFDSLLVADVGDVNVNLYNLPDSCRRIRESYQKIVASGCVPLTLGGDHSITYPILQAVAEKHGPVGLVHVDAHTDTSDMGEKIYHGTPFRRCVDEGLLDCSRVVQIGIRGSSYADQGFRVVPAEECWMKSLVPLMGEVRQQMGDGPVYISFDIDGLDPAYAPGTGTPEIAGLTPMQALEIIRGCKGLNIVGCDLVEVAPIYDVSGNTALLGANLLFEMLCVL..... 334
309 0.000e+00UniRef50_A0A2P2BYP6 Guanidinobutyrase n=6 Tax=root TaxID=1 RepID=A0A2P2BYP6_9ZZZZ  ali  38  8...GPPDAMTVPRFAGPDTFARLPRLTDVP--RADVAVLGVPFDSGVSFRPGARFGPGAVRAGSKLLRPYHPHL--DVEPWSVLQVADAGDAAVNPFDLDEAIRQIEAAAEATYEHADRLIAIGGDHTIALPLLRAAHRRHGPIAIVHFDAHLDTWDTYFGYTHGTPFRRASEEGLLVLDHASHVGTRGPDDRKLGFATVSSEDLARRGVDEAIDRIRERVGNHPVYLSIDIDVLDPAHAPGTGTPEPGGLTTRELQMILRGLTDLEIVGADVVEVAPAYDHAELTTIAAANVVYEYLALFALQ.. 314
310 0.000e+00UniRef50_A0A1E8Q752 Agmatinase n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1E8Q752_9MYCO  ali  37  9.....VDGQEVPRYAGLTTFARLPRREDVP--RCDVAVVGIPFDTGVTYRPGARFGPSHIRQASRLLRPYNPELR--VSPFAHQQVVDAGDMVANPFDIGVAVDQIDAQATELIDAGAKLVTMGGDHTIAYPLLRAHRRRYGPVALLHFDAHLDTWDTYTPVTHGTPFRRAAEEGLFVPGHSAHVGIRGDDDAGMGFTVVHCAEFERTSTDAVIERLRAQVGDRPLYVSVDIDVLDPAHAPATGTPEAGGMTSRELLAILRGLDGTNLVGADVVEVSPAYDHAEITGVAAANLVYEFVSLLAR... 312
311 0.000e+00UniRef50_Q9I3S3 Guanidinobutyrase n=1979 Tax=root TaxID=1 RepID=GBUA_PSEAE  ali  38  6..HQPLGGNEMPRFGGIATMMRLPHVQSPAELDADAAFVGVPLDIGTSLRSGTRFGPREIRAESVMIRPYNMATGA--APFDSLNVADIGDVAINTFNLLEAVRIIEQEYDRILGHGILPLTLGGDHTITLPILRAIKKKHGKVGLVHVDAHADVNDHGEKIAHGTTFRRAVEEDLLDCDRVVQIGLRANWSRKQGFRVVQAEECWHKSLEPLMAEVREKVGGGPVYLSFDIDGIDPAWAPGTGTPEIGGLTTIQAMEIIRGCQGLDLIGCDLVEVSPPYDTTGNTSLLGANLLYEMLCVL..... 313
312 0.000e+00UniRef50_A0A1V2MY25 Guanidinobutyrase n=1352 Tax=root TaxID=1 RepID=A0A1V2MY25_9ACTN  ali  37  7.PRGPVDSSRVPRYAGPATFARLP--RLDEVGRTDVAVVGVPFDSGVSYRPGARFGGNAIREASRLLRPYNPA--QDASPFALAQVADAGDIAANPFNINEAVETVEAAADDLLNTGARLMTLGGDHTIALPLLRSVAKKHGPVALLHFDAHLDTWDTYFGYTHGTPFRRAVEEGILDTSALSHVGTRGPDDEKMGFGIVTSADVMRRGVDEIADQLRQRIGDRPLYISIDIDVLDPAHAPGTGTPEAGGLTSRELLEILRGLSSCHLVSADLVEVAPAYDHAEITSVAASHTAYELTTIMSRQ.. 315
313 0.000e+00UniRef50_L7ZQT6 Guanidinobutyrase n=104 Tax=Bacteria TaxID=2 RepID=L7ZQT6_9BACI  ali  36  7....PVDSQTSPRFCGVKTFMRLPHVKTED--NIDFAVIGVPFDTGGTFAVGTRFGPEAVRSMSSLLRPYNPGLQ--IDIFQYCSGVDYGDLSVNPGYIEDSYEMIANQLEPLLNKNVVPILIGGDHSVSLPHLRAMAKRYGKVSLIQFDSHGDTWDSYFGYTHGTMFRRAVEEQLVDPFSSVQIGMRGSDAEDLGYKVITTDQLRALTPNQLGEEIRKRVGKNPVFVSFDVDFLDPAYAPGTGTPEIGGFTTYEAQQFVRQLKGLNLVGFDIVEVLPDRDPTRVTSLAAANIGFEFISLVAWNK. 313
314 0.000e+00UniRef50_Q7N122 Agmatinase n=533 Tax=root TaxID=1 RepID=SPEB_PHOLL  ali  70  5...TLGNQQDDSLVSNAFGFLRFPLNFQPYSSDAEWVITGVPFDMATSGRAGSRHGPAAIRQVSTNLAWESRRWPWDFKLHNCLKVVDCGDVVFNFGDAQDMSDKLQAHAEKVLASGKRMLSFGGDHFITLPLLRAHAKHFGKMALVHFDAHADTYPNGSQFDHGTMFYHAPNEGLIDPHHSVQIGIRTEHGRDNGFTVLDADQVNDRSVDDLLAQIKETVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTTDRALKLLRGLQPLNIVGMDVVEVAPAYDQSEITALAGATIALEMLYLQASKK. 306
315 0.000e+00UniRef50_A0A2H5V381 Guanidinobutyrase n=1 Tax=archaeon HR02 TaxID=2035438 RepID=A0A2H5V381_9ARCH  ali  36  11..FYPADSLKSPRFTGPYTFARLPHTRDL--EGVDALFIGIPFDGGVIFRSGARFGPASVRQASLLLRLYNPYLR--VRPFDALNVADYGDIDTVPGNIEATYQSISRELGPIHARGITPLVCGGDHSITLPLLREASKVYGRLSLIHVDAHLDMVEQHQKYTHGTVFRRAYEEGLIDPYKSVHVGVRGSLYSELGFRVIAMMSVEEMGIEAVCSEIKRIAGGGPVYLSFDIDACDPSCAPGTGTPEVGGLTSREALKLLHGLAGLGFVGFDLVEVAPPYDHGEITAYLAANIIYNFLCLKATKKG 321
316 0.000e+00UniRef50_A0A0D6GSR1 Agmatinase n=182 Tax=cellular organisms TaxID=131567 RepID=A0A0D6GSR1_MYCSM  ali  39  17.....VNATEVPRYAGIATFARLPQRF--EVLDHDIAVVGVPFDSGVTYRPGARFGPSAIREASRLLKPYHPAL--DVSPFAQAQVVDAGDLGVNPFNIDEAVGQIRDGVTELLDRDQRVVLLGGDHTIALPALQAMHAIHGPVALVHFDAHLDTWDTYFGCTHGTPFRRASELGLIVKGHSAHVGIRGLDDESLGFTVVHCRDIDRIGVDGVISRIHERVGEYPVYVSIDIDVLDPAFAPGTGTPEIGGMTSRELVAVLRAMRGLNIVGADIVEVAPAYDSGDVTAVAAANLAYELITLMA.... 320
317 0.000e+00UniRef50_A0A0K3AXM8 Agmatinase n=18 Tax=Actinobacteria TaxID=201174 RepID=A0A0K3AXM8_9PSEU  ali  38  3...GPVDSSKVPRYAGPATFARLPRLDQVD--KADIAVVGVPFDTGVSYRPGARFAPAAVREASRLLRPYNP--GLDVSPFERAQVVDAGDIVCNPFDIGKAITEISEQATELLDTGAKLVTVGGDHTIALPLLRSVAAKHGPVALLHFDAHLDTWDTYEPYTHGTPFRRAVEEGILDTSALSHVGTRGPEDARLGFGIVTSADVLRRGVDEVIEALRARIGDRPLYVSIDIDVLDPAHAPGTGTPEAGGMTSRELLEILRGLAGLNLVSADVVEVAPAYDHADITSIAASHVAYDLVTLLSM... 308
318 0.000e+00UniRef50_D2AUK3 Guanidinobutyrase n=14 Tax=Actinobacteria TaxID=201174 RepID=D2AUK3_STRRD  ali  38  4.TRGPVDSSRIPRFAGPATFARLP--RLDEVGRCDVAVVGVPFDSGVSYRPGARFGPSAVREASRLLRPYHP--GLDVSPFAALQVADAGDIACNPFDIGEAVETIEHAAGELQDTGARLVTIGGDHTIALPLLRSLARRHGPVALLHFDAHLDTWDTYFGYTHGTPFRRAVEEGILDTEALSHVGTRGPDDRRLGFGVVTSADVMRRGVDEVVDALRQRIGGRPLYLSIDIDVLDPAHAPGTGTPEAGGLTSRELLEILRGLAGANLVGADVVEVAPAYDHAEITSVAASHVAYDLVSLLALS.. 312
319 0.000e+00UniRef50_S0AEU1 Guanidinobutyrase Gbh n=530 Tax=root TaxID=1 RepID=S0AEU1_SERPL  ali  40  1MLNQPQSGNEMPRFAGIPTMMRLPVADDAQGLAA--AFVGIPLDIGTSNRSGTRYGPRQIRQESVMLRPYNM--GTGAAPFERLQVADLGDIAINPYSLEDSVRRIELAYNGILSHGCVPLTLGGDHTLTLPILRAVARHHGPVGLIHVDAHSDTNEEGEKLAHGTTFRRAYEEGLLEPQRVVQIGLRGDWSRRQGFRVVPAEACWYRSLAPLMAEVRQQMGGAPVYLSFDIDGLDPAFAPGTGTPEVGGLSVWQGLEIVRGCRGLNLIGADVVEVSPAYDRSGNTALLAANLLFEMLCVL..... 307
320 0.000e+00UniRef50_A0A1M4E2P9 Agmatinase n=27 Tax=Bacteria TaxID=2 RepID=A0A1M4E2P9_9ACTN  ali  38  1MNLGPVDSSKVPRFAGPATFARLPRLDQV--ERADVAVVGVPFDTGVSYRPGARFGPAAVREASRLLRPYHP--GLDVSPFERAQVADAGDIAVNPFDIGAAIETIEGAADDL---DARLVTIGGDHTIALPLLRSAARKHGPVALVHFDAHLDTWDTYFGYTHGTPFRRAVEEGLLDTEALSHVGIRGSEDRRLGFGIVTAADVLRRGLDEVIDLLRQRVGERPLYLSIDIDVLDPAHAPGTGTPEAGGLTSRELLEILRGLAGLNLIGADVVEVAPAYDHAEITSIAASHVAYDLVSLLALQ.. 307
321 0.000e+00UniRef50_A0A069RBJ7 Guanidinobutyrase Gbh n=12 Tax=Bacteria TaxID=2 RepID=A0A069RBJ7_PEPLI  ali  40  1MSNQPASALSSPRFCNTGTFMRMPRMTELEGL--DFAVVGVPFDTASSYRTGSRFGPSAIRNISSLIKPNNVNLQ--VNVLESLKGADCGDVNVVPGWIHETFENIENELKPILDADVIPIILGGDHSISLANLRAIAKKHGPVAMVHFDSHADINDFGMPHNHGTPFRRAHEEGLIDPDHVIQIGMRGVAEEELGFRLIAAHKVREMGIEGLIKEIKDRVGDKKVFLTFDIDFVDPAYCPGTGTPEVGGFTTLETLTILRELKDLNFVGCDIVEVAPQYDPSEMTAFMAANVAFEFISMLAAKK. 314
322 0.000e+00UniRef50_A0A0D0HQ65 Agmatinase n=4 Tax=Anoxybacillus TaxID=150247 RepID=A0A0D0HQ65_9BACI  ali  36  3.EFKPMDAGISPRYAQISTFMRLPHSRDI--KNYDVAIIGVPYDGGTSYRPGTRFGPREIRSHSSLIRGYSYYSKSDL--FSRLRIADYGDIDASPYNIELTYKLIEDTIESILNENVFPVVIGGDHSISLGILRAVAKKYGPVGLVQFDAHSDTYDGVYGYHHGTPFKRAIEEGLIDPSRSLQIGIRGDYALQSGMKILMMDDINKKGISDVIKNI-EGLGKEPVYVSLDIDAVDPAFAPGTGTPVPGGFDSREIIQLVRSLKPLNVVGFDLVEVSPPYDNNGITSLLASNLIYEFLNTVSLEK. 311
323 0.000e+00UniRef50_A0A267MM19 Agmatinase n=8 Tax=Firmicutes TaxID=1239 RepID=A0A267MM19_9CLOT  ali  40  7..NQPASALSSPRFCNRGNFMRLPAATNLEEL--DFAVVGVPFDTASSFRTGSRFGPGAIRNISALIKPNNVHL--EVNVLDSLKGADYGDLNIVPGYIEKSFENIEEGLQPLLDANVIPIILGGDHSISLPHLRAIAKKHGPVALVHFDSHADINDFGEKHNHGTPFRRAFEEKLIDPDHVIQVGMRGIAEEELGFRLIAAHKIREMGIDNLIEEIKDRVGDKKVFLTFDIDFVDPAYAPGTGTPEVGGFTSHETLTIVRALKDLNFVGCDIVEVAPQYDPTEMTAFMAANVAFEFISMLATKK. 316
324 2.000e-98UniRef50_A0A0G1CW45 Arginase family protein n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1CW45_9BACT  ali  26  10................PFNFLGL---RDQDYDKSKVAVFPVPYSSTTYWKSGTKEGPQAIIEASRHVELYDIETKKDA---SKQGIFTLELLEPSKNSPEETTARIKSVMDKILRDGKFPMMLGGEHSITLGAVQAVREQFSDFSVLQIDAHSDLRDEFEGFHHACVMKRIKDLGV----SVTQVGVRSSEGEELGDNVFLAPNL-------PIDKIISTLK-EKVYLTFDLDGLDPSIMPSTGTPEPGGLGWYETLKLIKEVAKRKIIGADVVELDPIPGFSAPD-FLAAKLVYKIINYI..... 278
325 2.000e-98UniRef50_F8C5F1 Agmatinase n=7 Tax=Thermodesulfobacteriaceae TaxID=188711 RepID=F8C5F1_THEGP  ali  26  4..................TFLGLP-----DHPQARVALIPAPLEITTSWQKGTKEAPTEILKVSPNLEFFDEET--EIEPQEVLGFFTYP-VPELPFDINTALEEISKKVRETLIKKRFPIVIGGEHTVTLGSIKALKGFYENLKILHLDAHLDLRDEYLGISHATVIRRIYEMGI----PILSVGVRTLCKEEYEFIKLWMKDLRE-NWEKSLRIIEEFIKEGDIYLSLDMDVFDPSFAPGVGTPEPGGINWYEFLQILKLVVRYNLVGMDIVEVKPNLG-NAITEYLAAKIIFKISSYLAKK.. 283
326 2.000e-98UniRef50_A0A147JX64 Uncharacterized protein n=3 Tax=unclassified Hadesarchaea TaxID=1775753 RepID=A0A147JX64_9EURY  ali  32  11.................PGFGG----FDEPYKRAQVVFMGVPLDITSSYRTGMRFAPARIREASMNLETYLMS--AELDVFEQLGIADIGDLVLVSTDLNATGERIERAVRKLRDEGKVPALLGGEHTLTYFS----SRVFENAFLVQLDAHRDLREEYDRLCHATVMRRVLDS--LPSDRLLQVGIRSCSKEEAEFARSAGLQAYERGLEDVTSEVRKKVGNKRVYLSIDLDVLDPAFAPGVATPEPGGLSTLDVVKLVRELGKLNICGFDVVELAAPHD-DGKTAFAAAKIIYELLAAISGS.. 291
327 3.000e-98UniRef50_A0A285UJ65 Agmatinase n=2 Tax=Salinicoccus kekensis TaxID=714307 RepID=A0A285UJ65_9STAP  ali  35  2......SSRDMLAYAGHATFWGLP--PSREAEGRDITVMGVPFELGLTRRPGARFGPRSIREASVH--DMSMHYPWPYDVKEDNDLIDYGDVGYDLGETRLMLEESYKHARKIFSGGSKLLTIGGDHTVAYSTIRAAKEKYGKLSLLHIDSHQESLPGGSGISRNSFAHDLAEEGAIDPGASVQAYVRTSMPKDFEYNIIHAKEAMAQGPEALAEKVKSVIGDNPVYLSFDIDALDPAFAPGTATPVPGGPSTTEMRLFLEHLAGLNIVAADLVEVTPSYDSGEMTAVAAASIGKDLLHLLAENN. 299
328 3.000e-98UniRef50_B5YF20 Agmatinase, putative n=3 Tax=Dictyoglomus TaxID=13 RepID=B5YF20_DICT6  ali  26  1..........MQQYRPLPSFGGLPFT---NPEKAKVLIISYPLEVTTTYKKGTKEGPQAILSASYNLELYDEELD---DIPAEIGIYTYPDLLLSLGNVEKVLEEIEELTFNIIDYDHFPIFIGGEHTITKGILRAYNKKYKHFSVLHLDAHSDLRNEYEGNNHACALREASE-----TLDIVQVGIRSMSEEEKNIKVYFDYKFQERFNTTLIEDILKSLKDE-VYITLDFDVFNPAEMPAVGTPEPGGLSWYQVLSLLREVKNKKVIGIDLVEFSPIPGLIYPD-YMAARLIYKIIGYY..... 288
329 3.000e-98UniRef50_D3QZK8 Agmatinase n=394 Tax=Bacteria TaxID=2 RepID=D3QZK8_MAGIU  ali  32  6.................STFIGC----DADFATADIVLFGAPFDSTTSFRPGARFAAQAMRPDSYGLETYSPRLDLDLTDFS---IMDSGDLELVMGCSDVALNQISEHVDEILAASKIPAMIGGEHLVTLGALRSVVKKYPALHIIHFDAHTDLRENYLGNSHACVIRRAWE--LVGDGRIWQFGIRSGLKEEFTWAKSHTHKFDFSGLAEVCTE----LKGQPVYFTLDLDVLDPAYFPGTGTPEPCGVTVLQLLDAIRELRDLDIVGFDVNELSPHYDASGVSTAVACKILRELLLQVAAHR. 284
330 4.000e-98UniRef50_A0A2M7T598 Agmatinase n=1 Tax=Actinobacteria bacterium CG_4_10_14_0_8_um_filter_50_43 TaxID=1973889 RepID=A0A2M7T598_9ACTN  ali  26  17................PFNFLGIDEHN--SFEESKVVVVPIPYDSTSSYRAGTREAPVAVINASRQVEFYDEELETEI--YDKVGIHTLNEIMPNMEGPRHQIEVVRRVLLDMMEAGKFPVTIGGEHSITLGAVQAVKDFFPQVSVLQLDAHTDLRKEYEDYSHACVMRRIFDEGV----RIAQVGIRNSSKEETRFIKVSARQ-YRYGYYGI-EEIVDALSDD-VYITIDMDVFDPSEVPAVGTPEPGGLSWYEVLDILREVFHKRVVGFDVVELCPIPG-NPASDFLTAKLIYKLIGYCFR... 300
331 4.000e-98UniRef50_A0A101EB65 Agmatinase n=3 Tax=Clostridia TaxID=186801 RepID=A0A101EB65_9THEO  ali  31  1....MLDAGSGVRFLRQGSFLG----SREDYAGARVCLLGLPLDVSTSFRPGCRFGPAVIRAVSEVLEEFSPAVWRSL---GEVPFCDLGDLELIPGDIEENLHRIEGAAEAILGDGKFFLALGGEHLVSYPLIRAVRRRYPDLAVIQLDAHADLREEYKRYSHATVMRLVAGE--IGPDNLYQFGVRSCTWEELAYGSRETNFFLDK-ILEPLTRLVPHLTGRPLYLSVDIDVIDPAFAPGTGTPEPGGCRPQEIFEAIYSLKGSRVVAMDLVEVCPPHDCGDITSVLAAKIVREA......... 285
332 5.000e-98UniRef50_UPI0004249251 agmatinase n=2 Tax=Alicyclobacillus TaxID=29330 RepID=UPI0004249251  ali  36  6.................STFL----YSNPDYRAASVVLFGVPMDYTVCFRPGARFGPAHIRQASYGLEPYSLQFG---DTLLHRSYHDAGDLVLPFGNAKDSLLRTETYVSGLVKDGKTPFALGGEHLISLPIIRVLHEHHPDLHVIHLDAHADLADVYFGESHATVMRRVLD--FLPHNQFAQFGIRSADWSELEFAAARPLRQCTMDVAEPLAQWLAEVPQTPLYVTVDIDVLDPAFAPGTGTPEAGGISPRELFAALGLLRGRNVVGADLVEVAPQLDASGCTAVLGAKIVREMLLTLFE... 285
333 7.000e-98UniRef50_A0A239TBV3 Agmatinase n=6 Tax=Bacteria TaxID=2 RepID=A0A239TBV3_9FIRM  ali  33  5...............NIETFLGC----DKEFEEAKIVLFGAPFDSTTSYRPGTRFASRTMRAESYGLETYSPYLDLDL---EDAAVFDGGDLELPFGSVENALEDIEEFTQKIIDCDKLPLMIGGEHLVTLGAVRAVAAKYPDLHIVHFDAHADLRDDYAKLSHATVLHRVWN--IVGDNKIFQFGIRSGDKSEWGKDHVKTQRFNFNNLKETVM----ALKGKPVYFTVDLDVLDAAVFPGTGTPEAGGVSFDELRCAMKLVAECNIVGTDMVELSPPYDQSGISTATALKLLREYLLAL..... 282
334 7.000e-98UniRef50_A6NUU0 Agmatinase n=16 Tax=Bacteria TaxID=2 RepID=A6NUU0_9FIRM  ali  33  13...........................DCPFEQAETVLFGAPFDSTTSNRPGTRFGPSALRRESYGLELYSPYQDKDL---SDCAVLDSGDLELSMGSSELALADIEARAEEILSAGKRPFLIGGEHLVTLGAFRAVHRKYPDVAIIHFDAHTDLREDYLGLSHACVIRRCWE--LTGDGKIFQFGIRSGDREEWRWGRVTCHPFDLEGLEDVVE----RLGDAPVYFTVDLDVMDPSVFPGTGTPEPGGVSFDALRRAATLVCSRNVVGCDVNELCPPFDQSGVSNAVAAKVVREMLLALS.... 283
335 7.000e-98UniRef50_W1QKN7 Uncharacterized protein n=2 Tax=Ogataea TaxID=461281 RepID=W1QKN7_OGAPD  ali  33  90.......PGKSDRYNGISTYGHLPHCFDPEDLELDIVVLGAPFDTGISYKPGSRFGPDAIRQGTRKFAPYSPYREGLNVWNNWAKIVDCGNVPMTPLDNRVALDQLYRSERAILNHGKYPLALGGDHTISYSGIRAAHEKFGKVSVLHFDAHLDTVTEYAALNHGTYLYWAHRKGW-TADNNIHAGLRGWYEDESKFAKIMARDVDKIGVQGIIDKIKERLGNSPVYISFDIDVLDPPSAPGTGSLEPGGWSSRELLEIIDGLAGLYVVGADVTEVSPWGDTNDVTSIMAGEVARSILGLMV.... 423
336 9.000e-98UniRef50_A0A1H1KHQ1 Agmatinase n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A1H1KHQ1_9RHIZ  ali  32  2.........PKSSFVQTASFMGLP--RSTERSGAKAAIVGLPFDCGTPYRIGARLGPAAIREQSLLLRPYDVHT--DLDPLTALGVVDMGDAPVRPGEVEASFAIIEAAIGEVAESGAVPVSLGGDGAIALPEMRALHRLHPDLVTVHIDAHTDA-YPIEGYNTATAFARAVEEGLVEARNSFQIGMRGAHGRKLGYNIITMDELLRRGIAEVFAAMRQAVGDRPVYLSYDMDFFDPSVAPGVCTPTWGGASAREGLAALEACGGLNLVGVNVNTVSPPHDVGGMSALLAATVALGSLNLIARN.. 300
337 1.000e-97UniRef50_G4KX50 Putative agmatinase n=194 Tax=Bacteria TaxID=2 RepID=G4KX50_OSCVS  ali  33  5...............NVQTFL----ACDAEYGAADVVLFGVPFDGTTSFRPGTRFGPSAIRGESFGIETYSPYCDRDL---TDCRIFDGGDLELPFGNTQRVLELIRDSAADLLADGKRFVMLGGEHLITLGAVRAVAERFPDVHVIQFDAHTDLRKEYEPLSHSTVMRQVWN--LLGDGRLHQFGIRSGERTEFEFAREHTC-LHKFNLADFTETA-AQLQGMPVYFSLDLDVLDSSAFCGTGTPEAGGVTFKELMEAVLRLHGLNIVGCDINELSPHYDHSGSSTAAACKITREILLQIAR... 283
338 1.000e-97UniRef50_A0A1E3A8K3 Agmatinase n=11 Tax=Bacteria TaxID=2 RepID=A0A1E3A8K3_9FIRM  ali  40  10............HYGGIPSFNAYPVTR--ELKNVDIAVMGVPFDSGVTNRPGARLGPRAIRNMSQLACCFS--YPWDYKISEKANIIDYGDVGVGPKTTEVMLEETHDHAKKILDAGCKLLTLGGDHTIPYGMVRAASEKYGRLALLHFDSHQDSTPSTDGNSHANFAYDLQAEGCIDPNHSAQVFIRTEM-TECGYHIFYAQEAVFMDMETLAEKIKAVIGDMPVYLTFDIDALDPSAAPGTGTPVIGGPSAAQVRKLLYLLKGIHVVAADLVEVLPAYDQSEIT.................... 281
339 1.000e-97UniRef50_A0A2M7UXG6 Agmatinase n=3 Tax=Bacteria TaxID=2 RepID=A0A2M7UXG6_9BACT  ali  26  12................PYNFGGLEKQ---NYKSSKVVIVPVPYESTTYYLSGTKEGPWAIIDASRHMELYDIEKDTNA---SKVGIFTLEELEPSKNSPKETVLRVENVVAKILEDGKFPFTLGGEHSVTLGAVSAFKKKFHNLSVLQMDAHTDLRNEFEGFHHGCVMRRIVDDLKLS---VTQVGIRSTTEEEMIYIKESKKNSIFYGKQYEIEKVISTLK-ENVYLTFDLDALDPSIMPSVGTPEPGGLGWYESLDLLKAVAQRNIVGADVVELSPIPGLIAPD-FLAAKLVYKIISYAIK... 291
340 1.000e-97UniRef50_A0A1Y0N5M4 Guanidinobutyrase n=4 Tax=root TaxID=1 RepID=A0A1Y0N5M4_9BURK  ali  40  26...................................YALAGIPFDGAVTNRPGARFGPQEIRRASLMLCD-GLHPVFEVSPLAHLG--DAGDMALPNASPLKVVREAIETQAALLMDKHHCVFLGGDHSVTLPLLRALKRRHGQVALIHFDAHCDTWEDGEPSGHGTWTFEAIQEGLVVPEKTVQIGLRSSYVKDQGGLIFTARDLRGQGLAGVISQIRERLGDTPCYLTLDIDCLDPAFAPGTGTPEPGGMTSSQVLTLLEELAPLHFVGMDCVEVAPAYDHAELTSNAAATFVWTYLSGQIAK.. 303
341 2.000e-97UniRef50_A0A1V6JGP7 N(1)-aminopropylagmatine ureohydrolase n=4 Tax=Bacteria TaxID=2 RepID=A0A1V6JGP7_9BACT  ali  27  4...................FGDLPGEYALE-KSSKIVVLPIPYDGTSTWVKGSDKGPEALLEASANMELYDIETDSEVYLH---GIHTAPAVS-ENKSPEDMVQAAEKEALKYIDSGKFLVTIGGEHSVSIGPIQAHAKRYKNLSVLQIDAHTDLRDSYQGNNHACVMARAQELC-----PIVQVGIRSMDSGEMENRVFWAHHIAR--GDEWMDKAIDLL-TDNVYLTVDLDGFDPSILPSTGTPEPGGLQWYQALSFLKKLERKNLVGFDIVELCPPYEKS--SDFLAAKLLYKILSYKFAK.. 281
342 2.000e-97UniRef50_A0A2H5W3N2 N(1)-aminopropylagmatine ureohydrolase n=9 Tax=Bacteria TaxID=2 RepID=A0A2H5W3N2_9BACT  ali  28  8.................FTFGGLPDEYTA-FETARILIWPVPFEATTTFLKGTALGPHAIIEASRHLELYDEELDAEVY---RLGIHTLPPAPVNA-SLEEVIERLYHEARRWVETGKFLCTLGGEHSITSPIVRAFAERYPDLSVLQIDAHADLRQSYDGYSHASVAARLVEIC-----PVVQVGVRALSLEEARVTTFFAKDLHD--PRAWIPQVVECLSPQ-VYLTIDVDGLDPSLIPATGTPEPGGLSWSETLRLIRQVAEHRIVGMDVTELCPMPGH-EASNFIVAKLIYKALGYVFHR.. 289
343 2.000e-97UniRef50_A0A2H6EN77 N(1)-aminopropylagmatine ureohydrolase n=17 Tax=Bacteria TaxID=2 RepID=A0A2H6EN77_9BACT  ali  23  6..............SKANNFLGIGVKHT-SFNNSKIVILSVPLEKTVSYGKGTAKGPREILKASHFVEFYDEELGKELCFSK--GICTLKPLDFENQRIETALQKIYKTVKFLINENKFVVTLGGEHSLSISPIKAYLEAYTNLSVLQIDAHSDLRDTYEKHSHACVMARVAEL----TKNIVQVGIRAQSKEEAEFNTFYARDITKKFRKDWQKKAVSKLK-KNVYITFDLDGFDPSLLPATGTPEPGGLFWNETMSLLKLVKEKNIVGFDVVELAPSK-YHPASNFVAAKLVYKILNYAFM... 295
344 2.000e-97UniRef50_J5Q483 Uncharacterized protein n=1 Tax=Trichosporon asahii var. asahii (strain ATCC 90039 / CBS 2479 / JCM 2466 / KCTC 7840 / NCYC 2677 / UA  ali  36  363............TFSGIAGFMRLPFARCLEEPGFDLAILGMPFDTTVSYRPGARFGPHAIRSGSRRAGPFLVPWGTSVTQESNLEIVDCNDVPISPYDPALAIDEMQTAYATLINRHPRILTLGGDHTVVLPILGALYDVYGPITVLHFDAHLDTW-----NGHELGGAHSEQHKVVSKAADRQSMNDLLHDEAVGFQVFTTDDIDDMGADGIAAALKKRLGKGPVYLSFDIDTIDPSMAPATGTPESGGWTTREVKRIIRALGDLNIVGADIVEVAPAYDTNELTAMAASDLAQEFMALMIARK. 686
345 2.000e-97UniRef50_A0A2G6CLY4 Agmatinase n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2G6CLY4_9PROT  ali  29  27..................TFLGLPPDECT-YDESRVVLLRAPYDGTTSYMAGARDGPAAILAASAQVEPYDRELGCEPC---EVGIHALPAVPPAAAGPKAVIDQIEALSLPVVADGKLPFVLGGEHSVTLGAARAVAEVHPRLSFLQIDAHLDLRPSYEGYSHACVAYHLLGLRG-DGGQVVQVGVRTACPEEHGLAPIWGEDVWREEDDAWIARAVEGLADHPVYVTVDVDGLDPSVIPGTGTPVPGGLGWYQTLRLLRAVGQCRVVGCDVVELAPGPG-DHRSAYAAAQLVYKMIGYFEAAR. 317
346 2.000e-97UniRef50_A0A1Q3E483 Agmatinase n=1 Tax=Lentinula edodes TaxID=5353 RepID=A0A1Q3E483_LENED  ali  32  51........TADAIFSGITTFAKLPWVQCLNDVPVDIAFLGAPFDTGTSYRPGARFGPSGIRAGSRRLNLYGYNVPLEANPFSGQRIVDCGDIPVSPYDSAYAVKQIEASHRSILQRTAFSPM--ANDSETGEALEAIA----------LDVFGGAPSDTAAVNHGTYFWHASQEGLIKNGSSIHGAIRTTLDDEVGFQRIEAREIDTLGVNGIIQKIHETVGHRPVYLSIDIDSIDPAFAPATGTPETGGWTTRELRAILRGLDGLQIVSADLVEVAPAYDTNELTTMAAADVLFEVLTVMTKN.. 348
347 2.000e-97UniRef50_A0A285EI99 Agmatinase n=2 Tax=Geodermatophilus sabuli TaxID=1564158 RepID=A0A285EI99_9ACTN  ali  35  2......................................LGAPFDWGASYRPGARFGPRAIREA-DYLPPRRPHLSTGIDPLFELPVVDAGDIPVVGGHIEPSLELIESWVHTVAAAGAIPIVLGGDHTITYPDATGVARHHGNVALIHFDAHADTAPHQWGYGHGTPMRRLIESGAVPGHRFVQIGLRGYWPEEQRMRTFFMDEINERGLDPVVDEAVDHAGAEAVFLSLDIDVVDPGMAPGTGTPEPGGILAREFLPTVRRLAELNVVGADIVEVAPHYDPMNITAALANRVVLEMTTGMVERR. 286
348 2.000e-97UniRef50_A0A2D9HFH1 Agmatinase n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2D9HFH1_9DELT  ali  34  1MPVGPRSGRTLPRXAGXNTFXRLPRR--VDVXEAGXVFLGAPFDGATTYRPGARFGPRAARLASDQ--AHGFHAELGIDPFKVLQAVDAGDVNMPPHDIVAAMXAXEXEAKAHFIENRSVFTVGGDHSISLPMLRAASAVHGPLAXLHVDAHYDTYPWGNDLHXGTPXRHAVREGLIEPSETLQLGLRGTFSQEXGMTVVTQADWDDGXGKERFEVWRRKIS-KPLYVSIDVDGLDPAYAPGTGTPVPGGLTSRELYSLLRRLRGVPVIGGDVVELAPDFDANGITALIVADLLHTFAALHVLGR. 310
349 2.000e-97UniRef50_A0A2J0LJF4 Agmatinase n=1 Tax=Candidatus Omnitrophica bacterium CG12_big_fil_rev_8_21_14_0_65_42_8 TaxID=1974751 RepID=A0A2J0LJF4_9BACT  ali  22  1....MPNKNYKARFK----FCGIEDKYS-SREKSMIAILPVSYDLTTSYKSGASGGPKAIIDASRYMETYDDETGKEIY---KLGIYTAEEIKSVNPEPEDIIKKVEKEISFMLKAGKFPVVLGGEHSISLGAVMAFKKKIKDFSVLQLDAHRDLRDNFQGNSHACIAKRIIEL-----TSLTQVGIRSMSAGEADLKTFFMKDM--IGNEDWIEDAVDSLDNDRVYVTIDMDAFDPSIMPSVGTPEPGGMGWYETLALLRRLSQKKVIGFDVVELSPVPGNVSPD-FLTAKLIYKFLNYIFSK.. 292
350 3.000e-97UniRef50_A0A1H5BLE3 Agmatinase n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1H5BLE3_STRMJ  ali  36  4.PRGPVDSSRVPRFAGPATFARLP--RLDEVSGADVAVVGVPFDGGVSYRPGARFGPAAVREASRLLRPYHP--GLDVSPFATQQVADAGDIAVNPFDIGEAIETIQDAANGLQADGTRLVTIGGDHTIALPLLRAAAQRHGPVAVLHFDAHLDTWDTYFGHTHGTPFRRAVEEGVVDTSALSHVGTRGPEDEKLGFGIVTSADVYRRGADEVADQLRQRIGDRPLYISIDIDCLDPAHAPGTGTP............................................................ 254
351 4.000e-97UniRef50_A0A1G2QQ84 Agmatinase n=2 Tax=Bacteria TaxID=2 RepID=A0A1G2QQ84_9BACT  ali  28  13..................NFGGLEEQ---DYEKAKVVVFPVPYEATTSYISGTKWGPKAMIEASRHLELFDIELKRDV---SRIGIFTLPELSCSKNSPREAVKEIKKVVTQLLKDKKFVLMLGGEHGITPGSVAAFKEKYRDLSVLQIDAHSDLRNEYEGFSHACAMRRVRDLGV----AVTAVGIRSQEESEADYIRKEKIKTIFYAPKIPVQKIISTLS-KNVYLTFDIDGLDPSIMPSTGTPEPGGLGFYEVLNLIKQVAKRRIVGADLVELSPLPGMVAPD-FLAAKLAYKIIGY...... 285
352 4.000e-97UniRef50_UPI0009EDA596 agmatinase n=1 Tax=Paenibacillus tuaregi TaxID=1816681 RepID=UPI0009EDA596  ali  32  1MSQKLKATNKLNRTVGVNTFMKLPLVEEIEELEADFAVVGIPDDSGAFFRVGQRFAPNSIREISAMLRSINMAIGTNID--EELRGFDNGDVNCVPSNTEENQHRAAEKITKLVEHGIIPVSMGGDHSISLGPIRAVGKHYGAVGLIHFDSHVDSYEGGSRYNNGTTLRRGIEEGVLDPNRIISVGIKGTLSEDLGVEVLTMQDFEEIGIEETIQRIRDRIGEGPAYLTFDIDCMDPSCAPGGAVYELGGFNSREIIRIMKGIKDLNIVGYDIAEVCPQYDTGSITSYMAAEFMHMFIAMIGIRK. 319
353 4.000e-97UniRef50_A0A0F2QBW8 Uncharacterized protein n=1 Tax=Clostridiaceae bacterium BRH_c20a TaxID=1629719 RepID=A0A0F2QBW8_9CLOT  ali  29  1MEQQKHNTS----FFGISSFAKVPIVDVDGVWEANAAVFGVPFDASAGYRPGARFGPRSIRDLSTRLCFFESSLYWDIDLLENAVLVDCGDVDVISVNSEYTFKETVKIVEKIIKKGAIPVALGGDHSISIPCIEGFKNQ-GPLDIVHLDAHLDLRDSGAKHGHSSVIRRAMEMEHV--EKVASVGIRGYWAKEQGNQIISYGEFKQAGLESVLAS-LDYMKN-NCYVTIDIDVLNVSEAPGTGTPEAEGLTYTELKKLLQGLASKKIVGFDLVEVNPLFDPTGITSLAASRLIIEFLGAIIK... 313
354 4.000e-97UniRef50_A0A1G6VR65 Agmatinase n=2 Tax=Kordiimonas TaxID=288021 RepID=A0A1G6VR65_9PROT  ali  42  8.............YSGEQSFMRVGYA--DGPQGVDIAVIGIPYDLGTTGRPGARFGPRAVRELSLAVGEFEWGFPWDHDVRDRHVVKDLGDVTGFTAYPDRLCPAVEAKAKQVLDTGASLLSIGGDHFVSLPLLRAHAEKYGPMALIHFDAHSDTW-VDEDLNHGTMFYHAIKEGIIDPARSVQVGLRTPNPETHGILILDADHCLRTPAADVAKAIRDRVGDHPAYVTFDIDFLDPAYAPATGTPVSGGPNTAYARHVLQGLAGLNIKGADQVEVAPHYGPGQITAVAGATIAADQLYLLGLAR. 298
355 5.000e-97UniRef50_A0A077ZLZ5 Arginase domain containing protein (Fragment) n=1 Tax=Trichuris trichiura TaxID=36087 RepID=A0A077ZLZ5_TRITR  ali  71  7..............................DSDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEHNRFPWNFD----------------------MRERLNAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNHSVQIGIRTEFDKDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSE...................... 238
356 6.000e-97UniRef50_A0A1Q4CPV7 Agmatinase n=5 Tax=Rhodobacterales TaxID=204455 RepID=A0A1Q4CPV7_9RHOB  ali  30  9.......GRLNLPFVGISTFGKRPYQADWSRIEADVAVMGAPFDFGTQFRAGARFGPRAVREASTLFSFYDHEDDC-TYLGSDVRIVDIGDADIVHTDTETSHANIEAGVRAILKAGALPVVIGGDHSVNIPCIRAFDDQ-GPIHILQIDAHLDFVDVRHGHGHGNPMRRAAEKDYVTG--ITALGIRNVSARAMGDDILSVRQVRKLGCDGVLARI---PKGARLYVTIDIDGFCPSIAPGTGTPSHGGFLYYEVLEILQGVADHEIVGIDLVEVAPDYDPSQSTAILAAQVLLNFLGFIFHAR. 316
357 6.000e-97UniRef50_A0A2H5XU44 N(1)-aminopropylagmatine ureohydrolase n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5XU44_9BACT  ali  29  10..................NFLGIP--PDKSTNTAAIAIQPIPLERTTSYGKGTKDGPREILRASHYVEFYDDEFDRELCF--ERGIATLEPLPLKKLPIEEALALVEARASAILQAGKFCVGLGGEHSITAPLVRAHAQKVPDLTILQFDAHADLRIEYDGYSHACVMARIAE--FLDPSRITQVGIRALSKEEAGVRTFFAHAIRR-GDAQWMDRVLEGLS-EHVYITFDVDALDPSIMPATGTPEPEGLTYSECIAIVKRLTGRRIVGFDVVELAPIKKLHHP-NLTAARLVYKLLNLAFA... 295
358 7.000e-97UniRef50_A0A2D6LJD6 Agmatinase n=7 Tax=cellular organisms TaxID=131567 RepID=A0A2D6LJD6_9ARCH  ali  27  4.........KNPHFYFPFNFGALPHEL-ADYDKSKVVIFPVPYDGTTSYKPGTRDGPHAIIDASRVVEFYDEEAKKN---FSEIGICTLDELEI-LDDAKKTIDRVYEATKKLLEDNKKFVMLGGEHSLTSGAVRAFKEKFSDLSVLHIDAHADMADGDSKWDHGCVARRVHEMCLV-----VLAGIRSLDEEQAKFITYFAHETLSSNDDSWMDDAISKLS-KNVYLTIDLDALDPSIMPSVGTPVPGGFQWFTLLKFLRKLKEKNVVGFDVMEFMPIPGMHSPD-FTAAKLVYKLIG....... 289
359 7.000e-97UniRef50_A3LPU2 Arginase n=2 Tax=Saccharomycetales TaxID=4892 RepID=A3LPU2_PICST  ali  35  24............IFGGILTYAHLPHFNCFDPQKIDIAIVGAPFDTGVSFRPGARFGPEAIRRSARRIGGAHVRTNYPIDPYDNYSIVDCGDVAMSPFDNRIALNQLYRGQRVIHRHKPKIITLGGDHTITLMALKSVSEQIGPVQIIHFDSHIDTWNPYMSLNHGTFLHYAHEQGYIVDGGNYHVGIRAPYIDECGFNIISANDVDKLGVSGIIRKLKQAVKTNPVYISVDIDVLDPATAPGTGTMEIGGLTGRELLSILDGLKGIELVGADVVEVSPPYDTNEITSLAATSVVDSLLKLMVVK.. 358
360 8.000e-97UniRef50_A0A250V3E8 Agmatinase n=27 Tax=cellular organisms TaxID=131567 RepID=A0A250V3E8_STROL  ali  27  27...NLQRYAFVPAYAGIATFFGLPLCLNPDDLRADVAVVGAPVDMSTGHR-GAAYGPRAIR-ADERILPNTPQMSTRIKPFEELTVVDYGDAAVDSFSIDNSMEPIRTLVREIAGTGAIPIVLGGDHSILWPDAAAVADVYGKIGVIHFDAHPDCSNDLFGHSHATPIRRLIEDEHIPGRNFIQIGLRSDWMREHGLRAHFMAEIDRRGFDVVLQQAIDEALDGPLFVSLDIDVLDPAFAPGTGTPEPPGLTNRELLPAIRRICETPVVGMDIVEVAPHLDPGYTTTMNARRAIFEALTGIAMRR. 349
361 1.000e-96UniRef50_A0A2G5WYS3 Agmatinase n=10 Tax=Sporosarcina TaxID=1569 RepID=A0A2G5WYS3_9BACL  ali  29  5..........NMPITGICSFAKYPICTDWEEIDADIAVLGVPYDTGVGFLSGCRFGPRRIREVSTHYAFYDPERD-EVFLGGDVKIVDAGDADVIHGDIEQAFTAIEYAVAKIREKGAIPAIMGGDHSISIPVARALKD-EGDITVIQLDAHLDWSDAPGGLGNGSPMRRMSEMDHI--KDMVQIGLRGLAAKAYGSELISARDSAKLGVEGILNKI---PKADKYYVTIDIDCFDISLATGTGSPSPGGFSFDFLNDILIGIAEKNVVCFDLVEVAPQYDPTGATTRVAAMTMLNFMGHILKNK. 309
362 1.000e-96UniRef50_A0A0T6A3G6 Agmatinase, agmatinase n=1 Tax=candidate division NC10 bacterium CSP1-5 TaxID=1640516 RepID=A0A0T6A3G6_9BACT  ali  34  9...................................IILFGAPLDLTSSYRTGTRLGPQQIRAAGEGLEDYSLALDRDV---RQVKVIDQGDLELPPDNLEAGLARIEEEAARALEKEMAFVALGGEHLITLPLVKAALTRYPDLALLQIDAHADLAEFYDGLTHATVIRRVAE--LLGPRRVVQLGIRSATAEE----VIFARQQTHLGPPADMAKVVKILSGRPVYLTIDIDVVDPAFAPGVGTPEPGGWSSLDLFQVLNRMAALEIVGMDLVEVCPPYDPAGITAILAAKALRETL........ 266
363 1.000e-96UniRef50_A0A2E4FF50 Agmatinase n=4 Tax=Bacteria TaxID=2 RepID=A0A2E4FF50_9GAMM  ali  50  1...........................................................MREASASLAWERQAVGWGFSPLETLAIVDYGDCDFDAGNPARVPEEIYECARQILATDTALLSIGGDHFVSYPLLKAHAEKYGELSLIHFDAHSDTWAEDSRIDHGTMFYHAAQQRLISPAHSAQIGLRTHNDSDHGFNIFDAPAVHDMKPADLAEEVKGIVGGRPCYLTFDIDCLDPSFAPGTGTPVVGGLSTHQAMQILQQLKGINLVGMDVVEVAPQYDVGAITSLAAATVALQQLCLFA.... 244
364 1.000e-96UniRef50_A0A256Z2Z8 Agmatinase n=1 Tax=Desulfurococcales archaeon ex4484_42 TaxID=2012520 RepID=A0A256Z2Z8_9CREN  ali  31  7....................LRNPYVFNCRREDSIFSLIGVPFDSTSSYRPGSRFAPQRVREASQNIELYSLRSGLD---MERVPIYDEGDLAVVHGDVYEVMKRLEYVVEDIVNEGKVLIALGGEHIITYGILRGFKK---PTCVLYFDAHADLRDEYLGYSHACTLRRLVE--IVGPDKVFIIGLRALCSEEVGIKYLTSLMCQGLSFMDVVNNVRKFLGCENVYVSIDIDVIDPAYAPGVANPEPEGLSPTYLLNLLSEVINESVWGFDIVEVVPPIDPSGITSVLAAKIINELASYIYIAKG 296
365 1.000e-96UniRef50_A0A2G9MN50 Agmatinase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A2G9MN50_9ARCH  ali  28  6...................FLGVDRV---SYADAQIVILPAPFDGTSTYGKGADKGPAAIIDASPHLELYDVETQTEV---WKKGIFTAKTLKFN-DDPEEVVNMVHEAVSKFLKDDKLVVVLGGEHSISTGFARALKEKYSRLSVLQFDAHGDTREEYNGYNHACVMARIRDLNV----PIVQVGIRAIDKCEVEQHVYFAHDIY--SDDKWMDDAVSKLTDE-VFITFDLDAFDPSIMPSTGTPVPGGLGWYQVMKFLEKVASKKIVGFDVVELAPQKGNNGPD-FLAAKLIYRLLSMIYKK.. 283
366 1.000e-96UniRef50_W0U9E7 Agmatinase n=16 Tax=Bacteria TaxID=2 RepID=W0U9E7_9FIRM  ali  38  10............HYAGIPSFNLYPYTQDTEC--ADITIMGVPFDSGVTNRPGARLGPRAIRNMSQL--TNCFAYPWSYKLSDKAKIVDYGDVGYYVGANKVMLEETYNTAKKVFESGSKLLTLGGDHTIPYGMVRAASEKFGKLALLHFDSHQDSTPSTDGNSHANFAYDLQAEGCIDPSHSAQVFIRTEMTK-CGYNIFYAMDAVNMNMKELARQLKAIVGDMPVYITFDIDALDPSAAPGTGTPVIGGPTSAQARRLLYELRGINVVAADLVEVLPAYDHSE...................... 279
367 2.000e-96UniRef50_A0A2C7A1K6 Agmatinase n=6 Tax=Rhodospirillales TaxID=204441 RepID=A0A2C7A1K6_9PROT  ali  41  4..........VPTFATPPGFLGV----TRTDRGAAFTVAGIPLDLGTTNRAGARSGPQAIRAASRML--VDGAHPAHWVDPAALSLADIGEFSIALGDLPGSLAAIEAQAEGLSH----LIALGGEHGITLPLLRALSRRLGPLALAHFDAHVDTWPDGQPFGHGSVFFHALREGLVDPRRMIQVGIRSPVQRAQGVTILDAQAVHEMGPAGVAARIRAVLGDAPAYLSFDIDALDPAFAPGTGTPEIGGLASWQAQAILRRLGGLDWRGMDIVEVAPAHDVSEITALAAATVAWEYLALVAMPK. 298
368 2.000e-96UniRef50_A0A0B1Q443 Arginase n=12 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0B1Q443_9RHIZ  ali  36  1....................MDLPFTTDAA--GAKVAILGCPFDCGIPFRVGSRQGPSSIRQQSGLIRRYHPEL-ADFDVPASLSAVDCGDVALTPARMEESFDAIEQAAYAIVETGAVCVGLGGDGSVSLPLLRAASRAYPGLAVIHVDSHTDAYPPNQPFDASTQFTHAALEQRVGPGSSYHLGLRGTTMRDLGYNLITLAEFLQRGQADVVDHIRAGLGDRPVYLSWDMDVFDPSCAPGVCTPVWGGLSAREGLSLIRAFTGLNIVGCDINTVSPPQDVNGMTAFLAAQMAYEMMLLVGAR.. 292
369 2.000e-96UniRef50_E3PRB2 Agmatinase n=34 Tax=Bacteria TaxID=2 RepID=E3PRB2_ACESD  ali  30  4...............NIFTFIG----FDNEFEESQIVLFGAPFDGTTSFRPGTRFAPNIMRNDSFGLETYSPYLNKDL---EDYMLFDSGDLDFPFGNPQRIIDMIKEHSKAIVNTGKIPFMIGGEHLVTLGSVQSVYEKYNDLHIIHLDAHADLREDYMGLSHATVLRRCHD--FLGDGRIHQFGIRSGTKEEFTWAKDH-VDMHPFSLDG-LKEVIDELKDKPVYITIDLDVLDPSIFPGTGTIEPGGISFLELVGAFKEFSRLNIVGMDAVELSPHYDQSGMSTAVACKVIRE-MALIAVK.. 283
370 2.000e-96UniRef50_A0A1M4M380 Agmatinase n=25 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1M4M380_9FIRM  ali  29  14...........................DKTYDEANIVVFGAPYDGTTSYRPGTRFAAKVMRAESLGFESYSPYQDKDL---TEIAVCDYGDLVLPYGGPELILDIISDFTRDVLSDEKIPVMIGGEHLVTLGTVRALVEKYPDLHVIHFDAHTDLRHEFFGLSHATVMRRVWD--LVGDGKIFQMGIRSGDRSEFEWAKEHLHQCRYNC--DTIDYIIEQTKGKPVYVTIDLDVLDPSVFPGTGTPEPGGVDFKTLLDCILKMSELNIVGADINELSPHYDPSGSSTAVAIKTLRELLLVVHK... 285
371 2.000e-96UniRef50_A0A0M0BJM3 Uncharacterized protein n=1 Tax=miscellaneous Crenarchaeota group archaeon SMTZ-80 TaxID=1685135 RepID=A0A0M0BJM3_9ARCH  ali  30  19..................NFAGC----NTSFDDAKYVILGVPYDKTSTYRPGSRFAPSHIREASLNIETYSFKTNLDL---EEIKICDLGDLNIV-DSLEETLKRLKIVVTEIVNADKIPIVIGGEHTITTGVFKSLKE---NSALMIFDAHLDFREEYMGFSHATFVRHLMN--ALGPEKIILAGTRAVSKVEVEYAYITTNEIQQNEANVIINKIKSKISDKKVYISLDMDVLDPAYAPAVGNPEGFGINIKDLMEIIYGLRDIPLSGFDLVEVVPHYDQ-GVTAIQAAKIIFEIISL...... 295
372 2.000e-96UniRef50_A0A2K8L2H5 Agmatinase n=3 Tax=Zetaproteobacteria TaxID=580370 RepID=A0A2K8L2H5_9PROT  ali  30  11...............................EEHDIRIIGAPFDGTVSFRPGARFGPAAIRDASDGVETYSPYLDADL---ETVHYADAGDLELPMGNTEAVLAIIRETVDECLNDDVIPFLLGGEHLVTLPAVEAVFEKYPELVVVQLDAHADQRDDYLGISHACVMRRVSE--LVGDENIRQLGIRSGTQREYGFGTLTTFR------DDDLDEMVAWIGDRPVYLTIDLDVFDPACFPGTGTPEPGGIDWWTFNRFIKAMMECDIVALDAVELAPQLDTSGCSSVLAAKAVREMLLAVS.... 276
373 2.000e-96UniRef50_A0A2H0Y197 Agmatinase n=6 Tax=Candidatus Saganbacteria TaxID=1703751 RepID=A0A2H0Y197_9BACT  ali  28  6...................FLDLPL-KLRAYQTAKFVVVPVPYEATTTYGQGTRRGPAAILTASLQVENFDEELKAEPYVF---GIHTQGNCQI---------KGLASRVKRHLAAGKTPIILGGEHSITPFVVKAAAQQDQALSVLQLDAHADLRDKYQGNNHACVMRRVLEIC-----PAVQVGVRSLSKEEWGFAKKSGQDKKMHWAQDKIKKIKNQLS-KNVYITIDVDVFDPSLIPAVGTPEPGGLSWYQVLNLLREICQKNVVGFDVVELSPRL--NEVSPFAVAKLVYKVISYL..... 272
374 3.000e-96UniRef50_A0A0D2BCV2 Uncharacterized protein n=1 Tax=Exophiala xenobiotica TaxID=348802 RepID=A0A0D2BCV2_9EURO  ali  35  39.............FQGIQTFAHLPHTQCLVEQDADLAIIGVPFDTSVAYRPGARFGPRAIRSASRQIPARGFNHAQGLNPYQWATVLDCGDIPVTPFDNAVAFEQMTEAYRDLLRRHPRLVTLGGDHSVALPALRALHEIYGPVSVLHFDSHLDTWNEQSNYNHGSMFWIAHNEGLIAKDGNIHAGLR---------TRIFGDDYGDY--AEDAKQNFQYIETE-----------EPGLAPGTGCPEPGGWTTRELKAMLRGLEKLNIVGADVVEVAPPYDDAGSTAWAAADLAYELLGLMVAN.. 342
375 3.000e-96UniRef50_A0A256ZX63 Agmatinase n=9 Tax=Euryarchaeota TaxID=28890 RepID=A0A256ZX63_9EURY  ali  28  6.................PSFF---ADANSNYNAAEFVIFGIPYDKTSTFRHGAAEAPSEIRKASWNFEPYRFETGVD---FREVRVHDFGDLPVKDLSPKDMVKEVEIFVKKIKKDRKFPVAIGGEHSVTLGIVKALGD--EDFCVLSLDAHLDYRDEYEGFNHACVIKRISEE--IGIEKIAILGFRSADKEEYRNAILFFKDIFKLGLKNVLKELKKYFGKSKIYLTLDIDVLDPAYAPGTSTPHPFGLTTFQLLEIIDEFSE-KLIGFDIVEVCPPYDNGE-TSLLAAELIRTTIT....... 283
376 3.000e-96UniRef50_A0A2J6W559 Agmatinase n=1 Tax=Caldisphaera sp. TaxID=2060322 RepID=A0A2J6W559_9CREN  ali  28  1MSLKEIYLSKSSRYAGLET-----------NKKSKYVIFGVPFDSSTSYKPGTRFGPDSIRQAASSLESNSYFSDI---YLEDIGIDDEGDITPVIGDINETMNRVTSITSEIVKENKIPIVLGGEHTITYGVLRGIKKALISPCLIVIDAHYDLRDDYLGLGHASVMRRNLE--ILGLTKINYLGVRAYSKEERNYNTLKPSDIYRLGILNTINTIKRFLSDKYIYLSIDMDGFDPSFAPGVGNPEPGGINNVEGLSIVNQLVDKRLIGADVVEVSPPYDSNDITAALGAKLINEII........ 294
377 4.000e-96UniRef50_A0A238ZNI7 Agmatinase n=1 Tax=Desulfurobacterium atlanticum TaxID=240169 RepID=A0A238ZNI7_9BACT  ali  33  11..................................EITIFGVPFDGTTCFRPGARFAPAGIRFFSENLETYSPALNRDLD---DIDFCDAGDLEINAL-PEDMVETVYSFMENV----KIPVMLGGEHSVTFPVVKALKERYGELTVIHFDAHTDLRDIYSGYSHACVMRRVLELGC----KIVHVGVRSGTLEEF-------TLIRDNPLLHLIKKLPEILENKNIYFSIDIDYFDPAFAPGTGTPEPCGGTPVEFFSIIYNLPSANIVGFDIVEVSPPYDPSGITQMLAAKVVRELI........ 260
378 4.000e-96UniRef50_A0A2H5YAU8 Proclavaminate amidinohydrolase n=6 Tax=Bacteria TaxID=2 RepID=A0A2H5YAU8_9BACT  ali  29  15..................SFFGVPLCDDVERLEARVAFIGVPFDQGTTNRPGARFGPNAVRDAYDYLSPFEPEVDLGTEVLRGVTMADLGDINVAPSNVDLAFDRLTRTVRRVVQKGAFPVVVGGDHSITFPVVRGL-EGYAPLGIVHLDAHLDYTHDYQGYYHGSPMRRCAELPFVGP--ISHIGIRAVEARQRGNLILSADRFRQLGPKESARLVPPSPF---LYISLDIDVLDPPVAPGTGTPVVGGLTYLEVRDFLREVVKRKVVGFDLVEVAPEYDHAQVTALTAGRLIVDVLAAVF.... 312
379 5.000e-96UniRef50_UPI00056529FD agmatinase n=1 Tax=Pseudonocardia acaciae TaxID=551276 RepID=UPI00056529FD  ali  33  3.PPQPSELPPVTPASG--TFLHVPPRT--EGAPADVVVLGVPYDVATPYRVGSRMGPDHIRALSAQTRRYLA--DRDGDPLSALAVVDAGNVALTPGRPEPAYQAIEAAVREILDAGAVPLTFGGDGAVTLPQLRAVAARHPDLVVVHLDAHTDAYDPDDPYTNATTFTHAVDEKLLDPAASVHIGTRGTYARRLGYQVIPMPELRATGIAEVARGLTTALEGRPVYVCWDMDVFDPSVAPGVCTPEWGGLTAAEGIEMLRALSGLRAVAVDVNTVSPPHDPAGLTGSLAARIALEFLYSLADGR. 311
380 6.000e-96UniRef50_A0A1J4UHW9 Agmatinase n=2 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A1J4UHW9_9ARCH  ali  27  8................PFTFLGMKN----NLKNAKTVIVQAPYDGTVFYKDGQRHGPREIIDASRHMELYDAEFGCDVC--ESAPVYTMDELVLSKESPKKAVERVGEVVDEVLKERKFPLVLGGEHSVSAGAVSACAKKFKKFSVLQIDAHGDLRDAYEGYSHACAMRRAREAC----GNIVQAGVRSMSGEEAEWIKKERIEKYIFGSEFEESEVLERIENENVYVTFDLDGFDPSIMPAVGTPEPGGISWKQATSLLRKVFERNVIGADVVELCPVIGDT-ASAFLAAKLCYKMIGWKF.... 286
381 6.000e-96UniRef50_A0A174HHN8 Agmatinase n=37 Tax=Bacteria TaxID=2 RepID=A0A174HHN8_9FIRM  ali  43  11.............................................................................VNIMDGLKGGDIGDFNVTPGYIHPTYQAIEEGVAGILKENACPIVLGGDHSITLAELRAAAKKYGPVALVHFDSHSDLCDEGQKYNHGTPFRRALEENLIDASHSIQVGMRGSMAAELGMKLIPAHKVREMGLETLVKTILERVGDMPCFLTFDIDFVDPAYAPGTGTPEVGGFTSLEALELVRNIKDLNFVGFDLVEVLPAYDHGEITAYLAANIVFEYLSILAVKK. 248
382 7.000e-96UniRef50_A0A2P5K4K6 Agmatinase n=1 Tax=ANME-2 cluster archaeon HR1 TaxID=1968520 RepID=A0A2P5K4K6_9EURY  ali  26  11...........................DSSYRDATFIIFGAPFDYTSTYRKGSRLAPGAIREASYSFETYNAFFNVDLC---EVPLHDAGNIEISNNSIEQAITAVGDMVNKVLAQGKIPIMLGGEHSLTLPCIKEAKFRYHDLGAVILDAHLDLRDDYSGNSHACISRRIIED---VTGKYISIGIRSGSRHEYDIKYYTADNIYDMGCDNVHTELTRYLNTRHLYLSLDMDVLDPSFAPALGTPEPFGLTDRQVLSFIRKLAPRSI-GFDVVEIAPQYD-RGYTALLGAKFIREFIAAVWANK. 289
383 7.000e-96UniRef50_A0A1F9YS33 Agmatinase n=4 Tax=Euryarchaeota TaxID=28890 RepID=A0A1F9YS33_9EURY  ali  31  13...........................SFSFEDSEFVIVGVPFDRTTTYRSGTRFAPTAIREVTHVFEKENFEHGT---TFEDIPVHDAGDL-YEEGTVDDMVMAIEEEARRIVLAKKFPLFMGGEHSISPPVVKAF----GDISVITIDAHLDFRDEYQGNSHACAHRRIVD--HVGKGNAFAFGVRSISSDEDLSEALYADRIHKEGCEKVFEEMLSKLKRKPVYLSLDIDGIDPAYAPGTGTPEPFGITPWDVRYIINRLGD-RLVGFDVVEVCPPYD-NGNTSILAARMMREVMAAMHAKKG 287
384 8.000e-96UniRef50_Q0F026 Agmatinase, putative n=3 Tax=Zetaproteobacteria TaxID=580370 RepID=Q0F026_9PROT  ali  30  11...............................EEHEIRIIGAPFDGTASFRPGSRFGPSAIRDASDGIETWSPDLDSDL---ESVHYADAGDLELPMGNTEGVLAIIREAVDECLTDDVIPFLLGGEHLITLPAVESVFEKYPDLVVVQLDAHADQRDDYLGLSHACVMRRISE--LVGDENVRQLGIRSGTQREYELMKGFGT--LTSFREDDLIELVDWIGDRPVYLTVDLDVFDPACFPGTGTPEPGGIEWWTFQRFIKAMQGCDIVGLDAVELAPQLDTSGCSSVLAAKCVREML........ 272
385 8.000e-96UniRef50_A0A1F5CR36 Agmatinase n=15 Tax=Candidatus Bathyarchaeota TaxID=928852 RepID=A0A1F5CR36_9ARCH  ali  30  1MYDHELFVSQPNVFSGVQ----------KDYDKADYAVLGVPFDATSTYRSGARFGPNAIRQASLNIETYSFRTGLDV---ENLRLHDLGDLHVS-TDARKTLNTLKLVIRDIIKT-KVPVTIGGEHTITLGIAKGFGSKIPKTAVVSFDAHLDLRNEFLGLSHTTFMRRINEE--TKPAKIIEVGTRSVCKEELGIEFLTTQQIRKEGSQRAAERLKEKLAEEHIYLSIDMDVLDPAYVPAVQNPEADGLEMHVLLDILGSICDRRVMGFDVLEIAPSYDQ-GITAIQTAKVIFEVLCNLQKSR. 296
386 8.000e-96UniRef50_A0A212LI87 Guanidinobutyrase n=20 Tax=Proteobacteria TaxID=1224 RepID=A0A212LI87_9RHIZ  ali  40  5...........PTFAVAPSFMGLARF----DRSAAYALAGIPLDIGVTNRTGARSGPAAVRAASRMLTDGDHPHFW-IDPT-RLDIADIGDFAIALGDLAESYRVIERQAEDLNH----LIAIGGEHGITLPLLRALRRKLGPLGLIHFDAHVDTWPDNFGYGHGSPFYHAIEEGLVDPRRMIQVGIRSPVQRDRGVGILTAQDVHALGPAAVTERIRQVIGAGPAYFSYDVDCLDPAFAPGTGTPEFAGLFPWQSQAILRSLTGIDFVGMDVVEVAPAYDVSEITALAAATVIWDYLGLVGSAK. 298
387 9.000e-96UniRef50_A0A2V6SHG1 Agmatinase n=2 Tax=Bacteria TaxID=2 RepID=A0A2V6SHG1_9BACT  ali  34  3.TFLPQDSLTSPRFCGITTFMRLPHTKVLD--GVDVAVLGIPFDTGSPFRVGCRFGPSAVRAMSLMLRPINPYQR--LNVFQECAIVDYGDTEVAPGYLPESFAQIEAALTPLAARGIIPVGLGGDHSIALPEVRALGKAHGPLAVLHFDSHTDTWDTYQRHSAGTAFRRGVEEGWIDARASMQIGMRGFSDGDLGYEVVTTDQMLDGGLEPLARRVLEKLRGRKVFLSFDLDVVDPAFAPGVQTPEAGGPTAREILRLLRSLRGLDLVGADVVEMNPSYDSSGISALLAATV............. 302
388 1.000e-95UniRef50_A0A1G2ZHM1 Agmatinase n=1 Tax=Planctomycetes bacterium RBG_16_43_13 TaxID=1801967 RepID=A0A1G2ZHM1_9BACT  ali  28  11..................SFMGIEPQYT-ELDKSRFVVLPVPYEQTTSYKKGTRFGPGALIDASCQVELMDEELMQDTY---KVGIHTLPPFPIN-KDPAVFIRELSDYTRRFLDKGKFVITLGGEHTVTAGTIIPYAKKYPKLSVFHIDAHPDLRNEYEGYNHACALRRVL-----DYAPIVQVGIRCITPEEVEIKTFFAHS--YKSVKEIIPSVLKTLSDD-VYITIDLDGLDPSIMPGVGTPVPGGLMWYDTLEILREIYKKNVVGADVMELCPLQD-NVLSEFTAAKLTYKIMGYVVKS.. 291