current user: public

If you have questions about the server, please let us know.

Query: [O] KOG4146 Ubiquitin-like protein, from COG1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# E-value Template Links and tools%idFirst MAIKVELLGGLDLLFNKQKALSLSLSNLGSTKLGSLIDYMAQIIEKPSQKDLFILNGTVRPGIIVLVNDQDWELLEKEEYNLEEGDEVVFVSTLHGKTIFSIFFIIFKTNCINLast
1 4.000e-26UniRef50_A0A2E7R0W3 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E7R0W3_9CHLR  ali  18  1MEIQVKFYATFRNLVGGNKNLTVE----NVSTVSELLKKVFEQHPDL-RVGLLGEDGDIRSFVAIMVNGRDIRHLSGIETRISDGDSLDIFPPVAGGALTGPESVVSK..... 103
2 1.000e-25UniRef50_A0A0M0BPI9 Uncharacterized protein n=1 Tax=miscellaneous Crenarchaeota group-15 archaeon DG-45 TaxID=1685127 RepID=A0A0M0BPI9_9ARCH  ali  15  1MEIEVKFYAMLREIAGKRHER---IEMPAKSSVRDLIDLLVDRYGGEFGRYIYDAEKRERRYLSYMLNGVNVNSLQGFDTPLSDGDVLSLLPPVGGG................ 94
3 2.000e-25UniRef50_A0A2R6IHW8 Uncharacterized protein n=1 Tax=Halobacteriales archaeon QS_6_71_20 TaxID=1919183 RepID=A0A2R6IHW8_9EURY  ali  16  1MELTLKFFATFREAVGSK---TVDREFADASTVGEVLAALEAEYEDLGGDLLVD--GDLRPQINVLLNGREVLHMEGVDTAVSDGDTVAVFPPVAGGSGSATETR........ 100
4 3.000e-25UniRef50_A0A1F9C3C5 Uncharacterized protein (Fragment) n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9C3C5_9DELT :  ali  21  26MEVRVRIPTPLKKLAGEQ-----DIVQAKGKTVGEVLQWLTETYPGLQ-ERLRDERGEVRRFINIYVNDEDIRFIQNLETPLKEGDQISIIPAIAGGAFSKRRVTL....... 125
5 3.000e-25UniRef50_A0A1F9Z848 Uncharacterized protein n=1 Tax=Euryarchaeota archaeon RBG_16_68_13 TaxID=1797982 RepID=A0A1F9Z848_9EURY  ali  15  1MRVTVRFFAVYRDIAGGKEQ---QIEFDAHASVETLLEALFRRSPRL-RQEIVDDDGNLREYVGVLANGRHVRDLKGLPTPLADGDVVSLFPPVAGGTP.............. 95
6 5.000e-25UniRef50_A0A2H5W4A9 Sulfur carrier protein CysO n=13 Tax=Bacteria TaxID=2 RepID=A0A2H5W4A9_9BACT  ali  27  1MAVKVRIPTPLRRLTGGQAELTVS-----ATTVEELLMQLRYDYEALA-QQILDDRGEVRSFVNIFVNDEDIRFLQGRSTPLKDGDVVSIIPSIAGG................ 91
7 8.000e-25UniRef50_A0A1G1Q383 Molybdopterin synthase sulfur carrier subunit n=16 Tax=Bacteria TaxID=2 RepID=A0A1G1Q383_9BACT  ali  21  1MAVIVRIPTPLQRLTNGQGEVP-----CAGSTVNDLLADLERRHPG-IKERICDESGKLRRFVNVFVNEEDIRFLQGDQTAVKDGDEVSIIPAIAGG................ 91
8 9.000e-25UniRef50_A0A2H5YFI7 Sulfur carrier protein CysO n=7 Tax=root TaxID=1 RepID=A0A2H5YFI7_9BACT  ali  24  1MTVEVRLTANLQRLAGGQRAVQVE-----AHTVGELLERLDHMYPGFKSSVL--DNGQLHRFVNIFLNDEDIRFLQQLETPLKDGDVVSILPALAGGQSGP............ 94
9 1.000e-24UniRef50_A0A2I0P8G1 Molybdopterin synthase sulfur carrier subunit n=3 Tax=root TaxID=1 RepID=A0A2I0P8G1_9EURY  ali  20  1MTVKVRAFAMLRDIIPT----ECNAKTPGGSTIGDLLAHLSARYPGL-GDALFTPTGEIRAYVNILKNGRNVHFSGGLETPLDDGDTVALFPPAAGG................ 92
10 2.000e-24UniRef50_A0A2H9LAJ3 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Hadesarchaea archaeon CG08_land_8_20_14_0_20_51_8 TaxID=1975561 RepID=A0A2H  ali  17  11.KIEVRLFANLREFAKTKAAVE---DVKSGTSVGDVLQKICERFGTKFRGQVLDERGQPNENIKILLNGHNIVFLQGAATKLRDGDVIAIFPPVGGGS............... 104
11 2.000e-24UniRef50_A0A1V6ATU0 Sulfur carrier protein CysO n=1 Tax=Deltaproteobacteria bacterium ADurb.Bin151 TaxID=1852868 RepID=A0A1V6ATU0_9DELT  ali  17  3MKITVRAFADYREIIGK----EMELLLPAEKTIGGLLADLGDRYPNL-RREMFTPAGELKEFINIFINGRNIAFLKNMATPLSDGDIIALFPPVAGG................ 94
12 3.000e-24UniRef50_K9TQF2 MoaD family protein n=34 Tax=root TaxID=1 RepID=K9TQF2_9CYAN  ali  25  1MSVKVLIPTPLQKFTSDKATVE-----CSGSNVAELLDSLEANCPG-IKERLCDEKGQLRRFLNVYVNEEDIRFLEGPDTPLKEGDEVSIVPAVAGG................ 91
13 4.000e-24UniRef50_A0A0S8CG15 Uncharacterized protein (Fragment) n=3 Tax=root TaxID=1 RepID=A0A0S8CG15_9CHLR  ali  19  1MAVTVYIPAPFRRLTANRSYVE-----GHGQTVAELLEDLTTRYPAL-GDMLQNEAGELPAHINIYVNNQEIHSLQGEATPLKDGDEVAVIPAIAGGQDLTPEQTL....... 100
14 5.000e-24UniRef50_K9SB36 Molybdopterin synthase subunit MoaD n=23 Tax=Bacteria TaxID=2 RepID=K9SB36_9CYAN  ali  29  1MAVKVLIPTPLQKFTNNQATLE-----CGGASVAELLEALEQSCPG-IKARLCDEEGKPRRFLNFYVNSEDIRFLEGTETPLKDGDEVSIVPAVAGG................ 91
15 5.000e-24UniRef50_A0A202DQK8 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A202DQK8_9BACT  ali  16  1MAVKVRIPAPLRKLTQDNPVVEVE-----GKTIQELLASLEKNYPGL-KERICDESGQIRRFVNIFVDGEDIRFKDGANTPVSDGAEVSIIPAIAGG................ 91
16 1.000e-23UniRef50_A0A1Q7Z3J2 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A1Q7Z3J2_9DELT  ali  20  1MPVTVKIPAPLRPLTANQGEVAVE----NATTVQAALEELARKYPG-IKDKLLDDKGALRRYVNLFRNDEDVRHGKGLGTELREGDRLTIVPAIAGGC............... 93
17 2.000e-23UniRef50_A0A1F6LIZ8 Uncharacterized protein n=1 Tax=Candidatus Lindowbacteria bacterium RIFCSPLOWO2_12_FULL_62_27 TaxID=1817870 RepID=A0A1F6LIZ8_9BAC  ali  23  1MSITIRIPTPLRKLTGDAEEVRID-----AVTLRDMITTLERQYPG-IKDRLCDESGEVRRFINVFVNDEDVRFMEGQATQLKDGDVVSIVPAVAGGARIKKKY......... 98
18 2.000e-23UniRef50_K9XAW5 Molybdopterin synthase subunit MoaD n=168 Tax=Bacteria TaxID=2 RepID=K9XAW5_9CHRO  ali  29  1MAVKVLIPTPLQKFTNNQATLE-----CDGSNIAELIESLEQSCPG-IKSRLCDEQGQPRRFLNLYVNSEDIRFLDGTETPLKEGDEVSIVPAVAGG................ 91
19 2.000e-23UniRef50_A0A1F8S2M8 Uncharacterized protein n=4 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1F8S2M8_9CHLR  ali  18  3...TVKFPSVLRANVGGAREVE-----AGGSTIGEVLDALVAAYPAL-RDQLFTDEGELNRFVNVYLNGQDVRYLDGPSTPVAAADEVRLLPAMAGGAGEARRTASGET.... 102
20 2.000e-23UniRef50_A0A0A7GDP4 Molybdopterin biosynthesis protein n=1 Tax=Geoglobus acetivorans TaxID=565033 RepID=A0A0A7GDP4_9EURY  ali  22  2..IKVKFPTVFVQITGKRR-----IEVDGVTTVSQLLEKLFDEYPQLKERLIKD--GDLSPFINIFVNGEDIRFLNGLDTEIKDGDEVAFIPAISGG................ 89
21 2.000e-23UniRef50_A0A211YMM8 Uncharacterized protein n=1 Tax=Pyrodictium delaneyi TaxID=1273541 RepID=A0A211YMM8_9CREN  ali  23  37.RVKVKLFAIYYEAAGTR---ELEVDLPEGATVLDLAKLLEEKFPKLRGELV--EDGRISEEARVLINGRNIEWLEKEKTKLHDGDVVAFFPPAAGG................ 127
22 3.000e-23UniRef50_A0A1F8NZ56 Uncharacterized protein n=2 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1F8NZ56_9CHLR  ali  21  3...TVRIPTPLRPYAGGQKDIDV-----RGETVAAALHDLARQYPAMQ-MHLFDDRGVLRPYVNLFLNDEDVRQLGGQETPLRPGDRLVIIPSIAGGAEADP........... 95
23 3.000e-23UniRef50_A0A2R6GIQ7 Uncharacterized protein n=1 Tax=Halobacteriales archaeon QS_1_68_20 TaxID=1919169 RepID=A0A2R6GIQ7_9EURY  ali  14  6...ELRFFATFRQAVGQK---TVHREVDDGTTVGDLLAALESEYDGLDGELIVD--GELREHLSVLLNGRDVVHQEGLDTSLSDGDTVSVFPPVAGGNGDPGRERTAGDD... 107
24 3.000e-23UniRef50_G4RLE2 Molybdopterin converting factor, small subunit n=30 Tax=Archaea TaxID=2157 RepID=G4RLE2_THETK  ali  20  1MNIRVRYLATLFDLMGTMRDV---VEVPEGATVRDLIRAIDRKHNGRLSKEILDGD-KLKDEYNILVNGRAIDYLAGLDTRLKDNDEVVFMPPVGGGCVSYR........... 98
25 3.000e-23UniRef50_A0A2H5UWN0 Sulfur carrier protein CysO n=41 Tax=cellular organisms TaxID=131567 RepID=A0A2H5UWN0_9ARCH  ali  23  1MPVKIYLPTPLRQYADGHDIVEVE-----ARTVGEALQNLASKFTGL-RKQIFTETGGVRSFVNIFVNDEDIRHLQGQETVLKEGDTIYIIPSIAGGS............... 92
26 6.000e-23UniRef50_C0GFW5 ThiamineS protein n=1 Tax=Dethiobacter alkaliphilus AHT 1 TaxID=555088 RepID=C0GFW5_9FIRM  ali  12  1..MTIYLPTPLRRHAGGAREVEVS-----GSTIREVFTGLKENYPDLASQLWDDEADDLKKYLSVFLNDENVRNLQGPDTPVGEKDEISVIPAIAGGS............... 91
27 7.000e-23UniRef50_A0A2V9GN45 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9GN45_9BACT  ali  24  1MPVKVMIPSPLRPYAGKRDSAEFS-----ARTVGEALGHLTTEF-AELRKHLFTEDGKLRSFVNVYVNDEDIRYLAKENTPTKDGDTISIIPSIAGGAST............. 94
28 1.000e-22UniRef50_A0A2J6MZ72 Molybdopterin synthase sulfur carrier subunit n=4 Tax=unclassified Candidatus Bathyarchaeota TaxID=1700837 RepID=A0A2J6MZ72_9ARCH  ali  25  1MKVNVRFFGSFRNITN---KSTVTLELGKGAQLKEAIRRIVEEFPKIESALIDPELGDPRPNTLIIVNGREISVLKGLETVLKDGDEVVFIPVSHGG................ 94
29 1.000e-22UniRef50_A0A151B963 Ubiquitin-like small archaeal modifier protein SAMP1 n=1 Tax=Candidatus Bathyarchaeota archaeon B24 TaxID=1779368 RepID=A0A151B96  ali  17  1MRVKVKYFALLRELAGKREE---DVEIDEETRVEELLEKLSERYGERFRDYVYGVGEFRGLTLMFLLNGRNIELMDGFKTRLRDGDTLSILPPVVGG................ 94
30 1.000e-22UniRef50_H1Z1H5 Molybdopterin synthase subunit MoaD n=2 Tax=Methanomicrobiaceae TaxID=2194 RepID=H1Z1H5_9EURY  ali  20  1MKIKVKAFATLREVMDMQ----VDLDIMEGATVGTLLSELTGRYAGL-GVLIFDGPDSLRKFVNILRNGRNIEFLAGLDTALADGDLIALFPPAAGG................ 92
31 1.000e-22UniRef50_A0A1G1KEM4 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1G1KEM4_9BACT  ali  19  1MAVKVRIPTPLQKLTANQSEVTVE-----ALTIDELLTGLERQHPG-IKERLCDEAGKLRRFVNIYVNEEDIRFLQGQETKLKAGDDISIIPAIAGGAAVVKKQVTL...... 101
32 2.000e-22UniRef50_A0A1Q7S084 Uncharacterized protein n=7 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7S084_9BACT  ali  19  4..ITVKIPTPLRPLTAGQAEVKIE-----GATVGEVLRKMDSQF-KGFGDRVLDDGQTVKRFINVFVNEDNIRDKKELDTELKNGDTISILPSIAGGKLATKRHKIYKK.... 104
33 2.000e-22UniRef50_A0A135VBX3 Uncharacterized protein n=1 Tax=Candidatus Thorarchaeota archaeon SMTZ-45 TaxID=1706443 RepID=A0A135VBX3_9ARCH  ali  20  26MKVTVKFYATLRDLTG--KKVPIEVDLEEGATISKLLNVL---YLDLAKEAMVEDSQKVKPNITILRNGREIKFLDGTETVLSSGDEVSIFPLVAGG................ 118
34 2.000e-22UniRef50_A0A2V8RPH3 Molybdenum cofactor biosynthesis protein MoeB (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8RPH3_9BACT  ali  15  1MSVTIAIPTALRQFAGGQSEVKVE-----AATAGEALNLLTASHAEL-RRHLFNDQNALRNFVNVYLNDEDIRHQDGPDTPIKDGDTILIVPSIAGGVVSEPLAV........ 99
35 2.000e-22UniRef50_K9TVJ1 Molybdopterin synthase subunit MoaD n=280 Tax=root TaxID=1 RepID=K9TVJ1_9CYAN  ali  28  1MAIKVLIPTALQKFTNNQATYE-----GSGNSVSELIESLEQGFPG-IKSRLCDEQGQPRRFLNLYVNSEDIRFLDGIDTPLKEGDEVSIVPAVAGG................ 91
36 2.000e-22UniRef50_A0A2A9HC97 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Thermoflexus hugenholtzii TaxID=1495650 RepID=A0A2A9HC97_9CHLR  ali  17  1..MHVNFYATLRPLAGGK---TVEFDLPPGATARDLLEAVGARFPA-IGELLWTAPGELGDYIKVFVNGREIRHLQLLETPVPPGAEVDIFPPAAGG................ 91
37 2.000e-22UniRef50_A2BJ47 Molybdopterin converting factor, small subunit n=2 Tax=Pyrodictiaceae TaxID=2307 RepID=A2BJ47_HYPBU  ali  22  1MKITVRLYAGFHEAVGST---ELELEVPKGVTVLDVARILEEKFPGLRGRLVKD--GELQDDVLVLVNGRSIEWLEGVKTKLRSGDRVAFFPPAAGG................ 92
38 2.000e-22UniRef50_A0A0U5H2I1 Ubiquitin-like modifier protein SAMP3 n=54 Tax=cellular organisms TaxID=131567 RepID=A0A0U5H2I1_9EURY  ali  18  1MNVELRFFATFRQAVGTK---VVEREYDAGTTVGDVLRELEAEYEGLEGQLV--ENDDLRPHINVLKSGREVLHLDGMETALEDGDQLSIFPPVAGG................ 92
39 3.000e-22UniRef50_F2LT69 ThiS family protein n=82 Tax=Bacteria TaxID=2 RepID=F2LT69_BURGS  ali  18  1MTVTVHIPTLLHPLTGDRKQVE-----AQGANLRELIDDLDARHPGLRARLMRD--GALHRFVNFYINDQDVRFAGELDAPVRAGDSIVILPAVAGGAPGRPEAA........ 98
40 3.000e-22UniRef50_A0A2H5XIA9 Sulfur carrier protein CysO n=34 Tax=Bacteria TaxID=2 RepID=A0A2H5XIA9_9BACT  ali  20  7.TVTIRIPTPLRSFTNEQATVEV-----QGTTVGEALAHLVEQFPRL-KPHLFNEEGRLRSFVNIYLGDEDIRYLQREATPLNPGAELSIVPSVAGG................ 96
41 3.000e-22UniRef50_A0A2H5ZFD7 Sulfur carrier protein CysO n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5ZFD7_9BACT  ali  19  9.TVQVRVTAVLQKLTGGLKAVE-----ATGSTVGEALDDLDRRFPG-FKAQLSGEDGKLHRFVNIYLNDEDIRYLQGVDTPLKPGDVLDILPALAGGS............... 99
42 3.000e-22UniRef50_A0A1G1KNS3 Uncharacterized protein n=3 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1KNS3_9BACT  ali  25  1MSIKVRVPTPLQKLT-----RDLDTVECNAKTIKDLVESLDKDYPGLKGR-ICDENGKIRRFLNIYVNDEDIRFLEMDRTELKDGDEVSIIPAIAGG................ 91
43 3.000e-22UniRef50_A0A0N8GP14 Uncharacterized protein n=2 Tax=Levilinea saccharolytica TaxID=229921 RepID=A0A0N8GP14_9CHLR  ali  15  1..MKIKYFAYLRDTTHTAAEHY----SQPAATIGDLLEVLCQRYGPGFSRWIRTPEGGISTIAIILINGKDIRDGAWVDTPLSPEDEICIFPPVAGG................ 91
44 4.000e-22UniRef50_P74060 Putative sulfur carrier protein slr0821 n=12 Tax=Terrabacteria group TaxID=1783272 RepID=Y821_SYNY3  ali  25  19MTVKVLIPTPLQKFTSGQATIDCE-----AANVGQLIEALEANCPG-IKARLCDEEGKPRRFLNFYVNEEDIRFLEGTDTALSAGDEVSIVPAVAGG................ 109
45 4.000e-22UniRef50_K9WN42 Molybdopterin converting factor, small subunit n=24 Tax=Bacteria TaxID=2 RepID=K9WN42_9CYAN  ali  30  1MAITVLIPTALQKFTNNQASLDCT-----GNSVGELIESMESSCPG-IKSRLCDENGKPRRFLNFYVNSEDIRFLEGTDTPLKDGDEVSIVPAVAGG................ 91
46 5.000e-22UniRef50_A5UR85 ThiamineS protein n=9 Tax=Bacteria TaxID=2 RepID=A5UR85_ROSS1  ali  19  1MAVTVTIPTALRQYVGGNASVSL-----AAGSVGQILAALSEQYPQLGR-HLYNEQGALRSFVNIYVGDEDIRHLQGIETPVPDGETVSIIPAIAGG................ 91
47 5.000e-22UniRef50_Q1PUP8 Similar to molybdopterin synthase subunit 1 n=814 Tax=root TaxID=1 RepID=Q1PUP8_KUEST  ali  19  1MSVTVRIPTPLRTFTDGVEEVKVE-----GKNIGEIISNLEANY-KGIKERICDDSGQIRRFINFYLNDEDIRFLNNLETPVKDGDYISVVPAIAGGC............... 92
48 6.000e-22UniRef50_A0A257AH21 Molybdopterin synthase sulfur carrier subunit n=2 Tax=GOM Arc I cluster TaxID=1978122 RepID=A0A257AH21_9EURY  ali  17  2..IAIKFFASFRDIVGRK---EMDVEYRHGMTLGELLRDLCSASESLEKACF--EDGQLRDYVKFLVNGHNIAFLNGLETVLKDGDVIAVFPPVAGG................ 91
49 6.000e-22UniRef50_A0A1F7NJ76 Molybdopterin synthase sulfur carrier subunit n=50 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1F7NJ76_9BACT  ali  23  1MAVKVYIPTPFRRATNNKDKVEVE-----AADVGRLLDRLEADFSGL-KGLVRNEKGEVHHHVNIYVNSEGIEALQGLATPLKDGDEVAIIPALAGG................ 91
50 6.000e-22UniRef50_A0A142XP85 Sulfur carrier protein CysO n=11 Tax=Bacteria TaxID=2 RepID=A0A142XP85_9BACT  ali  18  1MAIKIQIPTPMREQSGGKAEVEVT-----GATVKAALEDLLRQYPGLGAKLF--DNGKLRPYINVFLNDEDIRYLDEMDTAVTDGVVLALIPAVAGG................ 90
51 7.000e-22UniRef50_E1QP08 MoaD family protein n=8 Tax=Vulcanisaeta TaxID=164450 RepID=E1QP08_VULDI  ali  28  1MRIKVKFFGDLYELVG---AFRIELETPNGLSIRDLIDLISHTFNPKFAEAVLDGDGRLRGEYVVLVNGKAIEWLNGLATKLNDNDEVVFLPPAEGG................ 94
52 7.000e-22UniRef50_UPI000852CC1B MoaD family protein n=1 Tax=Vulcanisaeta thermophila TaxID=867917 RepID=UPI000852CC1B  ali  25  1MRVQVKFLASLYEVT---KVLKTELDLPDGATIRDLIQAIDQRVSPNFSKVILDD-GKLKDQYVILVNGRSVDFLNGLSTKLSNGDEVVFLPPAGGG................ 93
53 9.000e-22UniRef50_A0A062V1J4 MoaD family protein n=2 Tax=Candidatus Methanoperedens TaxID=1392997 RepID=A0A062V1J4_9EURY  ali  15  3.KIRVRLFANLREYTGTK---ELELE---GNTIKEILEILCKRFPGLRNMLF--NGNSLQPYINVFLNGRDIIESGGLGTPVHSDDEIAIFPPVSGG................ 90
54 9.000e-22UniRef50_A0A2U3CGV8 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Candidatus Heimdallarchaeota archaeon B3-JM-08 TaxID=2012493 RepID=A0A2U3CG  ali  11  11.QVTARFFGPYKQVT---KKRDIDISLTEKSTVSLLLEVIITQYPPL-KDLILDEYSKLGSWVVILINGRNMSIFNGLNTPLKEGDTIAIFPPVAGG................ 102
55 1.000e-21UniRef50_A0A1G1JPU8 Molybdopterin synthase sulfur carrier subunit n=13 Tax=Bacteria TaxID=2 RepID=A0A1G1JPU8_9BACT  ali  24  1MGIKVRIPTPLQKLTKDKEVVECE-----ANDVKGLVEDLEKRYPG-IKTRLCDDGGKLRKFINIYVNDEDIRFLKMDQTPLKDGDEVSIIPAIAGG................ 91
56 1.000e-21UniRef50_A0A2V6CHZ4 Uncharacterized protein n=2 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V6CHZ4_9BACT  ali  23  71.KITIHIPGPLRDCCAGAAVLALS-----ATSVRAVLDELERRYPALHRS-ICDETGTVRRHINLFVNTHHMRDRNGLDTPLDPGDEVTILPAVSGG................ 160
57 1.000e-21UniRef50_A0A2R6JZ50 Uncharacterized protein n=1 Tax=Halobacteriales archaeon QS_8_65_32 TaxID=1919186 RepID=A0A2R6JZ50_9EURY  ali  18  4.....KLFANLAEAAGDRR---IDVDLPGGATIGDALTALLDRYPALEAEVL-NDDGDLRDHIQLLRNGRNFVTANGLETDLDEGDELALFPPVSGGRDLDSSFRSGRSN... 105
58 1.000e-21UniRef50_UPI000A3D63A5 MoaD/ThiS family protein n=1 Tax=Natrialbaceae archaeon JW/NM-HA 15 TaxID=1902251 RepID=UPI000A3D63A5  ali  21  1MELQLRLFATFREIVGG-KEHTLTVD--EGASVGDVLATLEAEYDELEERLL--EDGTLRPQLSVLKNGRDVIHQEGAATPLEDGDTLSVFPPVAGG................ 92
59 1.000e-21UniRef50_D3DH97 Molybdopterin converting factor small subunit n=6 Tax=Bacteria TaxID=2 RepID=D3DH97_HYDTT  ali  21  1MAVVVRIPTPLRRVANGQGEVQVE-----AKTVRDAIEKLEEMFPG-FKERLVDENGELRRFVNLYLNDEDIRFLKGIDSELKDGDVLSIVPAIAGG................ 91
60 1.000e-21UniRef50_T1A996 UBA/THIF-type NAD/FAD binding protein (Fragment) n=2 Tax=mine drainage metagenome TaxID=410659 RepID=T1A996_9ZZZZ  ali  21  3.QVSVKIPTPLRSFAGGAAAIPVE-----GATVGEVLRRMSATHSGLGR-HLFTPEGKLRNFVAVYRNDEDIRYLERDSTPVKDGDVVSIVPAIAGGGGVEPRATI....... 101
61 2.000e-21UniRef50_A0A1G3V0Y2 Uncharacterized protein n=2 Tax=Syntrophobacterales TaxID=213462 RepID=A0A1G3V0Y2_9DELT  ali  21  1MKVTFRAFADLREIIGAREK---DLSLPEGETVGGLLKGLCEAHSGLERK-IFDAPGRIKPFIIVLKNGRSINSLQNLDTVIDEGDVIALFPPIAGG................ 93
62 2.000e-21UniRef50_A0A2V6ZSR1 Uncharacterized protein n=2 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6ZSR1_9BACT  ali  18  1MSVTVYIPTSFRRATDNRDRIEV-----AANDISRLLDQLEASYGGL-KGLMRDAGGEVHHHVNIYVNSEAIESLQGLSTPLKDGDEVAIIPALAGGA............... 92
63 2.000e-21UniRef50_A0A2H5XRI3 Sulfur carrier protein CysO n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2H5XRI3_9BACT  ali  26  2..VKVKIPGPLRKLVDGKDEIHLE-----AKTLKELIEKLAEINPE-IKSRILDENGEVRRFINIYINNEDIRFLKGINSELKDGDEISIIPAIAGG................ 90
64 2.000e-21UniRef50_A0A1M4MKQ3 9,5 kDa culture filtrate antigen cfp10A n=12 Tax=Methanomicrobia TaxID=224756 RepID=A0A1M4MKQ3_9EURY  ali  20  13ITVKVRAFAMLRDIIPAER----NAAIPRGSTIGDLLAHLSARCPGL-GDALFTPTGEIRAYVNILKNGRNIHFSGGLETPLEDGDIVAFFPPAGGG................ 104
65 2.000e-21UniRef50_A0A162JXH5 Molybdopterin converting factor, small subunit n=32 Tax=Actinobacteria TaxID=201174 RepID=A0A162JXH5_9ACTN  ali  18  1MAVQVRVPTILRSYTGGAKLVE-----GTGDTLAALFLDLDSRHPGLRGRLISDGEGGLHRFVNIYVNDEDVRFLGSLDAKLSDGDNVTILPAVAGGSAGDTR.......... 99
66 2.000e-21UniRef50_A0B538 Molybdopterin synthase subunit MoaD n=2 Tax=Methanothrix TaxID=2222 RepID=A0B538_METTP  ali  19  1MRIKIRAFASFREILGKEMMVEIE----SGSNVSDLINHLCEIKPDL-RRALYSDTGELRDYFIIMLNRRRLNMPEDLGAALSDNDEVAIFPPVAGG................ 92
67 2.000e-21UniRef50_A0A2R6T8Z2 Molybdopterin synthase sulfur carrier subunit n=1 Tax=archaeon SCG-AAA382B04 TaxID=2137776 RepID=A0A2R6T8Z2_9ARCH  ali  1MNVKIKYFANFREITGKSEE---QMEIQKNSTIKNVLDKVIEEHPDLEQEIF--EDNELSDYVNILVDRRNILDRNGLDTKISSNDTIAIFPPISGG................ 92
68 2.000e-21UniRef50_A0A2V5VZX5 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5VZX5_9BACT  ali  22  136.KITIHVPGPLRDCCAGAAVLALS-----ATTVRAVLEELERRHPALHRS-ICDETGTVRRHINLFVNTHHMRDRNGLDTPLAPGDEVTILPAVSGG................ 225
69 2.000e-21UniRef50_A0A263CXR2 Molybdopterin synthase sulfur carrier subunit n=9 Tax=Actinobacteria TaxID=201174 RepID=A0A263CXR2_9PSEU  ali  22  1MRVDVRLPSMLRPIVGGESSLPVDLDGP--ATLGGVLDRLRERYPALERR-LRDERGTLRRYVNFYVDGEECRRLDGAGTALRDGAEVVVIPSVAGG................ 94
70 2.000e-21UniRef50_A0A1V0A7H1 Molybdopterin synthase sulfur carrier subunit n=66 Tax=Bacteria TaxID=2 RepID=A0A1V0A7H1_9ACTN  ali  24  1MAIEVRIPTILRNYTDGAKAV-----NAEGATLEELIANLESRHPGIKERLV--DDGSLRRFVNVYLNDEDVRFLGGLGTPVSDGDTVTVLPAVAGG................ 90
71 3.000e-21UniRef50_A0A218PCL1 Molybdopterin synthase sulfur carrier subunit n=2 Tax=cellular organisms TaxID=131567 RepID=A0A218PCL1_9EURY  ali  17  1MKIRVRYFARFRSLTGTGEE---ELEVPDGTTVRELVERLKERHPALREEVFGEDD---LADVNVSRNGRYASF----DEVLKEGDVVALFPPVSGG................ 87
72 3.000e-21UniRef50_A0A1I5R277 Molybdopterin converting factor, small subunit n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1I5R277_9PSEU  ali  23  1MTVTVHLPAVLRGMAEGRVELTVS-----AATLGQALDAIAASYPALERR-LRDERGTLRRYVNFYVDGEECRRLAGPDTPLRDGAEVMVIPSVAGG................ 91
73 3.000e-21UniRef50_A0A1F8PVZ1 Uncharacterized protein n=4 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1F8PVZ1_9CHLR  ali  18  1..MKINFYATLRQIVGTK---QVDFDLAENSTIGMVLEQVIQRYPAL-RPELFAENGELYPYVQVIINGRHVAHLEKLDTPLIPDDLVSLFPAVGGGSEER............ 96
74 3.000e-21UniRef50_D3S0H2 MoaD family protein n=9 Tax=cellular organisms TaxID=131567 RepID=D3S0H2_FERPA  ali  22  1MKVKFKLYASLRR---GRGTVEVEF---KGKTLRDALRELFKIYPDLSE---IVERDRVKEFYKIFVNGRDVEHLEGLDTELKEGDEIAIFPPIAGG................ 88
75 3.000e-21UniRef50_A0A1F8LYG2 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_13_48_10 TaxID=1797620 RepID=A0A1F8LYG2_9CHLR  ali  14  3.SMQVKLYASLRQAAGIK---MMDVEVHEGTTIYDVLLELTERYPVLGK-LIWKDPGELAEYVHVFVNGENIHRLVGLDTPLKSEDHVDIFPPLVGGYTS............. 97
76 4.000e-21UniRef50_D2Q0V7 ThiamineS protein n=2 Tax=Actinobacteria TaxID=201174 RepID=D2Q0V7_KRIFD  ali  19  1MTIQVKLPTVLRPFADGRER--VEVEPSADATVGSVFATLERQHPAL-RRRLTDDQGTLRRHVNVFLGDDNIRDLDGLDTKLPDGAELLVLPSVAGG................ 94
77 4.000e-21UniRef50_A0A2V9SUC9 Uncharacterized protein n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9SUC9_9BACT  ali  21  43...KIHIPTPLRQYAGKQPAVEV-----KGSTVGEALSGLVSQHPDL-RRHLYTEDGKLRAFVNVYLNDEDVRYLQKEATAVREADNISIVPSIAGGRGIE............ 134
78 4.000e-21UniRef50_A0A1F8NGS2 Uncharacterized protein (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A1F8NGS2_9CHLR  ali  17  2..VVIRVPAPLRAYTGGAREIEV-----QGKTVASALSDLASRHPAL-RPHLFDDRGDLRPFVNLFLNEEDVRMLQGTATPLDENDRLMIVPSIAGGSSAA............ 94
79 4.000e-21UniRef50_A0A2R6BQV5 Uncharacterized protein n=8 Tax=Candidatus Marsarchaeota group 2 TaxID=2203771 RepID=A0A2R6BQV5_9ARCH  ali  17  1MKVTVRYFARLREMLGKSSD---EFELEDSSTIMDLLNLLSTRYPNLKSAVFENDGKTLKKIYQVLVSGQHVS---EPNRKLHDGDIVAILPPVAGG................ 91
80 5.000e-21UniRef50_D1B8V8 MoaD family protein n=3 Tax=Synergistaceae TaxID=649777 RepID=D1B8V8_THEAS  ali  21  1..MKVLFFATIRDLAGRKE------DQASAGTVRELLSLLSDRYGPAFRRAVL-EGGAMSPNVIVLVNGHHVAHLKGEDTPLQEGDQVSIFPVIGGG................ 88
81 5.000e-21UniRef50_A0A256IFJ1 Uncharacterized protein n=4 Tax=Halobacteria TaxID=183963 RepID=A0A256IFJ1_9EURY  ali  13  1MELELRFFATFREAAGGK---TVVREFADGSDVGDVLRALEDEYDGMDGRLIVD--GELAPQINVLKNGREVLHLRGLDTDLADGDRLSVFPPVAGGAT.............. 94
82 5.000e-21UniRef50_A0A0F8WDR5 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F8WDR5_9ZZZZ  ali  20  1MSIMVYIPTPFRRLAGNQTYVRVE-----GSSVAEVLNNLGSQYPE-MRHMIFDESDEVPGHINIYVNNQEMHTLQGKETPLEDGDEIAVIPAIAGG................ 91
83 5.000e-21UniRef50_A0A1G1MRM3 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=A0A1G1MRM3_9BACT  ali  21  3.KVKVRIPAPLQKIAQNKQEVT-----AEAGNIRELIVDLEKQFPG-IKERLLDESGKIRRFINFYVNDEDIRFLKQDETALSEGNEVSIIPAIAGGSSTRLRS......... 99
84 6.000e-21UniRef50_A0A132N644 Uncharacterized protein n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A132N644_HYDSH  ali  17  1..MKVRLFATLRDVSD---VAEVDV-APAGERVRDVLQALVERHPALQAE-LFLPDGSLKPLVQVFVNGRNIHFTGGLETPVGEGDAIAVFPPVAGG................ 90
85 6.000e-21UniRef50_A0A1Z4NIK9 ThiamineS n=3 Tax=Cyanobacteria TaxID=1117 RepID=A0A1Z4NIK9_9CYAN  ali  28  1MSIKVLVPTALQKFTNNQAVLE-----CSGTNISELIESIEKACPG-IKERLCDENGQPRRFLNLYVNSEDIRFLDGVTTALKDGDEVSIVPAVAGG................ 91
86 7.000e-21UniRef50_UPI000A05EEC7 MoaD/ThiS family protein n=1 Tax=Methermicoccus shengliensis TaxID=660064 RepID=UPI000A05EEC7  ali  22  38...RVKFTSVLAQLTG-ERRVKLDIED---ITLRELIEHLSERYGASFAQRVINNEG-LNEFVNVFVNGESVHHLAGLDTRLEDGDEVTFLPAVSGG................ 126
87 7.000e-21UniRef50_A0A133UA97 Uncharacterized protein n=18 Tax=root TaxID=1 RepID=A0A133UA97_9EURY  ali  15  1MSVEVRFFANFREILGYK-----EIDVSVG-TVRELLERLSDENKELAEKLFKDKEKELNKSVNIMVNGRSTEHLDGIDTELGEGDTVAVFPPVAGG................ 92
88 7.000e-21UniRef50_A0A1H5RAV9 MoaD family protein n=3 Tax=Amycolatopsis TaxID=1813 RepID=A0A1H5RAV9_9PSEU  ali  22  3VRITVLVPGPLRAKTGGESRLEVELD--GAATLGALLDELAQRYPALERR-LRDEQAGLRRYVNFYVDGEECRRLDGSSTALRDRGEVQIIPSVAGG................ 96
89 7.000e-21UniRef50_A0A023X5D9 Molybdopterin converting factor small subunit n=5 Tax=Bacteria TaxID=2 RepID=A0A023X5D9_9ACTN  ali  19  3...KVRIPTPLRQYASGNSEVEV-----AGGTAGEALGNLVEEHPDL-KQHLYTGDGKLRSFVNVYKGDEDIRYLDGPDTSVEEGDELSIIPSIAGGC............... 91
90 8.000e-21UniRef50_D4GVB0 Small archaeal modifier protein 3 n=19 Tax=Halobacteria TaxID=183963 RepID=SAMP3_HALVD  ali  15  1MELELRFFATFREVVGQKS---IYWRVDDDATVGDVLRSLEAEYDGLAGRLI--EDGEVKPHVNVLKNGREVVHLDGMATALDDGDAVSVFPPVAGG................ 92
91 8.000e-21UniRef50_K6QBW1 MoaD family protein n=4 Tax=Firmicutes TaxID=1239 RepID=K6QBW1_9FIRM  ali  18  1MRVEVYIPTPYRSITG-EARLQVE-----ATTVRELLEQLAQRYPDLRPRLF--EGEAIAHHLNVYVNKREIRTLQGADTPLQDGDEVALIPAMAGGSGEP............ 94
92 9.000e-21UniRef50_A0A151BIG1 Molybdenum cofactor biosynthesis protein MoaD n=1 Tax=Candidatus Bathyarchaeota archaeon B26-2 TaxID=1779371 RepID=A0A151BIG1_9AR  ali  18  3.RVKITFYGALVRVTG---EKTVEINC---STLRDAIDALTARYGVQFKNRILDEKGKLRRFINIYINGKDIRFLNHIDTRLKDGDKVSVIPAVGGG................ 92
93 9.000e-21UniRef50_A0A0M0BMG7 Uncharacterized protein n=2 Tax=unclassified Candidatus Bathyarchaeota TaxID=1700837 RepID=A0A0M0BMG7_9ARCH  ali  25  1MKVRVKYFTTLRELAGTK---EDELDLKDGCRLLALIETVALRYGDEAFAYLVADGGRIDPSIRFLVNGVDAQRLAGFETALKAGDVVAIIPPVGGG................ 95
94 9.000e-21UniRef50_X0Y612 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0Y612_9ZZZZ  ali  16  2...TLKIPSPLRTYTDGQAAVQV-----QGETVADALESLVEQHPDL-RQHLFNGQGELRPFVNLYLNSEDIRHLQKLATPIQDEDRLMIVPSIAGGSS.............. 91
95 1.000e-20UniRef50_X1J309 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1J309_9ZZZZ  ali  26  4.RINVQFFATFRDIFGTKA---MEIAVETGTNIGELLNLVFDT--QERRKKIFD-NGKVKPYIIILKNGRHIQHLDGVETELKEGDKVSIFPPIAGG................ 93
96 1.000e-20UniRef50_A0A1M5TMG8 Ubiquitin-like small archaeal modifier protein (SAMP) n=5 Tax=Halobacteria TaxID=183963 RepID=A0A1M5TMG8_9EURY  ali  18  4.....KLFADLAEATG---ESEPEVDAADAATVGEALDALLDAHPALAARVL-DDDGDLRGHINLLRNGRDIREGEGLATPVDEDDELALFPPVSGG................ 91
97 1.000e-20UniRef50_Q5V0P0 Molybdopterin converting factor subunit 1 n=17 Tax=Halobacteria TaxID=183963 RepID=Q5V0P0_HALMA  ali  17  1MQIELRFFANFREAVGQK---TVHREYETDLQAGDVLRQLSEEFTEMD----LFEDGELREYLTILRNGRDIAHLDGLETPLEDGDELSVFPPVAGG................ 90
98 1.000e-20UniRef50_A0A257VHS4 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Solibacteres bacterium 12-62-4 TaxID=1970571 RepID=A0A257VHS4_9BACT  ali  23  3...KILIPTPLRQYAEKNNSVDVS-----GATVGEALASLTTQFPDL-RKNLFNDEGKLRSFVNVYVNDEDIRYLQKDATAIADGDTISIVPSIAGG................ 90
99 1.000e-20UniRef50_A0A0T6A1Y7 Pyridoxal-phosphate (PLP) dependent enzyme family n=2 Tax=Bacteria TaxID=2 RepID=A0A0T6A1Y7_9BACT  ali  12  1MSVQVRVPQIFRRHTGGAKTVVVE-----GMTVRDILENLDKAHPGLRDRLL--DGKELHRFVNIYRNDEDIRFLKFLDTEVQEGDVISILPAVAGGVRVPTR.......... 96
100 1.000e-20UniRef50_A0A1Q7LAY6 Molybdopterin synthase sulfur carrier subunit n=23 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7LAY6_9  ali  20  1MPVTIEIPTAFRRFTDGAPRVD-----CSATTVAEALDALTRRFPDLSR-HVRDDTGQIRQFLNVYLNEEDIRFLGGESCSLKEGDRVLLVPSIAGGSS.............. 93
101 1.000e-20UniRef50_A0A2E4KE07 Molybdopterin synthase sulfur carrier subunit n=10 Tax=Actinobacteria TaxID=201174 RepID=A0A2E4KE07_9ACTN  ali  19  1MTITIRIPTTFRELTKGNSVI-----SSDGSTLNQLLENIKTEYPDFVNRVL-DEEGNLQRFVNIFLDDEDIRFLGKLETKLEDGQTVSIVPAVAGG................ 91
102 1.000e-20UniRef50_K9WTM5 Molybdopterin converting factor, small subunit n=75 Tax=Bacteria TaxID=2 RepID=K9WTM5_9NOST  ali  29  1MAVTVLVPTALQKFTNNQAALE-----CSGGNISELFDSLEQSCPG-IKSRLCDETGKPRRFLNLYVNSEDIRFLEGTETVLKDGDEVSIVPAVAGG................ 91
103 1.000e-20UniRef50_A0A2J6WXH7 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Aciduliprofundum sp. TaxID=2060325 RepID=A0A2J6WXH7_9EURY  ali  22  1..MKVQYFATLRKITGKQEEEI------SAKNVDELLRKILEEYGEPFRNALYDKDG-FRKGVIILKNGKNILYLKNLETELSDSDTVSIFPPVAGG................ 88
104 1.000e-20UniRef50_A0A0P6XDD6 Uncharacterized protein n=2 Tax=Anaerolineaceae TaxID=292628 RepID=A0A0P6XDD6_9CHLR  ali  16  1..MQIKYFATLRDIT-RVSEEHISVPEQ---TLEELIQFLCARYGRSFAKWVSCEDGGFGSLSIFLINGTDYRSLDGLQTRLKDSDVISLFPPIAGG................ 91
105 1.000e-20UniRef50_A0A1F8TEF9 Uncharacterized protein (Fragment) n=1 Tax=Chloroflexi bacterium RBG_19FT_COMBO_62_14 TaxID=1797671 RepID=A0A1F8TEF9_9CHLR  ali  17  4....VRLPTPLRPYAEGRKEVEVE-----GSTVADALGNLARMYPMLT-QHLYDEGGRLRPYVNVFLNEDDVRTLQGEATPIADEDRLMIVPSIAGGSVEARAVRPLR..... 101
106 2.000e-20UniRef50_A0A2V9JGA6 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9JGA6_9BACT  ali  11  1MSVTVRIPTPIRQYTEQQAEVVL-----NGKTVAEVLEQFKARFPE-AGSRFFSSESKASRFVNLYLNDEDIRFLKDLQTPVGDNDTLSIILAIAGGAPCARIHR........ 99
107 2.000e-20UniRef50_A0A1F8QN18 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Bacteria TaxID=2 RepID=A0A1F8QN18_9CHLR  ali  13  1..MQVNFYATLRPIVGQK---TIDVDIPNGATVRELIAAIITAYPAL-RSELLDEKGDLQDHIKFFVNGREVIYLDRIDTVIHPDDIITIFPPVGGG................ 92
108 2.000e-20UniRef50_A0A2E3AZY2 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2E3AZY2_9CHLR  ali  17  7..VYVRIPAPLRSITGQKNKIEINLSQFDDHNVRSILNYVDTQFPG-FKEKIFNTSGELKQFVNIFINGEDARYLDGVETEVNSADEISIVPAVAGG................ 100
109 2.000e-20UniRef50_A0A2V9XK41 Molybdopterin synthase sulfur carrier subunit n=6 Tax=Acidobacteria TaxID=57723 RepID=A0A2V9XK41_9BACT  ali  25  1MTITVQIPTALRRHTSGTGRIT-----CSATNLGELFSVLDQTFPDL-KPHLRDEAGQVRRFLNVYVNEEDIRFLGGPSYAFHDGDEVLLVPSIAGGAPDEHERV........ 99
110 2.000e-20UniRef50_A0A1F7NR03 Molybdopterin synthase sulfur carrier subunit n=11 Tax=Bacteria TaxID=2 RepID=A0A1F7NR03_9BACT  ali  21  1MPILVRIPTPLRAITKGAAEVQ-----ARGDTVDTLVEDLERQCPGL-KERLMDESGELRRFINIYVNEEDIRFLQGKKTALKEGDQVSIVPAIAGG................ 91
111 2.000e-20UniRef50_A0A2W4QMR8 Uncharacterized protein n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4QMR8_9FIRM  ali  13  56..MRIRLYGLLRDAA--ERQTAIDVDVCEGDTVGTLLERLVTKYPR-MRPLLFERPGVLYRHVMIVKNGRDIRDGLGLDTPVQPDDDMAVFPPSAGG................ 147
112 2.000e-20UniRef50_F9VXY3 Sulfur carrier protein CysO n=20 Tax=Bacteria TaxID=2 RepID=F9VXY3_9ACTN  ali  18  1MPVTVSIPTILRTHTGGAKRVE-----GSGATLAALIDDLESGNPGLKERLVAPDEKKLHRFVNVYVNDEDVRFSGGLDTSIDDGDEVTILPAVAGGC............... 96
113 2.000e-20UniRef50_A0A1Y3SHP7 Uncharacterized protein n=3 Tax=Flavonifractor TaxID=946234 RepID=A0A1Y3SHP7_9FIRM  ali  18  1..MTVKFFAYLREFAGTK-----ELTCPPAPTVRALGEALCERFGPKFRAEFFSPTGELGEKIIVMVNGRRVEFLSGLDTPLKDSDTVQIFPVVAGG................ 93
114 2.000e-20UniRef50_A0A2H9LL94 Uncharacterized protein n=2 Tax=unclassified Candidatus Bathyarchaeota TaxID=1700837 RepID=A0A2H9LL94_9ARCH  ali  16  15.HVSVRFFTTLREVTG-KKEETLEFPKGKTVTVDRVLKRLTQRYGREFVEYVYDKTGEVKGFIQFLVNGRSTSSLKGLATRLADGDVLAIIPPVGGG................ 110
115 2.000e-20UniRef50_A0A1F8SQ02 Uncharacterized protein n=3 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1F8SQ02_9CHLR  ali  15  1..MQVKLYASLRQAAGIK---MMDVEVHDGTTIRDVLVEVTRRYPVLVK-FVWKEQGELAEFVHVFVNGENIRHLASLDTPLKAEDHVDIFPPLVGG................ 91
116 2.000e-20UniRef50_Q1D528 ThiS family protein n=15 Tax=Bacteria TaxID=2 RepID=Q1D528_MYXXD  ali  14  3...TLRIPTPMRGFTGNQAEV-----AAPGATVGEVLKNLDARHPGIGGR-VFDERGAVRRYVNVFLNDEDIRALNGLDTPVKDADRITLIPAMAGG................ 90
117 3.000e-20UniRef50_A0A1H6FPB1 MoaD family protein n=6 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1H6FPB1_THEAL  ali  16  3...TIKIPPVLRSSTGGEREIAVD-----GESVREVLEALAARHPA-TRNQLFGEDGELNRYVNVYLNDEDVRVLKGLETPVAADDTVVILPAMAGGA............... 91
118 3.000e-20UniRef50_Q67J87 Molybdopterin converting factor small subunit n=6 Tax=Terrabacteria group TaxID=1783272 RepID=Q67J87_SYMTH  ali  11  1..MQVRLYATLRALAGAAR---VEVPGTPGEPVGDVLRRLVAQCPGLEGQILTPDGAALLPHVQVFIAGRSIRDLQGMATPVPPGADLAVFPPVAGGCG.............. 94
119 3.000e-20UniRef50_D3EQN1 Molybdopterin synthase subunit MoaD n=1 Tax=Atelocyanobacterium thalassa (isolate ALOHA) TaxID=1453429 RepID=D3EQN1_ATETH  ali  26  1MAVKILIPNSLQKYTNNQAILEYTID-----TVNELIRNIETDFPE-IRNHLTDDNGKLHRFLNFYVNNDDIRFLDNRETKLKDGDEVSIISAIAGG................ 91
120 3.000e-20UniRef50_A0A0A1DJA7 Molybdenum cofactor biosynthesis protein MoaD n=31 Tax=Bacteria TaxID=2 RepID=A0A0A1DJA7_NOCSI  ali  26  1MAIEVRIPTILRTYTGGEKAV-----NADGANLSALIDSLEANHPGIKDRLI--DGGDLRRFVNIYINDEDVRFIGSLEAALSDGDQVVILPAVAGGA............... 91
121 3.000e-20UniRef50_C5A2S5 Molybdopterin synthase, small subunit (MoaD) n=31 Tax=Thermococcaceae TaxID=2259 RepID=C5A2S5_THEGJ  ali  15  1MKVTVRYFARYRSLVGKGEE---EVELPEGATVMDLIEKIKEMHPVLRNEVFAEDDD--LADVNVSRNGRYVRF----DETLREGDVVAIFPPVSGG................ 88
122 4.000e-20UniRef50_A0A2H9I158 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Candidatus Bathyarchaeota archaeon B24-2 TaxID=2041147 RepID=A0A2H9I158_9AR  ali  26  16.KVKVLLFAALKELIGKGR---LDLTFDRDLTLKDLMMDLSERYGKKFYNYLFDEYGRFRGYIRFFINEEPVKTSEIGEINLKDGDVVAIIPPVSGG................ 108
123 4.000e-20UniRef50_A0A0T6A1Y5 Molybdopterin biosynthesis protein moeB n=8 Tax=root TaxID=1 RepID=A0A0T6A1Y5_9BACT  ali  22  1MGVKVYIPTPFRSLTRNQATVE-----AEGKTVVRLVEALESAYPG-IRERVLDEQGEIHRHINIYVNDIAVEDLEGKETVLADGDEVALIPAIAGGAIPFTEEQIKR..... 102
124 4.000e-20UniRef50_A0A2E8EEH5 Uncharacterized protein n=3 Tax=unclassified Candidatus Bathyarchaeota TaxID=1700837 RepID=A0A2E8EEH5_9ARCH  ali  18  4VEVEVRYYAMLREAAGTRREK---IMLPEGSNFGDLIGFVVVKYGPLFLRYVFDNEGRERDYLSFMVNGVSVHSREGFSTPLAEGDVVAILPPMGGG................ 97
125 5.000e-20UniRef50_A0A075G2B0 Molybdopterin converting factor family protein (NirA) n=6 Tax=Thaumarchaeota TaxID=651137 RepID=A0A075G2B0_9ARCH  ali  21  3.EVKVLIPAVMSSSTNGERELDID-----GNTVIEVIDELSKKYGEGFKNKVIDNEGKLKPIINVYVNDENIKFLEDLQTKLKDKDEILFLPAVSGG................ 93
126 5.000e-20UniRef50_UPI00037877A4 hypothetical protein n=1 Tax=Nocardiopsis alkaliphila TaxID=225762 RepID=UPI00037877A4  ali  25  166MAIEVRIPTILRNLTDDAKVVE-----GSGADLGELFADLDGKYPGIAERLV--EDGKLRRFINVYLNDEDVRFSGGLEAELSDGDNVTILPAVAGGS............... 256
127 5.000e-20UniRef50_A0A0S8I8V2 Molybdenum cofactor biosynthesis protein MoaD n=13 Tax=Bacteria TaxID=2 RepID=A0A0S8I8V2_9CHLR  ali  15  4....IRIPTPLRPYTDNLKEIEVD-----ASNVGEALDALTERYPTL-RPHLYDESGNLRAYVNIFLQQEDIRNLRGQATPLTGGDRLMIVPSIAGGRSAR............ 94
128 6.000e-20UniRef50_A0A2R6I2R6 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Halobacteriales archaeon QS_4_70_19 TaxID=1919178 RepID=A0A2R6I2R6_9EURY :_  ali  18  7.TVTVEFYGTVRDAIGEKA---VERDVASGTSVGAALQAIARDHPDL-SALLFTSEERLRPHVNISRNGVPVRELDGPETALEPDDTVTVAPSVSGGSGGAR........... 103
129 6.000e-20UniRef50_A0A2V8IMK3 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8IMK3_9BACT  ali  20  4..ITVKIPSPLRPLTAGQAEVKIE-----GATVGEVLQKMNSQF-KGFGDRVLDDGKTVKRFINVFVNEDNIRDKKELDTELKNGDTISILPSIAGG................ 92
130 6.000e-20UniRef50_I0GLN1 MoaD family protein n=3 Tax=Caldiserica TaxID=67814 RepID=I0GLN1_CALEA  ali  20  3.HVKIKMYATIREKF---KEGEVEIDAE---TVIDAIKKMVEKYPIL-RDEVLNENGSLKNDYIYLLNGRNVEFLEKGNTPLKDGDKISIFPPVAGG................ 91
131 7.000e-20UniRef50_A0A0S7BDZ6 Molybdopterin synthase subunit MoaD n=5 Tax=Chloroflexi TaxID=200795 RepID=A0A0S7BDZ6_9CHLR  ali  20  1..MNVRFYATFRALVGAKNA---EFLIPDGTTVRGLLSEIIRRYPSLE-PELLDEKRELHRHVHVLINGRDTYYLQKMETVLEEQDTVDIFPPVAGG................ 92
132 7.000e-20UniRef50_A0A2R7Y0M3 Uncharacterized protein n=1 Tax=Aigarchaeota archaeon NZ13_MG1 TaxID=1980982 RepID=A0A2R7Y0M3_9ARCH  ali  18  3.RVKLIMTSTLAMYLNSERELHLE-----ASSVRELLSQLSERFGDAFRQRVLDENGKPKSFVVLYVNGKNIHFAEGLDTKLNDGDEVLILPAIGGG................ 93
133 7.000e-20UniRef50_A0A250IMH1 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Melittangium boletus DSM 14713 TaxID=1294270 RepID=A0A250IMH1_9DELT  ali  17  3...TVRIPTAMRSLAGNQGEVRV-----AGATVGEVLNNLGRAHPGLGARVL-DDQGAVRRYVNVFLNDEDIRFLKELDTPVADADRLTLIPAMAGG................ 90
134 7.000e-20UniRef50_Q67KC8 Molybdopterin converting factor small subunit n=2 Tax=Symbiobacterium thermophilum TaxID=2734 RepID=Q67KC8_SYMTH  ali  16  3....VKLFGNLRLHGGGSR---VEVDLGGGRTVADLLDRLFALHPALRPHVVTPEGDALLPHVNIMLNGRLIRDLQGLQTPVSEQDSVAIFPPSAGG................ 92
135 7.000e-20UniRef50_A7NKD3 MoaD family protein n=6 Tax=Terrabacteria group TaxID=1783272 RepID=A7NKD3_ROSCS  ali  19  1..MQVNFYATLRPIVGSR---TVHFDVGENLTVQQLIDAVVTRFPKL-RQELLNDEGNLYPHVHVFVNGRDAPYLNGVETLIQAGDTIDIFPAVAGG................ 92
136 8.000e-20UniRef50_A0A218PEC7 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Thermococcus sp. P6 TaxID=122420 RepID=A0A218PEC7_9EURY  ali  17  1..MRVRFYATFRELMGTK-----EVEVHSVKTVGELIEYLSKHYPEIKKELLETERVNEQKPVMILVNGHNVLHLKGLETELKDDDVVHIFPPAGGG................ 93
137 8.000e-20UniRef50_A0A2H5V1X5 Sulfur carrier protein CysO n=1 Tax=archaeon HR02 TaxID=2035438 RepID=A0A2H5V1X5_9ARCH  ali  21  58.KVRVTVTAVLANYLGGQRDFIVEAD-----SVRAVIEELAKKYGSEIRRRLFDEEGRLRRYINIYVNDRGLSH-QELDMRLQDGDEVLILPAVSGG................ 147
138 8.000e-20UniRef50_A0A101DWV4 MoaD family protein n=2 Tax=Euryarchaeota TaxID=28890 RepID=A0A101DWV4_9EURY  ali  22  3...RVKFTSVLAQLTG-ERRVKLDIED---ITLRELIEHLSERYGASFAQRVINNEG-LNEFVNVFVNGESVHHLAGLDTRLEDGDEVTFLPAVSGG................ 91
139 9.000e-20UniRef50_A0A2H0LMT4 Molybdenum cofactor biosynthesis protein MoeB n=15 Tax=Bacteria TaxID=2 RepID=A0A2H0LMT4_9BACT  ali  22  1MTVTVLVPTALQSMTGNQESLKL-----QGKTVGEVLSDLTSKYPDL-KKHLFNEKGDLRSFVNLYVNDEDIRYQDQGNTVLNEGDTLTIVPSIAGGAKGLSNDEIKR..... 102
140 9.000e-20UniRef50_A0A239IWG2 Molybdopterin synthase subunit MoaD n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A239IWG2_9ACTN  ali  19  1MSVEVLLPGVLADLAGGRRRLRVD---PPPATVAGLLDALAAEHPVLERR-IRDESGALRRFVNVYVDGDDVRFAAGVHTAVRDGAVVEVLPSVAGG................ 93
141 9.000e-20UniRef50_T0N522 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=T0N522_9EURY  ali  20  2..ITVKYYANLRQITGM-KEDSMDYE---EATVGEVVDSLCHRYGEPFRKLML-EDGKLRGNVIILINGVNVIFGKGLQEVIKSGDSVDIFPPVAGG................ 91
142 1.000e-19UniRef50_A0A1G0SUI8 Uncharacterized protein n=1 Tax=Ignavibacteria bacterium RIFCSPLOWO2_12_FULL_56_21 TaxID=1798438 RepID=A0A1G0SUI8_9BACT  ali  18  1MMVTVRLPGSLRSFAGNKSECSMD-----GATVDEVLQNLTKQYAGL-RFQLYAESGELRRFVNIFVNKDDIRGLHAGHTNVRTGDVISIIPSIAGG................ 91
143 1.000e-19UniRef50_A0A1D7QUM3 Molybdopterin converting factor subunit 1 n=2 Tax=Bacillus beveridgei TaxID=632773 RepID=A0A1D7QUM3_9BACI  ali  15  1MEKEFKVFATFREICDGK---TVKIPYEANEPIGQLLDKLIDRFPQ-MGEELFTDDKVIRQHVHVFVNGRNVIHLDGLRTTVKPEDELALFPPVAGG................ 93
144 1.000e-19UniRef50_A0A2H3P1E5 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A2H3P1E5_9BACT  ali  16  5.TVTLHIPTPLRSATDDQATV-----NATGDTVRTALQNLVERYPDL-KSNLYNDDGALRQFVNIYVDDEDIRYLDGPDTALTDGADVSIVPSIAGG................ 94
145 1.000e-19UniRef50_A0A2E6ESA0 Molybdopterin synthase sulfur carrier subunit n=21 Tax=Bacteria TaxID=2 RepID=A0A2E6ESA0_9RICK  ali  17  1MSVDIRIPTALRSFTGGEARVSV-----NGGTVAEALEQLLSEHSGLAR-HLRDEQGKLRSFVNIYLGDEDIRTREGEQTVLSEGDVLMIVPSIAGGC............... 92
146 1.000e-19UniRef50_I6TVI3 Molybdopterin converting factor subunit 1 n=16 Tax=Thermococcales TaxID=2258 RepID=I6TVI3_9EURY  ali  14  2VKVKVKYFARFRQLAG---VDEEEIELPEGARVRDLIEEIKKRH-EKFKEEVFGEGYDEDADVNIAVNGRYVSW----DEELKDGDVVGVFPPVSGG................ 90
147 1.000e-19UniRef50_A0A1I2ETB5 Molybdopterin converting factor, small subunit n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1I2ETB5_9ACTN  ali  23  1MTVQVVLPGALASLAGGQRHLDLD---PAGGTLADVLDALCAAHPLLGRR-IRDETGRVRRFVNVYVDGDDVRYGGGLTAPVREGAEVQVLPSVAGG................ 93
148 1.000e-19UniRef50_A0A139CM62 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Methanohalophilus TaxID=2175 RepID=A0A139CM62_9EURY  ali  16  54...KVKLFANVRERAGT-SEVEV-----NGDTVSEILDEIIAKYPNLE-ELIFEDGKKLRGYISILINGENIQHIEGTDSAITDKDEVAIFPPVSGG................ 140
149 1.000e-19UniRef50_A0A2E9TBL3 Molybdopterin synthase sulfur carrier subunit n=382 Tax=root TaxID=1 RepID=A0A2E9TBL3_9CHLR  ali  19  1MTVMVRIPTPLRRLTDNADRVEV-----KADTLQGVVDALDTAH-TGIKARICGEDGEIRHFVNVYVNGEDVRYLDGLNTPTKSGDEISIVPAVAGG................ 91
150 2.000e-19UniRef50_A0A2H5ZFG9 Putative adenylyltransferase/sulfurtransferase MoeZ n=12 Tax=Bacteria TaxID=2 RepID=A0A2H5ZFG9_9BACT  ali  19  1MTVSVYIPTLFRHLVGNRVHVQ-----ARGRTVRDVLVDLDRQFPG-FRQQLFGPEGRLAAHINVYVNQVEIGTLQGEETPVREGDEVAVIPALAGGAVALTPEMVER..... 102
151 2.000e-19UniRef50_A0A1H6ILE9 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Halopenitus malekzadehii TaxID=1267564 RepID=A0A1H6ILE9_9EURY  ali  14  1MELELRFFATFREAAGSKTVHY-EVDGDDVI-VGDVLAALEEDYEGMRGRLI--EDGALAPQINVLKNGREVLHIQGLETPLSAGDTLSIFPPVAGGIDEVPE.......... 99
152 2.000e-19UniRef50_A0A2E5PSS3 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E5PSS3_9DELT  ali  22  1MTVIVEMPSALRQFADNLDEL-----SSEEKKVEEVFKELCQRFPEL-KQNLYEDEGSIRNFINIYVNDEDIRYGEGMQTQLKDGDRIQIVPSIAGGISLKI........... 96
153 2.000e-19UniRef50_A0A2N2LLW0 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Chloroflexi bacterium HGW-Chloroflexi-9 TaxID=2013732 RepID=A0A2N2LLW0_9CHL  ali  16  1MPVSVYIPSPFRRITAMHERVQVE-----GATVGEVLDAVEALYPG-FADLVYDSDRHVPTHINVYLNNQEIHELAGVDTPVSEGDQVAVIPALAGGAGGR............ 95
154 2.000e-19UniRef50_A0A1V4C297 Molybdopterin synthase sulfur carrier subunit n=51 Tax=Halobacteria TaxID=183963 RepID=A0A1V4C297_9EURY  ali  15  1MNVELRFFATFRQAVGGK---IVEREFPEGTTIGDVLRELEEEYDDLEGQLI--EDGDLRPHINVLKSGREALHLDGMDTELGDGDRLSIFPPVAGG................ 92
155 2.000e-19UniRef50_A0A147JSD0 Uncharacterized protein n=12 Tax=root TaxID=1 RepID=A0A147JSD0_9EURY  ali  15  1MEVVIKLHGDIREKAGTD---TVKLPINENETVDTLLIRLSKRHPVVIEAILDPTTGELKPYFNILLNGRRIQQLRGIHTKLKDRDEIAIFPPVAGG................ 94
156 2.000e-19UniRef50_P0A647 Sulfur carrier protein CysO n=1182 Tax=root TaxID=1 RepID=CYSO_MYCBO  ali  19  1MNVTVSIPTILRPHTGGQKSV-----SASGDTLGAVISDLEANYSGISERLMDPSSGKLHRFVNIYVNDEDVRFSGGLATAIADGDSVTILPAVAGG................ 93
157 2.000e-19UniRef50_A0A1Y5P1C7 Sulfur carrier protein CysO n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1Y5P1C7_9MYCO  ali  18  1MSVEVSIPTILRSHTGGEKRVT-----ADGATLQALIADLEANYSGISERLV--DSGKLNRFVNIYVNDEDVRFSGGLDTEIGDGDSVTILPAVAGG................ 90
158 2.000e-19UniRef50_A0A177PVS8 Thiamine biosynthesis protein ThiF n=4 Tax=Bacteria TaxID=2 RepID=A0A177PVS8_9BACT  ali  20  7MSITVYIPTPFRHLVGNKANVR-----ARGDTVSDIFLDLDRQFPG-FRDQLLDGTGQLAQHINVYVNQVGIENLQGERTILKSGDEVAVIPALAGGATLTPEMV........ 105
159 2.000e-19UniRef50_G7WND4 Molybdopterin synthase subunit MoaD n=6 Tax=Methanothrix TaxID=2222 RepID=G7WND4_METH6  ali  26  1MLIRIKAFARYRALLGSESEVKL----AEGAAVSDLLESLASRSGEL-RGQLFDDSGRVREDLNVMVNGRHFLSLAGEETPLAEGDEVALFPAVVGG................ 92
160 2.000e-19UniRef50_A0A1H8S721 Adenylyltransferase and sulfurtransferase n=126 Tax=Bacteria TaxID=2 RepID=A0A1H8S721_9BACL  ali  15  1MTVSLLIPTALRSFTDGLSEIGVE-----AATVEEALAVLTEQFVDL-RRHLFNDQGQLRSYVNIYVNEEDIRQKNGLQTALSDGDDVMLVPSIAGGSPTETE.......... 97
161 3.000e-19UniRef50_A0A151AYW1 Sulfur carrier protein CysO n=7 Tax=Moorella TaxID=44260 RepID=A0A151AYW1_9THEO  ali  21  1..MEVELLSFLQRAAG---ESRVDVE---ATTVEQLLAALISRYGETFRRELMTPEGKLKAGIAILVNGRNINFLKGLATPLSPRDKVTIIPPAAGG................ 89
162 3.000e-19UniRef50_A0A1I4QX34 Molybdopterin synthase subunit MoaD n=3 Tax=Euryarchaeota TaxID=28890 RepID=A0A1I4QX34_9EURY  ali  15  3.NVNVKLFANLREIA-QTSSLSIT-----GDTVKDVLLSLTEQYPPLKELIFESGDEKLCGYINVFLNGNNIKHMEGMDTVLNDGDEMGVFPPVSGG................ 93
163 3.000e-19UniRef50_F4BV73 MoaD family protein n=9 Tax=root TaxID=1 RepID=F4BV73_METSG  ali  17  1MLVKVRAFAQFREILGK----EMDMNIPEGSTVLSLLRSIGASSPA-FREQAFSGSGGPNDYILLMINRKRIDPLNDLSIPLNDGDELAILPPVAGG................ 92
164 3.000e-19UniRef50_UPI00036EC533 MoaD family protein n=1 Tax=Methanomassiliicoccus luminyensis TaxID=1080712 RepID=UPI00036EC533  ali  18  1MKVNVKLFGHFRNIANSK---EVDVD-ARGHTVNDVVSALVERFPELGPAVL--ENDQVRPYVNLFLNGKNIKELNGLATGIKEGDGIVLFPPMAGG................ 91
165 3.000e-19UniRef50_D7BXQ5 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=D7BXQ5_STRBB  ali  23  1MAIEVRIPTILRTYTDGQKAVQ-----GSGNTIAELFADLETRHTGIQARLVND--GELRRFVNVYLNDEDVRFLDGVTTKLTDGDSVTILPAVAGG................ 90
166 3.000e-19UniRef50_UPI0008376906 MoaD/ThiS family protein n=1 Tax=Actinomadura kijaniata TaxID=46161 RepID=UPI0008376906  ali  23  1MTVTVRLPGALRDIAGARPAVPLEV--PGNATVGDLLDALAAVLPAVERR-VRDERGVLRPHVNVFVGAANIRDLALLATPLVPDAEVYILPSVSGG................ 94
167 3.000e-19UniRef50_L0HKT9 MoaD family protein n=2 Tax=unclassified Euryarchaeota TaxID=33867 RepID=L0HKT9_ACIS0  ali  14  2..IRVRYFATLRDITGRREEFFEDVP-----TIRTLLTLLYKKYGDTFRREI-------ESRNMILVNGKNILDMNGYETEISDGDEISIFPPVGGG................ 84
168 3.000e-19UniRef50_A0A2V8VFF3 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8VFF3_9BACT  ali  12  1MPLTFLIPGPLRSFAAGKSQIVIE---QSPATLADALQALWKLYPG-IRDRVATEQGQIREHINIFVGIEDVRYTGGLQTPIRDGAEITIIPAISGGS............... 94
169 3.000e-19UniRef50_A0A2V9KP00 Uncharacterized protein n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9KP00_9BACT  ali  16  4...TIHIPGALRPFAGGRSQVKIE---TSETTLRNALEALWTLYPG-IRDRVVTEQGEIREHINVFVGDEDVRYTGGLATPLPAGAEISIVPAISGGEEGTK........... 98
170 3.000e-19UniRef50_U1PMB6 MoaD family protein, archaeal n=1 Tax=Haloquadratum walsbyi J07HQW1 TaxID=1238424 RepID=U1PMB6_9EURY  ali  15  10...TLRFFATFRDAVGTK---TIDREY-DATTVGEVLTAIESEFDDLSGEIIADD--AVRPQVNVLLNGRDIDHESGIETPVNSNDTVSIFPPVAGGAPA............. 100
171 4.000e-19UniRef50_A0A135VEC0 Uncharacterized protein n=4 Tax=Candidatus Thorarchaeota TaxID=1706441 RepID=A0A135VEC0_9ARCH  ali  18  3.QVLVKFFATVREITG-VKSVELEAE-----NIKELLQLLVQTYGSKFKDVLNNDTGELKQFFSCMVNGKRIELLSGYETILKDNDAVALFPPVGGG................ 93
172 4.000e-19UniRef50_A0A250AYZ8 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A250AYZ8_9ENTR  ali  20  1MAATLLIPTALRAFTDGQGKVSLE-----GETVGQLVAALATRYP-DIHQHLYEDDGSLRSFINLYVGETNIKTTGGLDTPVKNGDDVILVPAIAGGAGAR............ 95
173 4.000e-19UniRef50_X1M6D9 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1M6D9_9ZZZZ  ali  19  1MKIKVKFFATFREVFSGEVK---EIELDNRSNVQDLLNLLCDS--PQRSQEIFDDSGNIKRYVRVLKNGRRVQFLDGLRTELGEGDVVAMFPP.................... 88
174 4.000e-19UniRef50_A0A2V7XPL0 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2V7XPL0_9BACT  ali  13  43VSVTIAIPAPLRPLAEGLRQVTLD---PAPATVGEALAALWARHPAL-RDRIVDEQGRVRPHVNVFVGSDSVRDSGGLKARVPDGSEIAIIAAVSGGATTA............ 139
175 4.000e-19UniRef50_A0A1F2T3P3 Uncharacterized protein n=13 Tax=Bacteria TaxID=2 RepID=A0A1F2T3P3_9BACT  ali  22  8.TITVYLPGPLRAYSGGATQLVI-----PARTVRAALAHLEQSQAALYRN-ICDETGAVRRHLNIFVNADNMRDLSGVDTPLAAGDEVTIVPAVSGG................ 97
176 4.000e-19UniRef50_A0A1I8G7D7 Ubiquitin-related modifier 1 homolog n=8 Tax=Eumetazoa TaxID=6072 RepID=A0A1I8G7D7_9PLAT  ali  39  1MKLTLEFGGGAEFLVGNVKKHAIDLPDTQQWTLGQLLEWIKANKLQE-RPELFLQGSSVRPGILVLVNDTDWELLGELSYQLKDNDDVVFISTLHGG................ 96
177 4.000e-19UniRef50_Q74EQ4 MoaD family protein n=5 Tax=Desulfuromonadales TaxID=69541 RepID=Q74EQ4_GEOSL  ali  23  2..VSVRFYSLLRLMLGRE---VVELPWEAGETVRSLVQRAEQAVGSPLSRKLLDGDGVLHTGTIILVNRRNIHHLEGLETPIRDGDTVALFPPGAGG................ 93
178 5.000e-19UniRef50_A0A2H5Z304 Molybdopterin synthase sulfur carrier subunit n=16 Tax=Bacteria TaxID=2 RepID=A0A2H5Z304_9BACT  ali  16  1MRVTVRYFAVVREFLGQDHE---EHELPEGTTVGQFLEDLIARQPILER---------LRRSMLVMVNRRYAR----PDQLLSDGDEVALIPPVSGGSTP............. 84
179 5.000e-19UniRef50_A0A160VVH3 Molybdenum cofactor biosynthesis protein MoaD n=11 Tax=Archaea TaxID=2157 RepID=A0A160VVH3_9EURY  ali  23  3.KVTVKVFATLIEIIGKR------ILEEEASTVKELLEKIYEKYPKVKEE--------LEEGYIILVNGHNIEHLQGLETPLKEGDTVSIFPPAGGG................ 84
180 5.000e-19UniRef50_A0A2A2Q8Q3 Molybdopterin synthase sulfur carrier subunit n=69 Tax=Bacteria TaxID=2 RepID=A0A2A2Q8Q3_9BACT  ali  21  1MAISVSIPTPLRALTGQKDTVEVE-----AKDVQAMLASLEKSFPGIQDR-LVDEKGEVRRFVNIYVGGEDIRFLQNQQTPLKAGDEVSIVPAIAGG................ 91
181 5.000e-19UniRef50_A0A257RSQ4 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A257RSQ4_9ACTN  ali  23  1MSVIVRLPSQLRSLVGGAGEVPVE-----ATTVRDAIVAVDEAYPGIAFRVL-DDRGALRRFVNVFVADEDVRFLQGLDTVLEAGQTVSLVPAVAGG................ 91
182 6.000e-19UniRef50_A0A2N5KEB7 Uncharacterized protein (Fragment) n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2N5KEB7_9CHLR  ali  15  3...KIEIPTALRPYTSGRRDVEVD-----GHSVDEALVALTQRFPEL-RTRLFDQHGHLGKFINIYLNEDDVRYLHGLATPVQDNDVLSIIPALAGG................ 90
183 6.000e-19UniRef50_A0A2H5V0S2 Uncharacterized protein n=1 Tax=archaeon HR02 TaxID=2035438 RepID=A0A2H5V0S2_9ARCH  ali  16  2ITVKTKYYAYLRELTGIREE---EITLSEGATVLTLIEYLVKKYGASFKSYILADNMGLKPSIVIAINGVKISD-DPLNRRLRDGDTLVILPPISGG................ 94
184 6.000e-19UniRef50_A0A1B6A5S7 ThiS family protein n=2 Tax=Tepidibacillus TaxID=1494427 RepID=A0A1B6A5S7_9BACI  ali  12  1..MQIQLFATYRDIVNAK---TVDVPVTESTTIKELLQSLINLFPAFQKELFLDETQSLKPHVHIFVNGRNIIHLQGLNTPFTFKDEIALIPPVGGG................ 94
185 6.000e-19UniRef50_I4BVC1 MoaD family protein n=3 Tax=Acetomicrobium TaxID=49894 RepID=I4BVC1_ACEMN  ali  20  1..MIVRFYASLRDVTGTK-----EARIAGCKTVGELLKRMCDKYGKAFEDLLLRD-GSLIVGVMVLVNGTHIAHLQGLDTPLSDDCVVDVFPPVAGG................ 89
186 6.000e-19UniRef50_A0A1H0E0D4 ThiS family protein n=2 Tax=Paenibacillaceae TaxID=186822 RepID=A0A1H0E0D4_9BACL  ali  20  1MHITVSIPSLLRDCTGGHVKFQLE-----ALTLEEALDQLQTRYP-LLRVHLWTETGHVRKHVLLYYNDTNIAWLDTLEIVLQPGDQLIVFQAVSGG................ 91
187 6.000e-19UniRef50_A0A2W4TFN2 Molybdopterin converting factor subunit 1 n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2W4TFN2_9BACT  ali  15  1MRVTVQFFARLRELAGCSS---WTCEIADGATVADVWQAAEQQFPAIA---------AMAGRVSCAVN----ADFGRMNAVVHDGDEVAFLPPVSGGSATER........... 86
188 9.000e-19UniRef50_A0A1V5I8V6 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Synergistetes bacterium ADurb.BinA166 TaxID=1852916 RepID=A0A1V5I8V6_9BACT  ali  17  2..IKVLFFASIRERT-MEKETEVE---GAPATMEALLRLLCTRYGPDFEAEVFD-GGSLSSRLIILVNGRHIAHTGGPGTPLRDGDTVAVFPLIGGG................ 91
189 9.000e-19UniRef50_A0A0N4VF19 Ubiquitin-related modifier 1 homolog n=1 Tax=Enterobius vermicularis TaxID=51028 RepID=A0A0N4VF19_ENTVE  ali  37  88VHLNLEFSGGSEIVVGKKKFHQIDLPSDPSITIRDLIQWMMSSLIEKDKAYLLVANDTVRPGVLVLVNDVDWEVLSGVDTTLKEGDTVTFLSTIHGG................ 184
190 9.000e-19UniRef50_A0A1J5A4I6 Uncharacterized protein n=1 Tax=Anaerolineae bacterium CG2_30_64_16 TaxID=1805005 RepID=A0A1J5A4I6_9CHLR  ali  13  1..MQIRAYATLRDIMG---RSTIEMAVGAGTTAGQVLARLSAGHPGL-REKLWDADGQLTGFVTVLLNGRALEYLNGLDTLVADDDTMSLFPPVGGG................ 91
191 9.000e-19UniRef50_X5LGY9 Putative antigen Cfp10A n=14 Tax=Actinobacteria TaxID=201174 RepID=X5LGY9_9MYCO  ali  18  6.SVTVSIPTILRPHTDGQKRVT-----ASGDTLQAVIADLESNYSGISDRLV--DNGKLHRFVNIYVNDEDVRFSGGLDTTIADGDSVTILPAVAGGA............... 95
192 9.000e-19UniRef50_G2MG21 MoaD family protein n=2 Tax=Archaea TaxID=2157 RepID=G2MG21_9EURY  ali  16  1MELSLKFFANFREAVG---EKTVTREFDDGATAGEVLAALEAEF----ADLNLLEDGDLRPQINVLRNGRGVVHMDGVDTVLEAGDTLSIFPPVAGGTD.............. 92
193 1.000e-18UniRef50_I0I9D1 Uncharacterized protein n=2 Tax=Chloroflexi TaxID=200795 RepID=I0I9D1_CALAS  ali  17  1..MNVRVYATLRPIVGGK---EAQLTTGAGDTFRQMIEEMITRWPELKRE-FFDSNGELRSNIHIFLNGRDVRYLGGLDTTIPENADVCIFPPVGGG................ 91
194 1.000e-18UniRef50_I0I899 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Caldilinea TaxID=233191 RepID=I0I899_CALAS  ali  19  1MQIQVRLFATLRQLAGWSQQ---TIEVPEGTTLEQALAIIDERFPALT---------ISKRTFYAAVNQEYAKG----DQVLHAGDEVAIFPPVSGGSTAGSSFR........ 89
195 1.000e-18UniRef50_A0A2H6IQ20 Sulfur carrier protein CysO n=16 Tax=Bacteria TaxID=2 RepID=A0A2H6IQ20_9BACT  ali  24  1MAVKVKIPVPLQRLTQGKEEVE-----GAAGTIISLVNDLDQQYPGLAERI--SENGKLRRFVNIYVNEEDVRFMKNEETEVKDGDEISIVPAIAGG................ 90
196 1.000e-18UniRef50_Q5JE16 Molybdopterin converting factor, subunit 1 n=28 Tax=cellular organisms TaxID=131567 RepID=Q5JE16_THEKO  ali  25  3....VKLFATLIEFTGKRK-----LEISGPKTVRELLNELDRMFPGFKKE--------LEQGYIILVNGKNIEHLQGLDTPLKEDDTVSIFPPAGGG................ 82
197 1.000e-18UniRef50_A0A1F2WUT2 Uncharacterized protein n=1 Tax=Actinobacteria bacterium RBG_13_55_18 TaxID=1797197 RepID=A0A1F2WUT2_9ACTN  ali  17  6..VTVKFFATLRKATGVKSYE------SSAASVGAVLKEIEKGYGEDAHRHM--------KNCNILVNGRNIGYLKGKRTRLNDGDEVSIFPPLAGG................ 86
198 1.000e-18UniRef50_UPI0009F8481D molybdopterin synthase sulfur carrier subunit n=1 Tax=Nitriliruptor alkaliphilus TaxID=427918 RepID=UPI0009F8481D  ali  15  3...TVRIPTVLRKHTGGDAKVQ-----ADGATVGEVFGGLVSQHPTIEDSLF--EDGALRGFINVYVDDEDVRYLDGLDSKVEPNAEISIMPAVAGGAE.............. 91
199 1.000e-18UniRef50_A0A101IXK9 MoaD family protein n=2 Tax=Methanomicrobiales TaxID=2191 RepID=A0A101IXK9_9EURY  ali  23  1MMITIRAFARFREILGS----ETTGEVPEGTTLAALIEEIARKNPK-MKASLYDDDGTMRRYIILMQNKKRVNHSEVESIILNDGDEIALYPPVAGG................ 92
200 1.000e-18UniRef50_A0A1F3BHX4 Uncharacterized protein n=1 Tax=archaeon RBG_16_50_20 TaxID=1797286 RepID=A0A1F3BHX4_9ARCH  ali  16  1MKIKIQYFAIIRELVGQREEV---IDLEKKTNVLDLLKLLATKHGEKFMQYIFDPTGNPRLYLQFLINQESISSLSGFSTILPENSTFAIIPPVGGG................ 95
201 1.000e-18UniRef50_A0A2A5CKI7 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Moraxellaceae bacterium TaxID=1889775 RepID=A0A2A5CKI7_9GAMM  ali  19  1MNITIRIPSPLRRFTEQAAQIEL-----NANTVGEALMALNAQYPDLQ-TQLMDEQGKLRNFVNIFHNKIDIKQLQGMESTLDEGSELRIVPAIAGG................ 91
202 1.000e-18UniRef50_H2J861 MoaD family protein n=2 Tax=Marinitoga TaxID=160798 RepID=H2J861_MARPK  ali  22  1MKVEIKFFATLRLHL---RVASLSLDLNENTTVNELIDILVKHFNDEKVREYLIDENGIRKGTMILINGKNILHLNGLDTKIEEG-VISIFPPAGGG................ 93
203 1.000e-18UniRef50_A0A2N2BUD8 Uncharacterized protein n=3 Tax=Firmicutes TaxID=1239 RepID=A0A2N2BUD8_9FIRM  ali  25  2MTVEITTIMGLKALMGGNKDQSLTL--PDGATVAAALDQLGKIYGPALQQRIFNDTHQLNPGIAVFVNGCVIFARLGLETPLQDGDAVLIFPPVGGG................ 96
204 2.000e-18UniRef50_Q08Z53 ThiS family protein n=2 Tax=Stigmatella aurantiaca (strain DW4/3-1) TaxID=378806 RepID=Q08Z53_STIAD  ali  17  224...KVHIPTPLRGFTRNKGEVQ-----AQGATVGEVLRDLEKRFPGIGSRLL-DGKGALRRYVNIFHNDEDIRGLQDLETPVKDSDRLTLISAMAGG................ 311
205 2.000e-18UniRef50_A0A1G1EGH1 Uncharacterized protein n=1 Tax=Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22 TaxID=1801687 RepID=A0A1G1EGH1_9BACT  ali  21  2IRIKVRPFFQLKEIL---KEKELTIELTPDSTVLDAIEELTKRLSPSFKDAVIDKNGKVRSYYRVLLGGRDLHQLDDLNTKLCDGDIISFFPPVAGG................ 96
206 2.000e-18UniRef50_A0A1F5DCA1 Uncharacterized protein n=1 Tax=Candidatus Bathyarchaeota archaeon RBG_13_38_9 TaxID=1797377 RepID=A0A1F5DCA1_9ARCH  ali  14  1MKTKARYFAAVREITGKQEE---TFEVPDKTTVKDLLLILSDKYGQSLRDYIFISGEEPVSHLNFLLDGNNVSLMNGMKTALYEGCTFAIIPPVGGGSAE............. 98
207 2.000e-18UniRef50_A0A0S7BK64 MoaD family protein, archaeal n=1 Tax=Longilinea arvoryzae TaxID=360412 RepID=A0A0S7BK64_9CHLR  ali  20  1..MKIRCYAYFRDILGSSSFDY----DRTANSLGALLDDFSTRYGQPFRKWVYEPDGKTFSHVIILINGKDARDLQGLDTPLSPNDTVVLFPPLAGG................ 92
208 2.000e-18UniRef50_A0A2V8UAD0 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8UAD0_9BACT  ali  20  146.TITIHVPGPLRPYCAGAAQLSIS-----AHTVRAALEDLQRSHSALYRN-VCDETGTVRRHLNVFVNSDNVRDLDGVDTTLTPGDVLTILPAVSGG................ 235
209 2.000e-18UniRef50_A0A1H9PCV4 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacillaceae TaxID=186817 RepID=A0A1H9PCV4_9BACI  ali  14  1MK-TMKVFANFRDICGGK---TVNVAYEENETIGVILEDLIARFPE-MEEELFENGRTIRQHVHVFVNGKNVIHLDGLDTVVYPQDELALFPPVAGG................ 92
210 2.000e-18UniRef50_A0A1D2WCQ3 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Methanobacteriales TaxID=2158 RepID=A0A1D2WCQ3_9EURY  ali  24  2..VNVKFLARFRDITGKRS-----VSIEHNGSISDLMNTLTEKYGNEFKDALFDKKGNLRDYMKIIVNGEDVESNGGLESNVENNDEVVIFQTIAGG................ 91
211 2.000e-18UniRef50_V6M9H7 Molybdenum biosynthesis protein MoaD n=6 Tax=Bacillales TaxID=1385 RepID=V6M9H7_9BACL  ali  13  1..MKVKVFANFREICQGNS---VEVPLDNGDRVIDIMETLIQMYPALEDE-VFTAERTFKPFVHVFLNGQNIIHAQGLQTRVKEDDQFALFPPVAGG................ 91
212 2.000e-18UniRef50_A0A1V4YZ14 Small archaeal modifier protein 1 n=2 Tax=Methanomicrobia TaxID=224756 RepID=A0A1V4YZ14_9EURY  ali  16  4MMIRFRLFANFREAA---KQKDVDVAVSGGNTISDAIKALLARYPAMEPMMF--QDGRLKQYVNVLLNGQTVKGEQIASMTVKDGDEIALFPPVSGG................ 95
213 2.000e-18UniRef50_A0A1H6IJZ7 MoaD family protein n=9 Tax=Halobacteria TaxID=183963 RepID=A0A1H6IJZ7_9EURY  ali  17  1MQVECRFFGPFREEVG-ERSVEIT---TDAETYGDLLAELEDRYPGLSGRLIAD--GSLVGEIAVTRNRKNIRHLEGPDTRLTDGDVVRLTPSVYGGC............... 92
214 2.000e-18UniRef50_A0A2P8AY83 Sulfur carrier protein CysO n=25 Tax=Bacteria TaxID=2 RepID=A0A2P8AY83_9ACTN  ali  18  2..VTVLLPGPLRPEAGGESRLTV----AAAGTLRAVLDEVASGWPRLDRR-IRDERGELRRYVNVYVDGEDCRHAGGLAAPVSDGAEVQILPSVAGG................ 91
215 2.000e-18UniRef50_A0A2E7MR48 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2E7MR48_9ACTN  ali  16  1MAVTIRIPTTLRILTSGEAEV-----SAKEGTVSQIIDXICESYPDFQGRLI-DEDGNLLRFVNIYVEDEDIRFLKALETSVTDGQTISIIPAVAGG-----RXSIFRKDLF. 101
216 2.000e-18UniRef50_A0A2N2NHW7 Uncharacterized protein n=2 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A2N2NHW7_9CHLR  ali  25  1MQISLHFFATYRNLFG---ERSVELEVAPQTSVRMAIDQFLETH-HHMRRHWCDQEGNLMPHLIVILNKLDVSSLDGEDTILQPGDELDFVPPVGGG................ 94
217 3.000e-18UniRef50_I7L0V9 Molybdenum cofactor biosynthesis protein D n=15 Tax=Methanomicrobiales TaxID=2191 RepID=I7L0V9_METBM  ali  23  1MQIRVRAFARLREAIGG----DLTLEVPRGATMAGLLAAVGEVSGE-AHKALFGKNGELQGYVILMHNGRRVRRAEVETLALADGDEVALFPPVAGG................ 92
218 3.000e-18UniRef50_A0A1Q7LEI7 A/G-specific adenine glycosylase n=3 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7LEI7_9BACT  ali  10  1MPVTFHIPGTLREFTDGRNTIEIE---QSPATLADALSALWKLYPR-VRDRMATEQGQIREHVNLFIGDENVRYTGGLASPIAAGSEIWIIPAISGG................ 93
219 3.000e-18UniRef50_A0A2E8EGI2 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Candidatus Bathyarchaeota archaeon TaxID=2026714 RepID=A0A2E8EGI2_9ARCH  ali  29  11..VSVELAGELTRIAGEKRVLV------EACLLGQVLDTLASGHGEEFRDRLFDSGGQPRRFINIYVNGRDYRFLDKLDTVLHEGDVVALFPAVSGG................ 99
220 3.000e-18UniRef50_A0A2V8KW88 Molybdopterin converting factor subunit 1 n=10 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A2V8KW88_9BACT  ali  16  1MQVKLLFFASLKDIVGSR---QLLLDLPHGATIEDVLARLEASYPRIRD---------YRPVVLTAINEEYVDQR----TPIHDGDEVAIFPPVSGGEVDSVPTAISR..... 92
221 3.000e-18UniRef50_A0A177PUF6 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A177PUF6_9BACT  ali  16  8.TIQVRVTSVLQKLTDGKKTIE-----GSGATVSAVLDDIETRHPG-FKAQMYGPDGKLHRFVNIYLNDEDIRYTGGVDTSLKQGDVLDILPALAGG................ 97
222 3.000e-18UniRef50_A0A1F4DGE0 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Betaproteobacteria TaxID=28216 RepID=A0A1F4DGE0_9PROT  ali  14  1MKITVRIPTPLRAYTHGADEVR-----AEGATVADAMRALGDAYDGLLAQVL-TEDGEPRQFVNIYLGSRNVRALQGMRTPVAEGDVISIVPAVAGG................ 92
223 3.000e-18UniRef50_A0A1L7F368 Molybdopterin synthase subunit MoaD n=62 Tax=Bacteria TaxID=2 RepID=A0A1L7F368_9PSEU  ali  18  1MAVTVSIPTILRTHTEGEKSVP-----ADGATLQEIIDDLDNRYSGLKGRLV--KEGALHRFVNVYVNDEDVRFSGGLGAAVKDGDNITILPAVAGG................ 90
224 4.000e-18UniRef50_A0A2H6IDB8 Sulfur carrier protein CysO n=3 Tax=Bacteria TaxID=2 RepID=A0A2H6IDB8_9BACT  ali  22  1MAVKVRIPTPLQRLTDGQEVVE-----GKPGKIIEMIQDLDSRYPGLAERV--SEGGKIRRFVNIYLNEEDIRFLKAEETEVKDGDEVSIVPAIAGGRGELMKRRV....... 99
225 4.000e-18UniRef50_A0A1Q6DW96 Molybdopterin converting factor small subunit MoaD n=1 Tax=Candidatus Methanohalarchaeum thermophilum TaxID=1903181 RepID=A0A1Q6D  ali  14  65..VEIRFFANFREVVGKDK---IEVKSKDIDDVRDVIEILVEKYPEL--EEMFFDGSELREYVNLILNDQKLEQLSGLDTEVNSRDSLVIFPPVSGG................ 154
226 4.000e-18UniRef50_A0A0S8HYQ0 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium SM23_61 TaxID=1703399 RepID=A0A0S8HYQ0_9DELT  ali  20  1MAVRIKPYFTLRRIMGNQQFMEID---SDSKTLEDLLENLITMYGPEFRAVVLDETGGMNPNIQILVNGRSYRNLHKLKTLLKSGDEISLFPPIAGG................ 96
227 4.000e-18UniRef50_A0A1U7CLX2 Sulfur carrier protein CysO n=3 Tax=Planctomycetales TaxID=112 RepID=A0A1U7CLX2_9BACT  ali  13  3...RVQIPTPLRAQTGGNDEVE-----AAGATVGEVLADLGRQHPAIRERLF--DGEELRRFVNIYVNNEDIRYLEDLDTAVAATDQVSIIPAVAGG................ 89
228 4.000e-18UniRef50_A0A2V8KI06 Molybdopterin converting factor subunit 1 n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8KI06_9BACT  ali  17  1MQVKLLFFASLKDIVGSR---QLQLDLPHGATIEDVLTELEASYPRIRD---------YRPVVLTAINEEYVDQR----TPIHEGDELAIFPPVSGGEVDSVPLIISR..... 92
229 4.000e-18UniRef50_A0A2N2BPV4 Uncharacterized protein n=1 Tax=Firmicutes bacterium HGW-Firmicutes-4 TaxID=2013785 RepID=A0A2N2BPV4_9FIRM  ali  15  1MKVTVKSILDIKEILGGKR--TIEIEIKNSANVFDVLQQLVCIYGESFENRVFEKDGSQKPEIVLFINGTTILAREGLETRMKSGDELLIFPPVGGG................ 95
230 4.000e-18UniRef50_A7IA81 MoaD family protein n=10 Tax=root TaxID=1 RepID=A7IA81_METB6  ali  20  1MTIKVRFFARFRELLGT----DIIVTSQEGTHLLTVVKKIAEK-SQDGYDAIFDAKGDFREFVIVMQNGRRVETATAASTPVTDGDEIAVFPPVAGG................ 92
231 4.000e-18UniRef50_A0A2A6BEH9 Ubiquitin-related modifier 1 homolog n=2 Tax=Pristionchus pacificus TaxID=54126 RepID=A0A2A6BEH9_PRIPA  ali  38  79.SLTLEFTGGSEFLVGNQKMHQVSISGEELT-IRSVLIWLKENLLKNCDRILLLEGDAVRPGVLVLVNDTDWELLDEEKTVLKNGDRVTFISTLHGG................ 174
232 4.000e-18UniRef50_F2Z4T6 Ubiquitin-related modifier 1 n=16 Tax=Opisthokonta TaxID=33154 RepID=F2Z4T6_DANRE  ali  39  9....LEFGGGAELLFDGVKNHHVTLPDQNPWDMKQLLAWIRGNMLKE-RPELFMQGDTVRPGILVLINDADWELMGELDYQLQDKDNVVFISTLHGG................ 101
233 5.000e-18UniRef50_A0A2V5RDX2 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A2V5RDX2_9BACT  ali  14  43MQVLFNIPGPLREFTGNQSAVRVEVE--AGANLLQVLQALFVVYPGL-RYRVLTEAGETRRHVNIFVANENVLYTGGLATAIPAGSEVSIVPAISGG................ 136
234 6.000e-18UniRef50_A0A0Q3WPE1 Molybdenum cofactor biosynthesis protein MoaD n=2 Tax=Brevibacillus TaxID=55080 RepID=A0A0Q3WPE1_BRECH  ali  10  1..MRVKVFANFREICQAKS---VEVPMDSGDRVIDILEALIRMYPAL-DEEIFTPERTFKPFVHVFINGRNVIHANGLETRVLEDDQFALFPPVAGG................ 91
235 6.000e-18UniRef50_A0A2E6HSH5 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E6HSH5_9CHLR  ali  13  1MSVSIYIPSPFRTITGSK-----DYISAVGNTVEDILDSIEEQYPG-FSHLVFDEQHKLPGHINIYLNNQEIHEIEGLQTKVRSGDQLAIIPALAGGT............... 92
236 6.000e-18UniRef50_A0A0Q1G5G3 Uncharacterized protein n=5 Tax=Methanothrix TaxID=2222 RepID=A0A0Q1G5G3_9EURY  ali  21  1MIIRLKAYARFRDLLDR----EMEVDLPEGSTVFDLMKKLASR-SVDLDNQIFDSSGRVREDVNIMVNGRHSESLNGPDTALAAGDEVALFSAVVGG................ 92
237 6.000e-18UniRef50_A0A202EC93 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Halobacteria TaxID=183963 RepID=A0A202EC93_9EURY  ali  18  4.HVTCTLYGPLREIVGTKS---LEREIDDEATAGGVFDDLVAEYPDL-RALLFDEDGTFSDSVSVMKNGRNVAFEDGVDTALEDGDTLSASPPAEGGSE.............. 97
238 7.000e-18UniRef50_Q0PIE1 MoaD-like protein n=2 Tax=Bacteria TaxID=2 RepID=Q0PIE1_HELMO  ali  24  1..MKVNFYAYFREYANAK-----ELTVDHCATVEDLILFLGQRCGRRMQKELLKE-GTVSDQVIILVNGRHIAHLGGPQARLQPDDEISIFPLVAGG................ 89
239 7.000e-18UniRef50_A0A2E7R4D0 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Chloroflexi TaxID=200795 RepID=A0A2E7R4D0_9CHLR  ali  20  1MAVTVNVTSVIEKLVGGQRSFE-----SVGDSVKSLIENINEAYPG-FSDQILEEGGELRRFVNIYLNDEDIRYLDGLNTELTDDDTVSILPALAGG................ 91
240 8.000e-18UniRef50_A0A2V9M8Y4 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9M8Y4_9BACT  ali  11  1MPVTFLIPGPLRSFAAGKDHIVIE---QSQATLADALEALWRQCPG-IRDRVVTEQAQIREHINVFVDNEDVRYTGGLQTPIRDGVAIAIIPAISGG................ 93
241 8.000e-18UniRef50_A0A2E2AYG6 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Bacteria TaxID=2 RepID=A0A2E2AYG6_9BACT  ali  19  10....VAIPTALRAQVDGQSQLEI-----PGESVKAILESINTQYPDLGKRLFKTE-GELNRFINIYVNDEDIRFLNNLDTELKAGDELAIVPAIAGG................ 96
242 8.000e-18UniRef50_F8D3T3 ThiamineS protein n=2 Tax=Natrialbaceae TaxID=1644061 RepID=F8D3T3_HALXS  ali  18  1MRVTCELYGPFRDPVGTKS---LEREVAADATVRDVFAALADDYPALGDDLF--DDGTFADSVIVLRNDRNVAHQCGAETPVADGDVLSAAPAVEGG................ 92
243 9.000e-18UniRef50_V4XKQ6 Molybdopterin converting factor, small subunit n=3 Tax=Archaea TaxID=2157 RepID=V4XKQ6_9ARCH  ali  15  1MELELRFFATFREAVGRK---TVVREFEDGSDVGEVLAVLEAEYEEMDGRLIVD--GDLAPQINVLKNGREVLHLQGLETALGDGDRLSVFPPV................... 89
244 9.000e-18UniRef50_A0A2R6JYT0 Molybdopterin synthase sulfur carrier subunit n=2 Tax=unclassified Halobacteriales (miscellaneous) TaxID=38063 RepID=A0A2R6JYT0_9  ali  14  1MEVELRFFATVREAVG---ERTTTRTVEQGTTVRDVLAGLEADYPSLDGTLL--EDGEVAGGITVLHNGTNVTNRAGSATGLTDGDALSITLPVTGGCTCA............ 96
245 9.000e-18UniRef50_A0A177E9D3 Uncharacterized protein n=1 Tax=Thermodesulfatator autotrophicus TaxID=1795632 RepID=A0A177E9D3_9BACT  ali  26  7.NIKFKLFGTLRL---NYRPSEGEIFIAEPITLAQLLKELAKKYAGIQEKLL--EEEKLRPGVVILVNGKNVLHLQGLNTEIEPGDTVVIFPPGAGG................ 97
246 9.000e-18UniRef50_A0A2U4CGZ7 Ubiquitin-related modifier 1 n=11 Tax=Euteleostomi TaxID=117571 RepID=A0A2U4CGZ7_TURTR  ali  39  51........GGAELLFDGVKKHQVTLPGEEPWDIRNLLVWIKKNLLKE-RPELFIRGDSVRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG................ 139
247 1.000e-17UniRef50_D2RZZ7 ThiamineS protein n=1 Tax=Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734) TaxID=543526 RepID=D2RZZ  ali  20  1MEVVCKLYGPPREAVGEKR---VRYDVETGATVEDVLETAIETHPALE-ESLYADDGTLRESIGVLTNRTNISQREGLATPVEEGDELLITPPIHGG................ 93
248 1.000e-17UniRef50_A0A2E3CQE9 Molybdopterin synthase sulfur carrier subunit n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A2E3CQE9_9ACTN  ali  19  6.KVTVWLPXVLRVHTGGESXVMLS-----ASNVSQILTXLVDLYPAL-RSHLLDXQGMLYPFITMFRNETNIRDLRFLDTQLGDGDEVRILPAVAGG................ 95
249 1.000e-17UniRef50_A0A1Q7QJT6 Uncharacterized protein n=3 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1Q7QJT6_9CHLR  ali  20  3.RVNVRLHGVFSDFAGGARSTTVD-----ASTVGAAIDALARRFPSL-RERLRDEHGRLREHIGVFARGEEIQHAGGESQAVADGDTVHIVPAMSGG................ 92
250 1.000e-17UniRef50_A0A1R4HY04 MoaD and/or ThiS families n=1 Tax=Halomonas sp. JB380 TaxID=1434831 RepID=A0A1R4HY04_9GAMM  ali  21  1MPVTIHIPTIMRSLTNGAATVD-----AQGSNLADVIDDLERDWPGVKQRLVKDD--ALVKFINLYVNDQDVRFHSGLQTPINEGDEVIILPAVAGG................ 90
251 1.000e-17UniRef50_A8MDP2 ThiamineS protein n=10 Tax=Thermoproteaceae TaxID=2267 RepID=A8MDP2_CALMQ  ali  25  6.RVKVKFAGVLVTFAGSE---TIDVGVKCGSTLRDLLRQLASVNPRLKRRLIEDDG--LWPGVYVAINDTDIRLLNGLDTRLNNGDVVLFLSYIHGG................ 96
252 1.000e-17UniRef50_A0A101ENU6 Putative molybdopterin converting factor, subunit 1 n=3 Tax=cellular organisms TaxID=131567 RepID=A0A101ENU6_9EURY  ali  20  2..VRVKVFATLRNIV---EKNELQI---QANTVRELLEKLYSKYPEMKKE--------LEKGVIILVNGKNIEHLEKLDTKLKDEDVVSIFPPVGGG................ 82
253 1.000e-17UniRef50_K4LDX0 Archael molybdopterin converting factor subunit 1 n=4 Tax=Thermacetogenium phaeum TaxID=85874 RepID=K4LDX0_THEPS  ali  21  1..MKVKFFALLRDITGVKETADFT------ATVLELLEKLSEHYGKELTRWLFAPEKQLSSDVIILVNGRAIEHLAGLATPLKEEDEVAIFPRLAGG................ 95
254 1.000e-17UniRef50_A0A2G2R495 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A2G2R495_9PROT  ali  18  1MPVSIQIPTLFKQQTEGVS--EIDLEPSEASTIHVMLDTLFERYPSLEEKIL-DKNGKQQRCVNFFVNGLDVRFIKGLESSLSDGDEVMIVPAIAGGIG.............. 96
255 1.000e-17UniRef50_UPI0003804F6E hypothetical protein n=1 Tax=Succinimonas amylolytica TaxID=83769 RepID=UPI0003804F6E  ali  18  5....VYVSATLRMFTGREPVVE-----AAGSSVGEVLKDVAASH-EDIRRILFADEGRLRNFVRVFVNDTEIRGLKGLDTPIQSGDTVYLIPAVAGGASGK............ 95
256 1.000e-17UniRef50_D3F296 ThiamineS protein n=27 Tax=Terrabacteria group TaxID=1783272 RepID=D3F296_CONWI  ali  20  3...TVKIPPVLRPSVGGEKTV-----SADGSNVGEVLKSLATDHPQTQSQ-LFSAEGELNRYVNVYLNDEDVRVLDGLQTVVGEGDTLVILPAMAGG................ 90
257 1.000e-17UniRef50_A0A1F9KLL8 Molybdopterin synthase sulfur carrier subunit n=30 Tax=cellular organisms TaxID=131567 RepID=A0A1F9KLL8_9DELT  ali  20  1MKVKVKFFAILRERAGAG---EITREMKEGGTVADLWEALRKDYPRLA---------PVETRLLYAVNRNYVR----PNHILKENDEVVFVPPVSGG................ 81
258 1.000e-17UniRef50_A0A1F5CQX7 Uncharacterized protein n=2 Tax=unclassified Candidatus Bathyarchaeota TaxID=1700837 RepID=A0A1F5CQX7_9ARCH  ali  28  1MLITVRFLGSLRAA---SKKNIITLNFERTISLRDVINTIVKHRPTLSRALIGPENDDPRTNVLMLVNGKDTSVLDGLETVLQDGDELVIVPVVHGG................ 94
259 1.000e-17UniRef50_A0A0K2SG68 Molybdenum cofactor biosynthesis protein MoaD n=1 Tax=Limnochorda pilosa TaxID=1555112 RepID=A0A0K2SG68_9FIRM  ali  18  6......IPGLLQSITAGEREVP-----AEGGTVAEALAALTRLYPE-ARSRLFAEDGTLRTHVNLFVNEEDIRFLRGLETPVAESDEILIIPAMAGGS............... 91
260 1.000e-17UniRef50_Q9HJR9 Uncharacterized protein n=2 Tax=Thermoplasma TaxID=2302 RepID=Q9HJR9_THEAC  ali  15  2..VTVRYYATLRPITKKKEET-----FNGISKISELLERLKVEYGSEFTKQMYDGN-NLFKNVIILVNGNNITSMKGLDTEIKDDDKIDLFPPVAGG................ 90
261 2.000e-17UniRef50_Q8ZYL1 Molybdenum cofactor biosynthesis protein D/E n=14 Tax=Thermoproteaceae TaxID=2267 RepID=Q8ZYL1_PYRAE  ali  24  1MKIHIKYFSALRDITGKTSE---TIEIPNGYTLGDVINWFFKNYPK---------AEVFKEELLVLVNGRSLDW----SYELKEGDEVALMPPVSGGGG.............. 83
262 2.000e-17UniRef50_A0A2N2LXZ4 MoaD/ThiS family protein n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2N2LXZ4_9CHLR  ali  13  4VNLKVNFYATFRVFTGAK---TVEFDLPHGSTIRDLVNLVMQQFPE-FKGQLLDKDGELFRHIHVFIDGRDTYYLENLDTILNQDEKIDIFPPVAGG................ 97
263 2.000e-17UniRef50_A0A2W1ANI2 Molybdopterin converting factor, small subunit n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W1ANI2_9CHLR  ali  20  1..MEVRLYATLRPIVGGR---LVELPDTEASDVRSLIDALIARFPALAGRLL-SEAGEIRPYVAVMIDGRDVRHLGGLDAPVPAGAEVDIFPP.................... 87
264 2.000e-17UniRef50_A0A1F9ZEJ7 Molybdopterin converting factor subunit 1 n=1 Tax=Euryarchaeota archaeon RBG_16_68_12 TaxID=1797981 RepID=A0A1F9ZEJ7_9EURY  ali  19  1MHVTVRLFASYRDIAGSG---DLKVHLPDGATLRDLLEAVTAEHPRLRG---------LRDTMLLAVNHEFAE----PSARLRDGDEVALMPPVSGGAGGFIEVQ........ 89
265 2.000e-17UniRef50_A0A1E3Y761 Molybdopterin synthase sulfur carrier subunit n=6 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1E3Y761_9B  ali  15  1MRVTVQYFARLRDLAGCG---TWTCDLPDRATVGDAWRAGVERFPATA---------ALGDSLSCAVNADFSR----MDAPIHDGDEVAFLPPVSGGAWTEP........... 86
266 2.000e-17UniRef50_M7T7N0 MoaD family protein n=6 Tax=Euryarchaeota TaxID=28890 RepID=M7T7N0_9EURY  ali  19  1MKLKIKFLKPFSDAVG-KSELELDFD---GITLEDMLKVLVNRYPKL-KKEFYTKTDELTDYMCMFVNDKPISALNGINTELKNGDELLFFIPVSGG................ 92
267 2.000e-17UniRef50_A0A2H6HBH1 Sulfur carrier protein CysO n=3 Tax=Bacteria TaxID=2 RepID=A0A2H6HBH1_9BACT  ali  17  1MAVVVRIPTILRMYTDGESMVE-----AAGTTIKEVLVDLETRHPG-IGERLIDIDGGLHRCVNVFLGDDDVRYLEGLETPVPDDAEIVIIPAVSGG................ 91
268 2.000e-17UniRef50_A0A2R6MG35 MBL fold metallo-hydrolase n=4 Tax=Halobacteriales TaxID=2235 RepID=A0A2R6MG35_9EURY  ali  20  1MKITCELHGTVRDAFGTDAA---TAELREGATVADLLTALDG-GEERLDPLVRTADGEIRSHIAVHVDGEPVAACDGADTGLDDGDKVTILPSVAGGSATLPF.......... 99
269 2.000e-17UniRef50_A0A1I6MZ15 Molybdopterin synthase subunit MoaD n=2 Tax=Acidobacteriaceae TaxID=204434 RepID=A0A1I6MZ15_9BACT  ali  17  1..MKIHIPTPLRAYTEGKETIGVTAE-----NVSGALDALTTQFPAL-RQHLFTPEGKTRSFVNIYLNDDDVRYLPEKEAPVQESDELTIIPSIAGGCCS............. 93
270 2.000e-17UniRef50_A0A1Y3XLP7 Uncharacterized protein n=7 Tax=Clostridiales TaxID=186802 RepID=A0A1Y3XLP7_9FIRM  ali  19  1..MTVKFFAYLREFAGTK-----ELVLSPPPTVGALGEDLSRRFGPRFRGEFFSPRDALGEKIIVLVNGRRVEFLSGLDTPLKDSDTVQIFPVVAGG................ 93
271 2.000e-17UniRef50_X1IU69 Uncharacterized protein n=3 Tax=marine sediment metagenome TaxID=412755 RepID=X1IU69_9ZZZZ  ali  19  1MKIKLKFVSFLRELSGVDKA---ELCLPQDATVKDALEKVVYDFPKLKKW--------LPQYIWMFINGNYV----KPQTQLKDNDEIALFPPVAGG................ 82
272 2.000e-17UniRef50_A0A2V6XZ54 Uncharacterized protein n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6XZ54_9BACT  ali  15  1MRVRVRLFARYREATGQER---LDVDVPEGGTVETAWKAIVARHPDLSR---------YRPYTLFAVGHDYVE----PDHRLAPDDELCLFPPVSGGSASR............ 85
273 2.000e-17UniRef50_A0A1Y3GHA0 Molybdopterin converting factor small subunit MoaD n=1 Tax=Methanonatronarchaeum thermophilum TaxID=1927129 RepID=A0A1Y3GHA0_9EUR  ali  18  2..VEVKLFATFQKIVDS-SELEIEAD-----NIMELLGELDNRYPMLGDRLFVDDDNELRDNVMVLKNGKNIEFLDKLDTELDEGDRVAIFPPIAGG................ 93
274 2.000e-17UniRef50_A0A1F7LK45 Uncharacterized protein n=2 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A1F7LK45_9BACT  ali  1..MEIGLHATLRRAAGRPA---VTVDTPPGSTVGDALRALVAKHPAL-GPAVFDPAGALVGHVAVVLDGRDIRHGDGLDTPITDAQHLDVFPPVGGGSGG............. 94
275 3.000e-17UniRef50_V4XS49 MoaD family protein, archaeal n=4 Tax=Archaea TaxID=2157 RepID=V4XS49_9ARCH  ali  16  1MYVVFRAYGPARDVIGAK---TVDCELPADATVEELLSRLTDEYPELA--EWVYDDGSLSSIVSLTVNGTNVSQREGVETPLSAGDEVRVAPPIHGG................ 92
276 3.000e-17UniRef50_A0A2S6GGE0 Molybdopterin converting factor small subunit n=1 Tax=Actinokineospora auranticolor TaxID=155976 RepID=A0A2S6GGE0_9PSEU  ali  14  1MPVTVVLPAALHPRAGGRTTLEVDIPAP--TTLNDILDVIAARYPDLSRR-IRDETGALRRHVNFFIDGEESRRLGGGDAPITPDTRIELIPSVAGG................ 94
277 3.000e-17UniRef50_A0A2N2MJP2 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2N2MJP2_9CHLR  ali  20  31...TLRVPAPLKYYLDNQSEIVL-----KGETVGDVLRNLSKQYPK-IKSHLFDNSGQVRRHINLFVNADNIRDLQGLGTPVGEEDIVKILPSITGG................ 118
278 3.000e-17UniRef50_UPI00054D4279 MoaD/ThiS family protein n=1 Tax=Edaphobacter aggregans TaxID=570835 RepID=UPI00054D4279  ali  20  1..MTVKYFGDIRPLTGGIKEEEWHQPEPE---VRSLLKALGQRHPALANRLF--EGDQLSSTLIVLVNGRSVDYLNGAETPLQPDDIVDVFPVEGGG................ 90
279 3.000e-17UniRef50_UPI00082FF687 MoaD/ThiS family protein n=1 Tax=Methanofollis ethanolicus TaxID=488124 RepID=UPI00082FF687  ali  19  1MNVRVRAFAQLREALGADR----TMDVPAGATMNTLLALLGAE-SVQAKEALFEDNGDLKGHVILMRNGRRVPRSEVGAIALGEGDEVALFPPVAGG................ 92
280 3.000e-17UniRef50_A0A2A2WHJ6 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Rhodopirellula sp. SM50 TaxID=595453 RepID=A0A2A2WHJ6_9PLAN  ali  23  1..MKVIIPTALRKHTDGQNHLCVT-----ATTVEDALKQVVTTHPEL-RSSLFDDREQLVSFVNVFVNDRNIRDLENEATPLTESDEILLVPAIAGG................ 89
281 3.000e-17UniRef50_A0A1F9DRZ2 Molybdopterin synthase sulfur carrier subunit n=5 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9D  ali  23  1MKVKVKFFAILRERAGTG---EITKEIRKGSTVAELWEALQRDYSKLA---------PVDMRLLYAVNQAYVKA----DYVLKERDEVVFVPPVSGGS............... 82
282 3.000e-17UniRef50_F6D3P5 MoaD family protein n=5 Tax=Methanobacterium TaxID=2160 RepID=F6D3P5_METPW  ali  26  2..IEVKFLTRFLDITGERAT-----EIKDAKDMANLIDILSQKYQSEFKDVLFDDNGDIRDYLKVIVNGEDIRAINGMETPLKDGDQVVMFQTIAGG................ 91
283 3.000e-17UniRef50_A0A1F2S223 Uncharacterized protein n=9 Tax=Bacteria TaxID=2 RepID=A0A1F2S223_9BACT  ali  16  1MALVFHIPSPLRVFAEGKAEVILEVP---AATMGEALAALWTRHPGL-RDRIVTEQGEVRQYVNIFVGDGNIRDLAGLATPVLDGCEIMIVPSVAGG................ 93
284 3.000e-17UniRef50_A0A2W1AG08 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W1AG08_9CHLR  ali  20  3........AVIQKITNNQKEF-----VSEGSNIKDLIQNIEKEFPG-FKNHILTDSNEVHQFLNIYVNDEDIRFLSNLETAIKDGDVISFLPALAGGS............... 86
285 4.000e-17UniRef50_G8NRW3 Thiamine S protein n=4 Tax=Acidobacteriaceae TaxID=204434 RepID=G8NRW3_GRAMM  ali  20  1..MTINIPTPLRAYTDKKESVSVE-----GTTVTEGLAALVAAHPAMQ-QHLFTPEGKLRSFVNVYLNDDDVRYLAKEETAVSASDELTIIPSIAGGCC.............. 92
286 4.000e-17UniRef50_H3ZKR1 Molybdopterin converting factor n=8 Tax=Thermococcaceae TaxID=2259 RepID=H3ZKR1_THELN  ali  23  2..VKVRVFATLRGIVG-KSELEVQAE-----TVGELLEKLYNEYSKMKKE--------LEKGAVILVNGKNIEHLEKLNTKLKDEDVVSIFPPVGGG................ 82
287 4.000e-17UniRef50_Q8ZT89 Uncharacterized protein n=9 Tax=Pyrobaculum TaxID=2276 RepID=Q8ZT89_PYRAE  ali  20  1MRVLVKIFGP--KYFGTYDVITLVLDLKEGATVGDVMEELEKRYPGLRQKLLRGEEIIPMHD--IWVNGRSIYFLQGLKTALAEGDVVQIIPPFGG................. 94
288 4.000e-17UniRef50_A0A2E1RB83 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E1RB83_9DELT  ali  20  1MGVVIEIPSALKXYVNDQDEVEVS-----GSSVEEVFEALVSEY-AEVKANLFDENGKIRNFINVYLNDDXIRYANGLKSKVQDGDTIQXVPSVAGGCXTXK........... 96
289 5.000e-17UniRef50_A0A2V9K5H7 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9K5H7_9BACT  ali  22  1MLMRIKIPPPLRKFTGGLETVEVS-----AGNLNELFEALEGQFSG-IKEGLANPDGTPKRFINIYVNDEDIRFLGGAGYAFREGDEILLIPAIAGGSGPS............ 95
290 5.000e-17UniRef50_A0A0L0CQ63 Ubiquitin-related modifier 1 homolog n=2 Tax=Lucilia cuprina TaxID=7375 RepID=A0A0L0CQ63_LUCCU  ali  43  258.KIILEFSAGAELLFGNIKKREISLPLTEKWTIRNLLKWMHANILTE-RPELFIQGETVRPGILVLVNDTDWELLGELDYELQQRDNVLFISTLHGG................ 352
291 5.000e-17UniRef50_A0A285NZC4 Phosphoadenosine phosphosulfate reductase n=4 Tax=Aquificaceae TaxID=64898 RepID=A0A285NZC4_9AQUI  ali  21  530..VKISIFGPLSRFSGGLTEIEVSAP-----TVRSALEFLEKEF-EGFRGKLFDEQGNLKPFVKVFLNEEDISYLKGLDSELKEGDHIMLYPALAGGS............... 619
292 5.000e-17UniRef50_F8ADU8 MoaD family protein n=2 Tax=Thermodesulfatator indicus TaxID=171695 RepID=F8ADU8_THEID  ali  27  7.NVKFKLFGILRL---NYRPSEGEVPVKGSITLTQLLKELADRYPGIQEKLLEDE--KLRPGVVLLVNGKNVLHLEELATQIKPGDTVVIFPPGAGG................ 97
293 6.000e-17UniRef50_A0A1J4SA38 Uncharacterized protein n=2 Tax=unclassified Anaerolineae TaxID=1081798 RepID=A0A1J4SA38_9CHLR  ali  18  1MPV-VRFPPALKYYVEDHSEMEIS-----ASTVTELLAALVTRYPSL-KFHLLDADGKLRRHFNVFVNGEHIRELAGLETKLKPEDKVILMASASGG................ 90
294 6.000e-17UniRef50_E6N2R8 ThiS family protein n=1 Tax=Candidatus Caldiarchaeum subterraneum TaxID=311458 RepID=E6N2R8_9ARCH  ali  26  1MAVKVYLPTPLRQYADGRDMVELD-----GSTVGEVLNKLVSRYTALQK-HLFNENGAIRSFVNVFVNNEDIRFLEGVNTKIKDGD........................... 80
295 6.000e-17UniRef50_A0A2D7PJ43 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2D7PJ43_9DELT  ali  16  1..MQVKLYATLRALAG---VTTLELPLADGATVRQLAECLAEHCPALA-AQIFEPSGELSRRVHFMVDGRNSRWLQGSETPLHSRQTLDVFPPAAGG................ 92
296 6.000e-17UniRef50_A0A2V6P0I2 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6P0I2_9BACT  ali  13  15.RVAVRFFARYREATGRQR---LEVDLPDGGTVEAAWAAVVDRHPEL---------GRYRPFTLFAIGNDYV----GPDHALRPGDELCLFPPVSGGSAG............. 97
297 6.000e-17UniRef50_B8GIR4 MoaD family protein n=1 Tax=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) TaxID=521011 RepID=B8GIR4_METPE  ali  21  1MIVTVRGYADLRLVIGDQ-----EVVLPEVATVQHLLDLLIVDHPV-ISTALFDQAGALLPAVNILKNGRNIFFLNGLSTLLEEGDLISVFPPVAGG................ 91
298 7.000e-17UniRef50_D5EAN0 MoaD family protein n=10 Tax=Methanosarcinales TaxID=94695 RepID=D5EAN0_METMS  ali  24  2..VSVRFSSALNNIT-KTRSSEFDL---QNTTIRSLFDELIKEFGEEFENRLF-ENGEIRRFVNIYVNGEDIRHLSGLETEIKASDEVSILPAVSGG................ 91
299 7.000e-17UniRef50_A0A1Q7HL60 Uncharacterized protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Q7HL60_9CHLR  ali  26  1..MRVLLHGAWRGFAGGAKEVRLD-----AADLHEALAALVAAHPSLA-ERLRDEHGKLRPHLALFVNDEDARLLGWEDAKLKEGDIVHVIPALSGG................ 89
300 7.000e-17UniRef50_A0A2H5ZI64 Molybdopterin synthase sulfur carrier subunit n=1 Tax=bacterium HR30 TaxID=2035425 RepID=A0A2H5ZI64_9BACT  ali  18  1MTVKVRFFAVLRERTGVSSTV---LTFEGSPSVHEAWQLLQQQYPVL---------GPFSECVTFAVNREYVNQ----HHRLHDGDELALIPPVSGGCDREVQ.......... 87
301 7.000e-17UniRef50_E8V8A7 ThiamineS protein n=31 Tax=Acidobacteria TaxID=57723 RepID=E8V8A7_TERSS  ali  25  1MSIRVMLPAAFQRHTDGVKQVD-----SSAINLAALVEDLKFKFPVL-GEHIKDADGKLRKFINVYVNDEDIRFLGGESYAFQDKDEVMFIPSIAGGA............... 92
302 7.000e-17UniRef50_A0A143PVY8 Sulfur carrier protein MoaD n=2 Tax=Bacteria TaxID=2 RepID=A0A143PVY8_9BACT  ali  19  1MSVTVRLFARLREIAGTD---ELSRPVGAPATVADVWQGMTGEWPALT---------PYAGSLSCAVNAQYAR----MTTAVQDGDEVAFLPPVSGG................ 81
303 7.000e-17UniRef50_A0A1F5CRD7 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=A0A1F5CRD7_9ARCH  ali  22  2VNVNVSLVGVLARAAENSTKVEAE-------TLGQVLGALIQKYGESFGERILDDGGSLRRFINIYVDGRDYRFLGKLDAKLSEGSEVSIIPAVSGG................ 91
304 7.000e-17UniRef50_Q7Q6I6 Ubiquitin-related modifier 1 homolog n=29 Tax=Opisthokonta TaxID=33154 RepID=URM1_ANOGA  ali  36  15.TITVEFSGGAETLFGGVKEHIVPLDGSKIVLLEEMLRWLRDHLLTG-DAGLFLQENTVRPGILVMINDTDWDLMGETEYILQPGDHILFISTLHGG................ 109
305 8.000e-17UniRef50_A0A268K7J9 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Bacillus TaxID=55087 RepID=A0A268K7J9_9BACI  ali  14  3....VRVFANLREICGGVG---VEVN-PDGQRVIDVLDKMVEMFPDL-KIEIFTPEKQLLPFVHVFINGRNIIHLDGLETIVKETDQFALFPPVAGG................ 90
306 8.000e-17UniRef50_A0A0F9KQT8 Uncharacterized protein n=9 Tax=root TaxID=1 RepID=A0A0F9KQT8_9ZZZZ  ali  11  3.KVKISFLSLLTDIT---EVEEITLSIDDESVIRDILEQLATKFGSKFEEMIYKTSKDLSQYVLITINGRDIRQFNGLDTKIQINDEIALIPAIAGG................ 95
307 8.000e-17UniRef50_A0A2U1LEN1 Ubiquitin-related modifier 1 homolog n=3 Tax=Pentapetalae TaxID=1437201 RepID=A0A2U1LEN1_ARTAN  ali  34  1MQLTLEFGGGLELLCNSVKIHSVDVDLPAEETMKHLLAWVKSNLIKE-RPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLENKDVVVFISTLHGGSGLFILEPLLTS.... 111
308 8.000e-17UniRef50_A0A2E4FED5 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E4FED5_9DELT  ali  17  243MSVAIKIPTSLRRFVGGNDQIEV-----AGQNVREALDGLEAAHPG-IKAKICDAQGNLRRFINVYADQEDIRFLDNLETPLGEGAELQIVPAIAGG................ 333
309 8.000e-17UniRef50_A0A1Q6YGJ7 Uncharacterized protein n=16 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q6YGJ7_9BACT  ali  13  1MQVVFNIPGPLREFTENRSSVPVEV--KAGPDLRAALQALFAAYPGL-RDRVLTESGETRRHVNIFVANEDIRYTGGLAMPVREGVEISIVPAISGGIP.............. 96
310 9.000e-17UniRef50_A0A1G1CAS2 Uncharacterized protein n=1 Tax=Lentisphaerae bacterium RIFOXYB12_FULL_65_16 TaxID=1798581 RepID=A0A1G1CAS2_9BACT  ali  24  1MRVKVHFYGQIRQKAG---VEHTDIDLAEGTVLRLAFSALAARHGEEFGRMVLEPSGRVHPNLICLVNDV---PATGDEHVLKDGDGVALFSPVAGG................ 91
311 9.000e-17UniRef50_UPI000A3D8423 MoaD/ThiS family protein n=1 Tax=Natrialbaceae archaeon JW/NM-HA 15 TaxID=1902251 RepID=UPI000A3D8423  ali  21  10MSVTCDFYGPLREAVDQK---TLTRDPPTDGTVGTFLESLAADYPELDD--LLFEDGDLQSTANVSVNARHLRLEEGLETPLEAGDRVRLYPPIEGG................ 101
312 9.000e-17UniRef50_UPI000C6CEA1A MoaD/ThiS family protein n=1 Tax=Haloferacaceae archaeon SYSU A9-0 TaxID=1985678 RepID=UPI000C6CEA1A  ali  14  1MQVEYNFFGPMRDAVGTK---TVRREVPTGATVGEALRAVCEEFDGLEPHLF--EDGDLLDRVTVTVNARNVRQLDGAETTLADGDVLRLAPPVVGG................ 92
313 9.000e-17UniRef50_M1ZHP2 MoaD family protein n=19 Tax=Firmicutes TaxID=1239 RepID=M1ZHP2_9FIRM  ali  10  1..MKVKVFANFREIC----QSPVVEVKATGDRVIDILEALTRQYPALE-TEIFDAERKLKPFVHVFINGRNAIHEQGLETKVKASDQFALFPPVAGG................ 90
314 9.000e-17UniRef50_A0A146H8J7 Ubiquitin-related modifier 1 n=1 Tax=Mycena chlorophos TaxID=658473 RepID=A0A146H8J7_9AGAR  ali  46  595IALKVEFGGGLELLFSNERTHKVTVPATKPADIAFLIRYLRDNLLKE-RDELFMENETVRPGILVLVNDTDWELEGEGEYALKNGDEIVFISTLHGG................ 716
315 9.000e-17UniRef50_A8NID9 Ubiquitin-related modifier 1 homolog n=14 Tax=Chromadorea TaxID=119089 RepID=A8NID9_BRUMA  ali  38  4LSLKLEFSGGAESLFDMQKEFDVQVPNDSGPLISDLVRYININLIPDKSRLVDKDGEGVRPGILVLVNDVDWEVLEGPKTVLEDGDTVSFISTLHGG................ 104
316 1.000e-16UniRef50_C7NNH8 MoaD family protein n=2 Tax=Halobacteria TaxID=183963 RepID=C7NNH8_HALUD  ali  15  1MDVSWKLFATLREAAGQA---EVQVAVGTDGTVADALEELLEEYPTLETDAL--DGNELRAHISVVHNGVRIDEPLASDRELADGDELALLPPLSGG................ 92
317 1.000e-16UniRef50_A0A1Z9JQV8 Uncharacterized protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1Z9JQV8_9ACTN  ali  16  1MSVQLWLPSVLLAHVDGQSRFSF-----AGRTVEEILNHLVELYPS-VRPHLFDDHDKLHPFISIFCNEKNIRDLNGLETCVNDGEEIRILPAVAGG................ 91
318 1.000e-16UniRef50_Q2FMJ7 Molybdopterin synthase subunit MoaD n=4 Tax=Euryarchaeota TaxID=28890 RepID=Q2FMJ7_METHJ  ali  14  1MKVTIRCYARFRDAFGEEQ----TLDLPEGSTIHDAVRALAGDGPD--AELLVDTAHNIRSYVMIMHHDTRISPMEAESVPLADGDLIILFPPVSGG................ 91
319 1.000e-16UniRef50_A0A099D4G7 Molybdopterin synthase sulfur carrier subunit n=16 Tax=Actinobacteria TaxID=201174 RepID=A0A099D4G7_9ACTN  ali  23  1MRITLVIPQMLRSTADGAGRLRLSLE--DRATLRQLLDELAISHPALERR-LRDETRTLRRYVNFYVDGTECRALDGAATTLSDGAEVRIVPSVAGG................ 94
320 1.000e-16UniRef50_A0A1F6LKK6 Uncharacterized protein n=1 Tax=Candidatus Lindowbacteria bacterium RIFCSPLOWO2_12_FULL_62_27 TaxID=1817870 RepID=A0A1F6LKK6_9BAC  ali  20  1MPVKVKIPTMMQKLTGQKAEVSV-----KARSVREMIDALDRKFPG-AKVMLLGADGAIHHHFIIAINDEDARYLDGLDSALSGNDRVEIVASIAGGSA.............. 93
321 1.000e-16UniRef50_A0A143PPQ4 9.5 kDa culture filtrate antigen cfp10A n=1 Tax=Luteitalea pratensis TaxID=1855912 RepID=A0A143PPQ4_9BACT  ali  17  88.TVIVFVPAPLRQYCGNASELVVSAD-----TVQQALGEMERTQPQLYRN-VCDETGAIRRHLNVFVNDDNVRDLDGVATRLRREDVVTILPAVSGG................ 177
322 1.000e-16UniRef50_F8CD82 Molybdopterin synthase sulfur carrier subunit n=41 Tax=Bacteria TaxID=2 RepID=F8CD82_MYXFH  ali  12  5.RVTVLYFAAARERTGQTRE---SLEVPAGAQVRDVLRLLTERHPALA---------PLLPHLRVAVNQAFV----GPDSPVGDGAEVALIPPVAGGAPERFRVV........ 92
323 1.000e-16UniRef50_A0A062X001 Cytochrome P450 n=1 Tax=Frankia sp. BMG5.23 TaxID=683305 RepID=A0A062X001_9ACTN  ali  21  17..VTIKIPAAFRALSGGQRQV-----AAKGENIREVFADLNECLPGLIDK-IMDGQGSVRRYINVYRNDNDIRGLENLETRVEESDVVWIIPAVAGGS............... 106
324 1.000e-16UniRef50_A0A1F8NSL8 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_13_68_17 TaxID=1797638 RepID=A0A1F8NSL8_9CHLR  ali  21  1MHVRVRGFLTFREAVGTR-----EVDLEDGATLRTLFERLAGQLDSVAAQVYAPSDG-LRRGVAVLVNGRHYTHTRGLETTLCDGDEVDVFPPLAGG................ 92
325 1.000e-16UniRef50_A0A0M8VJ92 Uncharacterized protein n=1 Tax=Streptomyces sp. MMG1121 TaxID=1415544 RepID=A0A0M8VJ92_9ACTN  ali  17  16.TVTVKLPAAFHVLTGGRRQLP-----GEGENIRDVLVDVDRECPGVLDR-LMDQEGSVKRYVNVYRNDNDIRGLDGLETKVENQDVIWIVPAVAGGSGTARI.......... 111
326 1.000e-16UniRef50_A0A2T2VKL4 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Bacteroidetes bacterium SW_10_40_5 TaxID=1919112 RepID=A0A2T2VKL4_9BACT  ali  22  3...TIQIPTPLRKYTNQQSKIEV-----QENNVEKAIQQLVSEYPE-IKENLLDENGNIRSYINVFVGDNNIKSLDKEQTVIKEHDLVNIVPAIAGGS............... 91
327 1.000e-16UniRef50_F4HJG1 Molybdopterin converting factor related, subunit 1 n=3 Tax=cellular organisms TaxID=131567 RepID=F4HJG1_PYRSN  ali  21  3.KVKVKVFATLIDIIGKR------IFEEEAENVGELLEKIYAKYPKVREE--------LEGGYLILVNGHNIEHLQGLNTKLKHGDVVSIFPPAGGG................ 84
328 1.000e-16UniRef50_A0A1F8PVY6 Molybdopterin synthase sulfur carrier subunit n=3 Tax=root TaxID=1 RepID=A0A1F8PVY6_9CHLR  ali  14  3...TLRIPSPLRPYTDGSGEVSV-----QGNTVGAALDDLISQFPDL-RQHLFNGDGHVRPFVNLYLHEENVKQLKGMDTPVTAEDRILLIPSIAGG................ 90
329 1.000e-16UniRef50_A0A1V5VHH6 Sulfur carrier protein CysO n=1 Tax=bacterium ADurb.Bin236 TaxID=1866925 RepID=A0A1V5VHH6_9BACT  ali  20  1MPVRIMIPGPFRRLAGGASEAEVE-----AATVYEAIRALEILAPGL-RDRLTTAEGDVRRFIRLYVNGKDIYELRGAETELRDGDSIEIVPAAAGG................ 91
330 1.000e-16UniRef50_A0A0A2U3A3 Uncharacterized protein n=7 Tax=Peptococcaceae TaxID=186807 RepID=A0A0A2U3A3_9FIRM  ali  16  1..MTVRLPASIAHLTGDNKVVE-----CAASSIAECVQDLDARFTGL-KDILCDLDGNVSDIFFIFLNGENITYLQGMQTALQDGDELNIIPAAAGG................ 89
331 1.000e-16UniRef50_A0A2H9QAD8 Molybdopterin synthase sulfur carrier subunit n=4 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A2H9QAD8_9ARCH  ali  19  2..VKVRFSSTIQSAVNNDVETQLEFS----GTVLGLLEKLAGKYGENFKKRIYGSDGKPRKFINIYLNGKDIRFKEGGATRVGGKDEVDLIPAVSGG................ 92
332 1.000e-16UniRef50_A0A0T6AB80 UBA/THIF-type NAD/FAD binding protein n=3 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A0T6AB80_9BACT  ali  17  3.QVTVALPSLLAGVVGGARTLPIEAE-----TLAGALDELVRQYPAL-KIHLFDESGAFRQHVLCFHNEESTRWLGSLDRPLAPGDVITIMQAVSGG................ 92
333 1.000e-16UniRef50_A2BLK0 Conserved archaeal protein n=3 Tax=Pyrodictiaceae TaxID=2307 RepID=A2BLK0_HYPBU  ali  20  1MKVKAVFIQEFYELMG---RFELEIELAEGATVRDLIEYIDSQVKPGFKSWILDEKGEPRYPVEIAVNGRRIDFLDGLETRLKDGDRVLFSP..................... 89
334 1.000e-16UniRef50_A0A1I4DQF6 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Xanthomonadaceae TaxID=32033 RepID=A0A1I4DQF6_9GAMM  ali  16  18..VVVLIPSGLRRFTGQAGSVDVQAE-----TVGQALRLISDKYP-LLRTQMFAGDQQLRRFINVFLNSKDIRFLQQEHTPLRSQDVITILPAIAGG................ 106
335 1.000e-16UniRef50_A0A0N8H4Y6 Ubiquitin-related modifier 1 n=1 Tax=Neonectria ditissima TaxID=78410 RepID=A0A0N8H4Y6_9HYPO  ali  44  123.......SGGLEMLFSHQRSHALTIPATDKTTIAHLIDHLCEHVMNDSRKDLFVLDNHIRPGILVLINDADWELEGEEAYEVQSGDSILFVSTLHGG................ 216
336 1.000e-16UniRef50_A0A1W4ZVI1 Ubiquitin-related modifier 1 n=3 Tax=Bilateria TaxID=33213 RepID=A0A1W4ZVI1_9TELE  ali  34  5IALRLEFGGGAELLFDGVREHLVTLPGQEPWDMKQLLAWIRGNLLKE-RPELFVQGDTVRPGILVLINDADWELM...................................... 79
337 2.000e-16UniRef50_A0A1F9BKF7 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1F9BKF7_9DELT  ali  22  6..IKVKVYSTLKKILGQR---EFEVSIPPGSTVKDLLFWMINKWGDKLTRHLFTPGNSLLPHIRLMVNGRSIEFLNGVETILQDGDEFLMLPIVSGG................ 100
338 2.000e-16UniRef50_A0A1G8YZI7 ThiS family protein n=2 Tax=Natronincola TaxID=89958 RepID=A0A1G8YZI7_9CLOT  ali  20  2MQVTVKVMGDLIKIVGYSS---FTVELQKDATIKGLLEELFILHGEDFKKEVMDKEGRLAPYYKVLVNGRNAKLLGHFETVLENGQTIHIMPPIAGG................ 96
339 2.000e-16UniRef50_A0A147JSZ0 Uncharacterized protein n=1 Tax=Hadesarchaea archaeon YNP_45 TaxID=1776334 RepID=A0A147JSZ0_9EURY  ali  19  1MKVKVKFIGAFRDAAGVS-----ETEVSGVKNIRGLFDALVKNFGENLKNEMFDPKNNLLDWVFVSLNGKTVRLPEDLDRPLQNGDVIVIYPPLAGG................ 93
340 2.000e-16UniRef50_A0A2V6TG73 Molybdopterin converting factor n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6TG73_9BACT  ali  14  1MKVAVRFFARYREAAG---RDHIELEVPEGGTVEAAWEAVASRFPVLQ---------PYRPFTLFALGTDYVQ----PNHPLRPGDEVCLFPPVSGGSDG............. 84
341 2.000e-16UniRef50_A0A075R8N3 Molybdopterin synthase sulfur carrier subunit n=37 Tax=Bacilli TaxID=91061 RepID=A0A075R8N3_BRELA  ali  19  1MQVTLLLFAGLAERAGQNS---IQIELPDSSTVQDLLDKLPHEYPALK---------ELLSSCFVSVNQEYADH----HTIIKENDEVAILPPVSGG--EEPRFAI....... 88
342 2.000e-16UniRef50_A0A1F8KX58 Uncharacterized protein n=1 Tax=Chloroflexi bacterium GWB2_54_36 TaxID=1797613 RepID=A0A1F8KX58_9CHLR  ali  11  1..MQINLYATFRLIAGQR---TLDIQLAPGATARQAVIAVLEQAPDL-RTHWVNEQGEIHAHVHGFINGNEIPTLEGWDTPLHPDDIMDFIPPVAGG................ 92
343 2.000e-16UniRef50_A0A202DGP9 Uncharacterized protein n=1 Tax=bacterium E08(2017) TaxID=1932693 RepID=A0A202DGP9_9BACT  ali  17  1MEITLNYFSQIRQLAGTGTE---TVEVNEGATVAEVLATL--QYGDKFKELLLDEGSAIRSTIMPVVNGQSANGEQ----VLNDGDEVSLFAPIAGG................ 88
344 2.000e-16UniRef50_A0A2G4H4Q4 Cysteine synthase B n=1 Tax=Thermoleophilia bacterium TaxID=2026888 RepID=A0A2G4H4Q4_9ACTN  ali  14  1MPISLRMPPVLRPQVGGARQVEVT-----GATLREALEDLFTQFPA-VRDQIVDAEGQINRFVNVYVSNEDVRLGQGLETPVPDGSTVIVLPAMAGGSVFPP........... 96
345 2.000e-16UniRef50_A0A1Q7NYU7 Uncharacterized protein n=9 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A1Q7NYU7_9BACT  ali  14  1MRVRVRFFARYREATGRER---LEIDLPDDGTVESAWSAVVHRHPEL---------EAYRPFTLFAVGHDYVA----PEHRLQAGDELCLFPPVSGGAGGDRYQVV....... 90
346 2.000e-16UniRef50_F4C092 MoaD family protein n=3 Tax=root TaxID=1 RepID=F4C092_METSG  ali  19  1MRIKIRSFAGFRNILG--KEKDIDLP-GEGAMIRDLLNLLCHDHASL--EPLLFKEGRLREDVNIFLSGKNIESLQSLETPLADGDELALFTAVIGG................ 92
347 2.000e-16UniRef50_A0A1J5D765 Uncharacterized protein n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A1J5D765_9CHLR  ali  16  1MKVTVRPFLFIRDALGDQREIEVKLN--SSATISDLLTTLRREYGPIGRGVFELFHGNEVRNMVILKDGRNIRFLEGMETKLEDGAEIALFPPVVGG................ 100
348 2.000e-16UniRef50_B5Y6N3 Molybdopterin converting factor subunit 1 n=3 Tax=Coprothermobacter TaxID=68335 RepID=B5Y6N3_COPPD  ali  24  8MLVNVLYFGHLREATLKEKE---TLEVPSEATLATLIELLEQKYGPEYRNAMDAIKG-----LRILIDGRDSSILGGTDAPLKEGCTVVFLPPIAGG................ 96
349 2.000e-16UniRef50_A0A1V4RUX2 Uncharacterized protein n=1 Tax=Desulfobacteraceae bacterium 4484_190.1 TaxID=1956167 RepID=A0A1V4RUX2_9DELT  ali  20  1MKIKVKGYFNFKEAFRNLGISEIEM---AGGTVIGLFDDLFDRFGEEVTDLIYDSTNRVRGDIRILLNGRHIVHLKGLDTELKEGDEVALFPPVAGG................ 96
350 2.000e-16UniRef50_A0A251VVY7 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Litorilinea aerophila TaxID=1204385 RepID=A0A251VVY7_9CHLR  ali  17  1MEVTVKLFATLRQQAGWSERR---IDLPTEATLQDLLSRLEEEHENLTFA---------DRPVYAAVNQEYAH----LDRILAPGDEVALFPPVSGGTGGERESVL....... 90
351 2.000e-16UniRef50_A0A2E5TPG1 Molybdopterin synthase sulfur carrier subunit n=1 Tax=bacterium TaxID=1869227 RepID=A0A2E5TPG1_9BACT  ali  22  1MAXKILIPTPLRPAVNQKTELLIS----DGGSIGSIMFDLVTTYPKL-KLYLIDDHGNLRKFVNFYLNDTDIRDLDGDKTRVSDGDSISIVPAIAGGA............... 93
352 2.000e-16UniRef50_A0A117MFB4 MoaD family protein n=2 Tax=cellular organisms TaxID=131567 RepID=A0A117MFB4_9BACT  ali  19  1MAMTVRYFGPFRDVT----KLHVE-EVPGGQTVRGLLKVLEEKYGDAFSP--AEKPVPVSGRLILLVNGRHIQHLDGLDTRLEDGDVLSVFPLIGGG................ 91
353 2.000e-16UniRef50_G7E712 Ubiquitin-related modifier 1 n=10 Tax=Basidiomycota TaxID=5204 RepID=G7E712_MIXOS  ali  44  1MDIRVAFGGGMELLFGSQRSRTVRLPTHYATDIRLLIAYLLERLQDKQRPDLFVQGQTVRPGILVLVNDCDWELEGELDYNIKPNDEIVFISTLHGG................ 119
354 2.000e-16UniRef50_A0A093B9M4 Ubiquitin-related modifier 1 (Fragment) n=2 Tax=Bilateria TaxID=33213 RepID=A0A093B9M4_CHAPE  ali  36  1......FRGGAELLFDGVKKHQVTLPSPEPWDIRNLLQWIKQNLLKE-RPELFMQGESVRPGILVLINDADWELM...................................... 69
355 3.000e-16UniRef50_A0A2D6BU83 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2D6BU83_9DELT  ali  13  25.RVHVSLFATLREIVGQK---TVDLQVGPGSTVQALAEELVLRWPEL-GEHLFDAEGRLGRRVNVFIDGRNLRWLDREQTRLTSTECIDLFPPVAGG................ 117
356 3.000e-16UniRef50_G0ECT9 MoaD family protein n=2 Tax=Pyrolobus fumarii TaxID=54252 RepID=G0ECT9_PYRF1  ali  17  3.RVKVVLFAIFREVAGW---HERVYDVPEGTTVAQLVEMIFREHPELRKSI--EELLERGYSTLILVNGRPVEFLDGEKTVLRDGDRVALIPPAAGG................ 94
357 3.000e-16UniRef50_A0A2V8FCV9 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Bacteria TaxID=2 RepID=A0A2V8FCV9_9BACT  ali  17  30.TVTFHVMGSLRTYCAGAAQLSIS-----GRTVRTALEDLERSQVALYRN-VCDETGAVRRHLNVFVNADNVRDLNGVDTALTSGDVITILPAVSGG................ 119
358 3.000e-16UniRef50_UPI00040CC1A2 hypothetical protein n=1 Tax=Acidipropionibacterium jensenii TaxID=1749 RepID=UPI00040CC1A2  ali  24  1MAI-VSIPSVLKSYTDRQRQVVL-----PGTTVAEVVKELTSAYPDLA-PHILDEDGTLRDYVNVFVNDSDIRQLDGELTAVEEDSTVRLLPAIAGGAPDS............ 94
359 3.000e-16UniRef50_A0A2E8E5V6 Molybdopterin synthase sulfur carrier subunit n=27 Tax=Bacteria TaxID=2 RepID=A0A2E8E5V6_9BACT  ali  18  1MRVNIRLFARLRDIAGAG---EIERHVPDGATVRTVWTALAAEFPDLMSYE---------ASISTAVNAEYSR----MEAPVGEGDEVAFLPPVSGG................ 81
360 3.000e-16UniRef50_E1QUM6 MoaD family protein n=7 Tax=Vulcanisaeta TaxID=164450 RepID=E1QUM6_VULDI  ali  25  1MKIYVKFLTLLYEMT---KTLRTEIELPDGATLLDLIRKIDNAIYPGFSKVILDCNNKIKDKFLVLINGRSPDFLNGVDTKLSDGDEVTFLP..................... 89
361 3.000e-16UniRef50_A0A1F5BCY9 Uncharacterized protein n=1 Tax=Candidatus Aminicenantes bacterium RBG_13_63_10 TaxID=1797270 RepID=A0A1F5BCY9_9BACT  ali  21  1MRVRVKYFAFFRELFRGEER---EVDLDPPADVRRLLGALCGS--VSLRKELFD-GENLKPQVVVMKNGQSVHSLQGLRTPLEEGDTVAVFPFMGGG................ 91
362 3.000e-16UniRef50_A0A2E3J3N2 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Bacteria TaxID=2 RepID=A0A2E3J3N2_9BACT  ali  23  1MNIKTLFFATCRDIVG---EREVSLEMAEGTTVRDLIELISSENPSFRSME---------ASLMVSVNQKYVDRME----VLNDGDEVAFIPPVSGG................ 81
363 3.000e-16UniRef50_D9QR55 Uncharacterized protein n=2 Tax=Acetohalobium TaxID=28186 RepID=D9QR55_ACEAZ  ali  19  1MQVQVKYFATFCLETDFIQQEEIKL--KSGATVKDLITRLSDRYGIGFKKRLFTKEGSLDSVSWIILNDKRLKKVKELELVLKSGDTISFSPPLVGG................ 96
364 3.000e-16UniRef50_A0A168LTT3 Ubiquitin-related modifier 1 n=31 Tax=Eukaryota TaxID=2759 RepID=A0A168LTT3_ABSGL  ali  45  5.NIKVEFSGGMELLFNNERKHQIALSSNDPATLQDLIFYIRDNMMTEKKDLFVDKD-TVRPGILVLINDVDWELCDELEYQLEDKDEVVFISTLHGG................ 105
365 3.000e-16UniRef50_A0A2S9YBY8 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Myxococcales TaxID=29 RepID=A0A2S9YBY8_9DELT  ali  15  1MRLTVLLFAGIRQRVGAA---QIELELPEPATVAQLREHIRATHP---------EIGDALDHCRIAVNQEFVRDT----HPVAPGDELALIPPVSGGAP.............. 83
366 3.000e-16UniRef50_A0A2V7UQ93 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7UQ93_9BACT  ali  13  29.KLTFRIPGPLLSFTGGRTVVDAE---AEASTVAEALDQLWRLYPGL-RDRVLTEQGQVRPHVNVFVGPDSIRDTGGLSTPLEGRVEIAIIPAVSGGVAPGR........... 125
367 3.000e-16UniRef50_A0A2R6AEV5 Uncharacterized protein n=3 Tax=Candidatus Marsarchaeota group 1 TaxID=2203770 RepID=A0A2R6AEV5_9ARCH  ali  16  1MKVRVKYFARVKEET---SLGEEEFELSSGEKLSELLQRVLQKHPSL-KSILLDEKGELKKGYQLFKNGKN----SLKDEVLSDGDVVAIIPPVAGG................ 89
368 3.000e-16UniRef50_A0A2V8M0T3 Uncharacterized protein n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8M0T3_9BACT  ali  15  2..ITILIAGYLTEFTGGRAEIKLN---GSPATVEEALSRLWGEHIGL-RDRVLTEQGEVRPHVNIFVNGETVSRNQVLKTSL-DGDEICIMPAVSGGCVSKVQSSSF...... 102
369 3.000e-16UniRef50_A0A0D6QFV3 Sulfur carrier protein CysO n=42 Tax=Bacteria TaxID=2 RepID=A0A0D6QFV3_9DELT  ali  16  1MSATLRLPAVLARAAGGTTVHEV-----RGATVGEVVAEVAGRFPEL-GTRLRDARGEPYPYVMFYLDDEDIRFQQGFATPVPDGAEIVVVPAIAGG................ 91
370 3.000e-16UniRef50_A0A0S7BMX2 Molybdopterin synthase subunit MoaD n=2 Tax=Longilinea arvoryzae TaxID=360412 RepID=A0A0S7BMX2_9CHLR  ali  13  1..MQINLYATFRLAAGVK---TIQIDLPSGATVYQAVQAAVEKYPAL-RVHWLNDAGEIHAHVHCLLNGDDVATLPKWNMPLHPDDTLDFFPPVVGG................ 92
371 3.000e-16UniRef50_A0A1S3KR54 Ubiquitin-related modifier 1 n=39 Tax=Eukaryota TaxID=2759 RepID=A0A1S3KR54_SALSA  ali  42  11........GGAELLFGSVKEHHVTLPNQEPWDMKQLLVWIRGNMLKE-RPELFVQGDTVRPGILVLINDADWELMGELEYELQDKDNVVFISTLHGG................ 99
372 4.000e-16UniRef50_A6R989 Ubiquitin-related modifier 1 n=68 Tax=Fungi TaxID=4751 RepID=URM1_AJECN  ali  42  17.TITVEFTGGLESIFNNTRKHTLSIPAPEPTSVASLVHYLIENVMEDTRQELFVVDGAVRPGILVLINDADWELEGEEKYQIQQGDNILFVSTLHGG................ 121
373 4.000e-16UniRef50_W4JUV6 Ubiquitin-related modifier 1 n=9 Tax=Agaricomycetes TaxID=155619 RepID=W4JUV6_9HOMO  ali  46  5.NIKIEFGGGLELLFSNQRSHRISLPAHQPANMDFLIQWLKENLLKE-RAELFVENDTVRPGILVLINDTDWELEGEGQYELKDGDEVVFISTLHGG................ 103
374 4.000e-16UniRef50_A0A202DIC2 Uncharacterized protein n=1 Tax=bacterium E08(2017) TaxID=1932693 RepID=A0A202DIC2_9BACT  ali  25  1MSIRVKIPSALRDATKGEAEV-----YGEGHNLKILIDGLESKYPGL-RDGIYDDGGRLQRFVNIFVNDTNIQSLSNELTSLEDGDEVVIVSAVS.................. 89
375 4.000e-16UniRef50_A0A2M8CMU2 MoaD/ThiS family protein n=2 Tax=unclassified Anaerolineae TaxID=1081798 RepID=A0A2M8CMU2_9CHLR  ali  15  33.AMNVNFYATLRQITGKK---TLMLDLPDGVTVRETLETCFGLFPAL-RAELMTADNQLHGHVHFFVNGRDVPYLDTLETRVSRADKLDVFPAVGGG................ 125
376 4.000e-16UniRef50_F2NNP7 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteria TaxID=2 RepID=F2NNP7_MARHT  ali  21  1MRVNVRLFAVYRERVGRA---HLELDLPEGATVRQAKTALEAQYPGLSLE-----------GGMVAVNQEFASGT----TPLREGDELAFLPPVSGG................ 79
377 4.000e-16UniRef50_A0A2P4Z025 Ubiquitin-related modifier 1 homolog n=7 Tax=Cryptosporidium TaxID=5806 RepID=A0A2P4Z025_9CRYT  ali  42  1MSIKVEFSGGLEVLAGDKQNVEVNLNNLKSNSMKSLILYVEENIIQYRKDHFIETGSKIKPGIIVLVNNCDWEILGGENYALNDGDLVTFIMTLHGG................ 97
378 4.000e-16UniRef50_A0A2M7CN76 MoaD/ThiS family protein n=1 Tax=Anaerolineae bacterium CG03_land_8_20_14_0_80_58_20 TaxID=1973905 RepID=A0A2M7CN76_9CHLR  ali  15  38..MKVNFYATLRAVVGKK---TIEVDLKPQATARDLVEVVVTDYPS-MRTELLDANNEFQSHMKFFINGREAVYLEKMNTVIQPDDKVDIFPPVGGG................ 129
379 4.000e-16UniRef50_O29699 Putative sulfur carrier protein AF_0552 n=5 Tax=cellular organisms TaxID=131567 RepID=Y552_ARCFU  ali  32  1MAIKVRLPASI-----NQGDLEID---AEKLTVNQLIALLSQITGKDLEKILKRD-GELSPFISIFVNGRNVRYAEGLETEVRSGDEVSIVPTVAGG................ 88
380 4.000e-16UniRef50_A0A1Y1HN11 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1HN11_KLENI  ali  19  68MRVKVLYFARAREATGSTEE---SAEIENGTTAKALLETLVRRFPKLQ---------EIRSCLVLAINQEYADG----SAVLKEGDEVALIPPISGG................ 148
381 4.000e-16UniRef50_K6CB91 MoaD family protein n=43 Tax=Bacillales TaxID=1385 RepID=K6CB91_BACAZ  ali  10  1MKVQVKVFANLREIC-NASVVEVE---TASLVVIDILEELVKMFPAMEDE-IFTEERTLKSFVHVFINGHNIIHKDGLLTKINPDDQFALFPPVAGG................ 92
382 4.000e-16UniRef50_A0A1F4QD29 Uncharacterized protein n=1 Tax=candidate division NC10 bacterium RBG_16_65_8 TaxID=1801657 RepID=A0A1F4QD29_9BACT  ali  14  4..........LARILGRQS---VQLDVKPGATVRTVLEALIAEHGGLQGRLFDPGTGGLLSYLFVELNGRDIRALQGLETSVQDGDALSVLIPVAGGA............... 88
383 4.000e-16UniRef50_D5ECM6 MoaD family protein n=2 Tax=Aminobacterium TaxID=81466 RepID=D5ECM6_AMICL  ali  16  1..MKLRVHAFLIYATGEK-----EFDMKAPATIRQLLEDFSNRFGEPFDKWIWSSNEVPHRGTIIMVNGKHIAHLNGLDTPLCDEDVVNIFPPVGGG................ 93
384 4.000e-16UniRef50_A0A0F8Y0R9 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F8Y0R9_9ZZZZ  ali  16  3.KITVRLYTTLKEKVGRGK---VELEAK---NVADALEELREQFGTKFTDQLYDPSGKIKNYYILLLSGHTVDKEEIKKTKVKEGDILHIFPPIAGG................ 92
385 4.000e-16UniRef50_E8N047 Uncharacterized protein n=3 Tax=Anaerolineaceae TaxID=292628 RepID=E8N047_ANATU  ali  18  3....INLYATFRLLAGTK---QIHLNLPENSTVRQALEDALRIVPAL-RPHWMNESGELHAHVHVLVNGQDVATLEGLETPLQTSAVLDVFPPVAGG................ 92
386 4.000e-16UniRef50_A0A2M7G045 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A2M7G045_9BACT  ali  15  1MKITLKTFAQLREKTG---RGQIELELPEQATLETCLKAFLQQFPELEQDL---------KHTRLALNQRYVR---DLTTPLKTNDEVALIPPVSGG................ 82
387 4.000e-16UniRef50_A0A1W9UJM4 Uncharacterized protein n=1 Tax=Anaerolineaceae bacterium 4572_32.2 TaxID=1971624 RepID=A0A1W9UJM4_9CHLR  ali  20  1MKVNLKLFLPVLPEAIGRKELKVEFV---GETVNDLIEHLVVRYGRKARQALHDEQGKLDPVIQILLNGKEWVTHDQLDTALEDGDSVMLMMMMAGG................ 94
388 4.000e-16UniRef50_A0A1W9X084 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Beggiatoa sp. 4572_84 TaxID=1972449 RepID=A0A1W9X084_9GAMM  ali  18  1MAIIVKFFASLREEVG---KSEVQMETPDSLTVAQVWAQVCDNAP-------------LPAHVLMAVNMEYANQ----DAPVKNGDEVAFFPPVTGG................ 77
389 4.000e-16UniRef50_UPI00044080BE ubiquitin-related modifier 1 n=1 Tax=Fomitiporia mediterranea (strain MF3/22) TaxID=694068 RepID=UPI00044080BE  ali  42  38..........................DVKPLDVNHLLCYLRDTLLKE-RVELFMENETIRPGILVLINDSDWALEGEGDYQLKEGDKIVFISTLHGG................ 107
390 5.000e-16UniRef50_A0A0F2NKD4 Uncharacterized protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0F2NKD4_9FIRM  ali  23  4..ITIKLAGSIALLTGGRDVLE-----SGASNVMGCIDDLEARFSG-IKNSLCDDSGNLKGVFNIYVNGENVKYLQGAVTPLEDGDEVSIIPAMAGG................ 92
391 5.000e-16UniRef50_A0A256XPJ9 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Thermofilum sp. ex4484_79 TaxID=2012527 RepID=A0A256XPJ9_9CREN  ali  26  1MKITILFFATLRDKFGKEKTVKLNR---NSTRLIEVISKV------DGLKEEIVEGGSIKKMYKILVNGINVEFLDKLDTLVRDGDEICIFPPAGGG................ 88
392 5.000e-16UniRef50_A0A0S8CGD4 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A0S8CGD4_9CHLR  ali  11  3.RVKVKSFSVIRDVLGSE---VVEIDVNEPETVGGLFQELLRRYGQPFKEKIWDPETGQIAPFLMKLNETIIRSTSDMDYKIHNGDKVAIIFPIGGG................ 95
393 5.000e-16UniRef50_A0A2E8TAN2 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A2E8TAN2_9CHLR  ali  28  1MAINVYIPTPFVKFTNGQSNIIV-----QKTNVLDALNEVVKSY-QQMEQLLFDTNGNLPEHINVYVNNQEIDSLEGLKTNLEDGDQVAIIPALSGG................ 91
394 5.000e-16UniRef50_F5YQC4 ThiamineS protein n=5 Tax=Bacteria TaxID=2 RepID=F5YQC4_TREPZ  ali  15  1MAVTILIPTALRNFTDRKSEVTTE-----GSTVGEALRNFTGTYP-DIKQHLY-QGEELRSFINVFVEETNIKKLQGLDTKIADGGTIMLVPAIAGGTS.............. 92
395 5.000e-16UniRef50_D7CIW8 MoaD family protein n=1 Tax=Syntrophothermus lipocalidus (strain DSM 12680 / TGB-C1) TaxID=643648 RepID=D7CIW8_SYNLT  ali  16  1..MKVLFFATLRKVTGCT-----ETEVHGPADLEGVLRELGARYGSAFKEKVF-PDGQLSRDVMVMINGHAVEHLGGSKAVVNEDDTIAIFPRLAGG................ 89
396 5.000e-16UniRef50_A0A290YXJ3 MoaD family sulfur carrier protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A290YXJ3_9ACTN  ali  19  4....VKLPAAFHVLTGGRRQLPVE-----GANIREVLVGLDQTCPGVL-ERLMDQEGSVKRYVNVYRNDSDIRSLDGLETKVEHHDVIWIVPAVAGGSEAAR........... 95
397 5.000e-16UniRef50_A0A1F8RQT5 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Chloroflexi bacterium RBG_16_68_14 TaxID=1797660 RepID=A0A1F8RQT5_9CHLR  ali  20  1MKVHVRLFAGLQDLLGQR---NVTLELADGATVSHLREQLGREYP------------VISPFLSTLVCAVDEEYVPG-DHALRDGDDVALIPPVSGGAEPELFRVTSE..... 92
398 5.000e-16UniRef50_A0A2U3E534 Ubiquitin-related modifier 1 n=1 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3E534_9HYPO  ali  37  35.TLTREPRGGLEMLFSDQRHHSVTLPSEHAADIAFLIDHLCDHVMKDTRKELFVLDGHIRPGVLVLINDADWELEGEEDSAIQPCDALVAVSSL................... 142
399 6.000e-16UniRef50_D3PKL1 Molybdopterin synthase sulfur carrier subunit n=38 Tax=Thermaceae TaxID=188786 RepID=D3PKL1_MEIRD  ali  18  1MRVQVLLFALFREQAGQAR---LQLELPEGSTVADVKALLEAQYPLRL------------SGGLAAIN----EQLAQPHQPLKDGDELAFLPPVSGGSTTP............ 82
400 6.000e-16UniRef50_A0A2V9HDF7 Molybdopterin converting factor subunit 1 n=10 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A2V9HDF7_9BACT  ali  20  26IRVTVLFFGRLKELTGHP---EHSIEFADATTIEHLFALYAARHPELAK---------YRSSVVASRNQEFAAW----DTPLRSGDEVAFLPPVSGG................ 106
401 6.000e-16UniRef50_A0A2N2HD20 Molybdopterin synthase sulfur carrier subunit n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2N2H  ali  14  7VKIIVKGYFNLQKAMENKSLVEVE---KAAATIREVLDDLSRRFGREFIETICEPDRQPAGHIMLLVNGRNYLTLPGLDTELKDGDEIALFPPIAGG................ 102
402 6.000e-16UniRef50_B5Y6W1 MoaD family protein n=1 Tax=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) TaxID=309798 RepID=B5Y6W1_COPPD  ali  22  1MKLEVEFFATLRLKLPKP---TYEVDMPEGSTVKDLMRELDRITGQPVSEELFRGDEVI-PGTVLLLNGKNILHLNGIHTPLEPG-KVAVFPPVAGG................ 92
403 7.000e-16UniRef50_A0A2H6JWW7 Sulfur carrier protein CysO n=1 Tax=archaeon BMS3Bbin15 TaxID=2005738 RepID=A0A2H6JWW7_9ARCH  ali  12  2..VIVRLATPLRKFSGGKPEIKVE-----GSTVREVIENIEARSPGFADKILDDND--IKQFINIFHNNEDIRFQKAIDTEIKPDDVLSILPAVSGG................ 89
404 7.000e-16UniRef50_G2MKY9 ThiamineS protein n=28 Tax=Halobacteria TaxID=183963 RepID=G2MKY9_9EURY  ali  19  1MNVECRLFGPFRDDVG---EEHVGGEYAVGTTAGDLLCDLESTYSELEGRLVDEGEETTAGQTVVSLNEKNITHREGLETELEDGDVVRIVPSVYGG................ 94
405 7.000e-16UniRef50_A9WDC0 Molybdopterin synthase sulfur carrier subunit n=7 Tax=Bacteria TaxID=2 RepID=A9WDC0_CHLAA  ali  20  2ITVTVRFFAGHRDIVG---RSEASYTLAEGTTLGQLWEQLTAEYPRLTG---------YTGRLLFAVNQQFAQ----PTTVLANGDEVAFIPPVSGG................ 82
406 7.000e-16UniRef50_A0A2E0S3D7 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E0S3D7_9CHLR  ali  15  1..MKWKLFANFAEIAG---EREIEIRMDSGITIEDALEDLFDQIPKL-RELVMDEQGGVLNHVQVLCNGEEMRGEKFSQLALENDDELAIIPPMSGG................ 91
407 7.000e-16UniRef50_A0A2D6RZK4 Uncharacterized protein n=1 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2D6RZK4_9BACT  ali  18  1MKVTVRYFAVCRQMFNRDEE---DIELPEGAILQDVLDQLKEEKP---------EISELFETMQMSVNWQYADH----ETKLSNNDEVALIPPVTGGSPTS............ 85
408 7.000e-16UniRef50_Q5ZJU4 Ubiquitin-related modifier 1 n=69 Tax=Opisthokonta TaxID=33154 RepID=URM1_CHICK  ali  38  5VSLQVEFGGGAELLFDGVKKHQVTLPSPEPWDIRNLLKWIKQNLLKE-RPELFMQGESVRPGILVLINDADWELMGELDYKLQDQDNVLFISTLHGG................ 101
409 7.000e-16UniRef50_A0A2E5YLR5 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E5YLR5_9DELT  ali  17  64MKITLKLFGSLREAAGN---STLQVELEEGALVRDVWNWLAECHPRVERL-----GDRLAASVNLEI--------GDLGDVLEDGDEVAFLPPVAGGDGSPPE.......... 150
410 7.000e-16UniRef50_A0A2D8MUK5 Molybdopterin synthase sulfur carrier subunit n=14 Tax=Bacteria TaxID=2 RepID=A0A2D8MUK5_9CHLR  ali  21  1MAI-VKIPTPLRNLTENKTEIQI-----NGKTIIEIIENLDSMYIGIKDKIL--NNGELKHFVNIYVNGEDIRYINSLETSIDNNDEISIVPAVAGG................ 89
411 7.000e-16UniRef50_B3LTL7 Ubiquitin-related modifier 1 n=9 Tax=Saccharomyces TaxID=4930 RepID=URM1_YEAS1  ali  41  2VNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVIFIEDDSIRPGIITLINDTDWELEGEKDYILEDGDIISFTSTLHGG................ 99
412 7.000e-16UniRef50_A0A2W0AMC0 Uncharacterized protein n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2W0AMC0_9BACT  ali  11  57VSVTFHIPGALREFTAGRSTVEIE---QLAGTLADALSGLWTLYPG-VRDRIVTEQGQVRQHINIFIGAENVRYTGGLASPVSNGSEISIVPAVSGG................ 149
413 7.000e-16UniRef50_A0A1T5M889 ThiS family protein n=1 Tax=Maledivibacter halophilus TaxID=36842 RepID=A0A1T5M889_9CLOT  ali  18  2IKVTVKTILGMDKYLGNKLSQEIEL--KENSTVKELISIMANIYGESIISLLLTEDNTPKRGIAMFLNGRNIFARDGLKTILKDRDEFLIFPPVGGG................ 96
414 8.000e-16UniRef50_A0A2G6E9Q2 Molybdopterin synthase sulfur carrier subunit n=2 Tax=candidate division KSB3 bacterium TaxID=2044937 RepID=A0A2G6E9Q2_9BACT  ali  21  17MTITVKFFASFQEILGTNSVLL--SPEEDIACVADLIEYLEQQYPVF--------EGRLEKRSLVAVNEQYSQRHRH----LSDGDVIAFFPPVSGG................ 99
415 8.000e-16UniRef50_A0A1I7WJ44 Ubiquitin-related modifier 1 homolog n=1 Tax=Heterorhabditis bacteriophora TaxID=37862 RepID=A0A1I7WJ44_HETBA  ali  32  5ISVTIEFSGGSEFLVGNQKEHSVQVPLVEGKTVTNLLEWIRDVLLKDDRPELLLDGNTVRPGVLVLINECDWELMDKAETHLKGGDVITFISTLHGGECFLTQAQ........ 111
416 8.000e-16UniRef50_A0A239E3W1 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Bacteria TaxID=2 RepID=A0A239E3W1_9BACT  ali  22  1MHIDVLYFGVLKELF---QTSQTQVELPGGANVGELVNLLQKT---------TSNQTSPWRSLAVAVNREYA----GMDTMLQDGDEVALLPPVSGGSPCA............ 85
417 8.000e-16UniRef50_A0A1V5AAM5 ThiS family protein n=5 Tax=unclassified Methanoregulaceae TaxID=1811719 RepID=A0A1V5AAM5_9EURY  ali  20  6..VRVRAFARYRELFGER----VEVTVPAPATVRDVVMAVGQSNPIGMGE-LVDSSGRVKPSVIILVNRERVTGSHREDHPVAGGDEVAIYPPVAGG................ 95
418 8.000e-16UniRef50_UPI0003B720A8 MoaD/ThiS family protein n=1 Tax=Thermodesulfatator atlanticus TaxID=501497 RepID=UPI0003B720A8  ali  26  39..VKFKLFGTLRL---TYRPSEGEIEIDSSLKLKDLIKELDKRYPGVYEKLV--NQERLRPGVVILKNGKNVLHLEGLETEIVPGDTVVIFPPGAGG................ 128
419 8.000e-16UniRef50_F0JC26 Thiamine S protein n=2 Tax=Desulfovibrio desulfuricans TaxID=876 RepID=F0JC26_DESDE  ali  18  1MRIVIASFATVKAVLGARS---FDLDVPDHSTVRDVMAILLDRFGKPLADEMYDSPGCLKENYLLMVNGQTVRFLNGMETVMGEGDELLIFSPVCGG................ 94
420 9.000e-16UniRef50_A0A1V6ACC5 ThiS family protein n=2 Tax=Candidatus Aminicenantes bacterium ADurb.Bin147 TaxID=1852831 RepID=A0A1V6ACC5_9BACT  ali  15  9MTVRVRFFAAFRQTFGGKERI---FELEEGTTLGRLLERLGDS-PARRDEIFAAGEAGLHPHVVVMINGENASARGGWSGELRSGDTVAVFPLMGGG................ 105
421 9.000e-16UniRef50_A0A1F7SDH5 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Bacteria TaxID=2 RepID=A0A1F7SDH5_9BACT  ali  16  1MKVKIKFFAALRE---GIGKSEIEINIPSGSRLNGLIERLEKEYKAIA---------EFKTSIAYSINMEYVRG----DEVLKEGDEIALIPPVSGGCP.............. 83
422 9.000e-16UniRef50_H9ZZN1 Molybdopterin converting factor, subunit 1 n=2 Tax=Fervidicoccus fontis TaxID=683846 RepID=H9ZZN1_FERFK  ali  21  2..VKVRLFAMLYELTNKK-----ELEVENANTVREIIEKLDSMYPGFK--------GFLEKGYLILVNGINIVHLNDLDTKVNDTDVVSIFPKVGGG................ 83
423 9.000e-16UniRef50_A0A158PH61 Ubiquitin-related modifier 1 homolog n=5 Tax=Strongylida TaxID=6308 RepID=A0A158PH61_ANGCS  ali  36  67VSLTIEFSGGCEFLVGNKKEHKVSFPDEDFVTVADVIRHVKDVMLKDDRQDLLIEGETIRPGVLVLVNECDWELLDCEKCQLYNGDLVTFISTLHGG................ 165
424 1.000e-15UniRef50_C7N2G5 MoaD family protein n=7 Tax=Terrabacteria group TaxID=1783272 RepID=C7N2G5_SLAHD  ali  15  3....VKFFATYRQIAGCKS-----CDVPAPQDVLALMEELSKRWPEFRNLILNEDGTDKGDDVIIMVNGRHIEHLEGVATPLTEQDYVAVTPLVAGG................ 90
425 1.000e-15UniRef50_E6N929 Molybdenum cofactor biosynthesis protein D n=2 Tax=Archaea TaxID=2157 RepID=E6N929_9ARCH  ali  14  7.KILTKYYAVLRERVGKASE---EFELPQGSTVIDFLEKLRQVYGGVLGDLF--EGDGLRTGFALALNGESLDRKLWASTRLKDGDVVVVLPPIAGG................ 97
426 1.000e-15UniRef50_A0A0M0BSR0 Uncharacterized protein n=1 Tax=miscellaneous Crenarchaeota group-1 archaeon SG8-32-3 TaxID=1685125 RepID=A0A0M0BSR0_9ARCH  ali  29  1MAIAVKFVGALRHFSG---ASELFLHCKDCISIGEMINELVMEVPELKKGLIDQQLGDLRSNALILVNDREIGVLNSLETKLNDGDEVVLVPVVHGG................ 94
427 1.000e-15UniRef50_UPI0008F92BC5 MoaD family protein n=1 Tax=Bacillus tuaregi TaxID=1816695 RepID=UPI0008F92BC5  ali  13  3....IKFFAYVRDYT-----HKKVIEMEPCETVEELLKVLSSRYGKPFKTNVFPDN-KLSDEMIILVNGRHIDHCDGVHTKLMDEDVICIIPVVAGG................ 89
428 1.000e-15UniRef50_UPI0008DB114C hypothetical protein n=1 Tax=Halofilum ochraceum TaxID=1611323 RepID=UPI0008DB114C  ali  18  3.EVTLRIPTPLQPYADGNGELR-----AEAGYVDELLERIGADHQALI-QRIRTRDGQLRPYVNVFVRRTDIRQLQGLETELHDGDEVIVMPSVAGG................ 92
429 1.000e-15UniRef50_A0A1G1WNV1 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Candidatus Woykebacteria bacterium RIFCSPHIGHO2_12_FULL_45_10 TaxID=1802603  ali  22  1MEFTIKIPAQLLSHSNNQEKVHVVV--HEGATMDQLLDALETLCPG-IKGRLVDEEGKQRRFVNLYVNRDDIRLGEGLATVLKEGDEITIVPGMAGG................ 94
430 1.000e-15UniRef50_A0A164YJ44 Ubiquitin-related modifier 1 n=4 Tax=Eukaryota TaxID=2759 RepID=A0A164YJ44_9HOMO  ali  49  4VSLKVEFSGGLELLFNNQRQIKLDLPAQAPADVRYLIHWLKDNRLKE-RPELFVENGTVRPGILVLINDTDWELEGEEEYVLENGDDIVFISTLHGG................ 105
431 1.000e-15UniRef50_A0A0Q1AKB9 Uncharacterized protein n=1 Tax=Methanoculleus sp. SDB TaxID=1735326 RepID=A0A0Q1AKB9_9EURY  ali  18  12IKIRIRAFARFREIFG----EETELSVPDGTTLAGALAEFAARSPEG-RGALYEPGGALHRYVVLMKNGARIGHASAGADVLREGDELVVYPPVAGG................ 103
432 1.000e-15UniRef50_J3P3A4 Ubiquitin-related modifier 1 n=18 Tax=Sordariomycetes TaxID=147550 RepID=J3P3A4_GAGT3  ali  46  48..IVVEFSGGLEMLFSHQVRHQLALPNADPATIAFLIGYLCRHAMKDARRHLFVLDGHLRPGILVLINDADWELEGEEEYVIQPGDNILFVSTLHGG................ 146
433 1.000e-15UniRef50_A0A2E6NN02 Uncharacterized protein n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2E6NN02_9BACT  ali  22  1MKVNIRYCGQLKQAAGCPSE---ELGLEDCLSAQELIASVAENHGEPLAGYLLDESGRLRATVLAFVNEEQVDW--ETARPLGDGDELVFMSAIAGG................ 92
434 1.000e-15UniRef50_Q7KU86 Ubiquitin-related modifier 1 homolog n=96 Tax=Eukaryota TaxID=2759 RepID=URM1_DROME  ali  41  7.KIILEFSAGAELLFGNIKRRELNLDGKQKWTIANLLKWMHANILTE-RPELFLQGDTVRPGILVLINDTDWELLGELDYELQPNDNVLFISTLHGG................ 101
435 1.000e-15UniRef50_G2Q7Q2 Ubiquitin-related modifier 1 n=60 Tax=Opisthokonta TaxID=33154 RepID=G2Q7Q2_MYCTT  ali  39  10IPITVDFSGGLEMLFDNQRRHTVALPSGKPATVAFLIDYLCKNLMRDPRAELFVLDNHIRPGILVLINDADWELEGEEAYEIQPNDNILFVSTLHGG................ 110
436 1.000e-15UniRef50_A0A2U1S3I5 Molybdopterin converting factor subunit 1 n=3 Tax=Bacteria TaxID=2 RepID=A0A2U1S3I5_9BACT  ali  18  11MKIRVRCFASIREIVG---AYELVVDLPEGSTLNQLLRDLCERFPRLQ---------ALRGSLLFSVNREYAA----IDTTLTEEDDVALIPPVSGGAD.............. 93
437 1.000e-15UniRef50_A0A1F2UNR9 Molybdopterin synthase sulfur carrier subunit n=4 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1F2UNR9_9B  ali  23  1MSIQVRIPAITR---GKTGSATVEV---AAHNLSELLAALEALYPG-VKKTICDDSGKLNRFVNVFVNDEDIRFLGGEGYRFQDGDEVLLIPSIAGG................ 91
438 1.000e-15UniRef50_D3T0P4 MoaD family protein n=40 Tax=Halobacteria TaxID=183963 RepID=D3T0P4_NATMM  ali  19  6.....KLFADLAEHAGDK---HVTVDASAGDTVDDALSDLVDDRPAIADRVL-TDDGDLRSQINVLRNGTNVLEEDGLETELEEGDELALFPPVSGG................ 94
439 1.000e-15UniRef50_A0A2V6R7L0 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6R7L0_9BACT  ali  13  1MRVAVRFFARYREATGRER---LELELPDGGTVEAAWAAVVGRHPELAR---------YRPFTLFAIGNDYV----DPDQTLRPGDELCVFPPVSGGGG.............. 83
440 1.000e-15UniRef50_B8G9X3 Molybdopterin synthase sulfur carrier subunit n=9 Tax=Bacteria TaxID=2 RepID=B8G9X3_CHLAD  ali  18  2ITVTVRFFAGHRDIVGRA---TAQYTVANGTTVGQLWELLVADYPRLAG---------YTGRLLFAVNQQ----FGQPATVLADGDEVAFIPPVSGG................ 82
441 1.000e-15UniRef50_A0A2H0PHG5 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_47_16 TaxID=197  ali  20  7MKVSVLFFASFRELMNTD---QVELNLPESFTAGEVLDRVCTN---------EVRAMSWRRIMKLAVNDCYVAH----DTPLKDGDVVAIIPPIAGG................ 87
442 1.000e-15UniRef50_Q1IPZ2 Molybdopterin synthase sulfur carrier subunit n=49 Tax=root TaxID=1 RepID=Q1IPZ2_KORVE  ali  18  1MKVKVIYFGMLREIAGSQQEP---IEVAEGATAGMLFAQVLAKYPEMAR---------FEKSLAIAVNLEYSAHSQ----PLKEGDEVALIPPVSGGNSSRCEIVRER..... 92
443 1.000e-15UniRef50_Q9C245 Ubiquitin-related modifier 1 n=120 Tax=Eukaryota TaxID=2759 RepID=URM1_NEUCR  ali  45  11..ITVDFSGGLEILFSNQKHHALSVPAQDPANVGFLINYLCQTLMTDPRADLFVLGGELRPGILCLINDCDWELEEEDAYVLQPGDNILFISTLHGG................ 109
444 1.000e-15UniRef50_D9TD81 MoaD family protein n=53 Tax=Actinobacteria TaxID=201174 RepID=D9TD81_MICAI  ali  25  1MAIEVRIPTILRSYTGGAKVVE-----GSGDTLADLIADLDSRHGGL-KARLVTEAGVLHRFVNVYVNDEDVRFLGALDAKLNDGD........................... 80
445 1.000e-15UniRef50_Q583L0 Ubiquitin-related modifier 1 homolog n=15 Tax=Trypanosomatidae TaxID=5654 RepID=Q583L0_TRYB2  ali  39  6.HITVQFAGGCELLFAKQTSLQLDGVVPTGTNLNGLVQLLKTNYVKERPDLLVDQTGQLRPGILVLVNSCDAEVVGGMDYVLNDGDTVEFISTLHGG................ 102
446 1.000e-15UniRef50_A0A2V8A7K9 Molybdopterin converting factor subunit 1 n=4 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8A7K9_9BACT  ali  20  48VRVTVKLFARLRDIAGSP---ELARDVAPGATIGSVWRELAREFPELARYE---------RSISSAVNTDYAR----MDHVLSDGDEVAFLPPVSGG................ 128
447 1.000e-15UniRef50_A0A1V5DU73 ThiS family protein n=1 Tax=Syntrophaceae bacterium PtaU1.Bin231 TaxID=1811718 RepID=A0A1V5DU73_9DELT  ali  14  4ITVEVRAFADFRSVLGARTKVVLS----EGQTVKDLLEVLFERHDGL-REKILDSEGRPGEGVDIILNGRNVGYTKDLTVKLRDGDQIFFFPPLSGG................ 95
448 1.000e-15UniRef50_A0A2V7XJX8 Molybdopterin converting factor subunit 1 n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7XJX8_9BACT  ali  14  1MKVRLLYFAVLRDIAGKGEEV---IELPDGTRAADVWNRLRAQHRALAGYE---------RPPMTAINETYVAA----DQVLRDGDEVAFIPPVAGG................ 81
449 1.000e-15UniRef50_A0A1F8SFL4 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Chloroflexi bacterium RBG_16_69_14 TaxID=1797661 RepID=A0A1F8SFL4_9CHLR  ali  14  3...TVRIPPTLRAATGGAKQVEV-----PGGTVREVVAGLVVLHPSLESQLI-GPDGDLNRFVNAFLNDTDVRHLEALDTPVGESDTLVLLPAMAGG................ 90
450 1.000e-15UniRef50_Q6FWQ3 Ubiquitin-related modifier 1 n=54 Tax=cellular organisms TaxID=131567 RepID=URM1_CANGA  ali  43  2VKVRVEFLGGLDVIVNKQRVYDLDVPSQVE-NVGDLIDYIIENLITNKKDEVFIENDSIRPGIITLINDTDWELENEKEYVIEDGDVISFTSTLHGG................ 98
451 1.000e-15UniRef50_A0A0V1G307 Ubiquitin-related modifier 1 homolog n=7 Tax=Ecdysozoa TaxID=1206794 RepID=A0A0V1G307_TRIPS  ali  34  1MQLTLEFVGGSERLLKCERMHEIELDDGRAWTLASLFQWIKQNMLLVNNCRMLIDGNSVRPGILVLINEVDWELCDGLQYVLKPNDKVTFISTLHGG................ 102
452 2.000e-15UniRef50_I4ERW1 ThiamineS n=51 Tax=Actinobacteria TaxID=201174 RepID=I4ERW1_9ACTN  ali  19  1MTVQVLLPRLLAECAGGRTSMA--LDAPAPATVGALLDLLAAEHPVLGRR-VRDETGALRRHVNVYVDGEEVRRLSGLGTPVPADAEVMVVQSVAGG................ 94
453 2.000e-15UniRef50_A0A2V7EYR7 Molybdenum cofactor biosynthesis protein MoaE n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V7EYR7_9BACT  ali  14  92VRVRVRLFARYREATGRDR---IELDLPEGGTVESAWSAVAERHPELAR---------YRPFTLFAVGNEYVAA----EHRLRPDDELCLFPPVSGGAGGDTYRVV....... 181
454 2.000e-15UniRef50_A0A1X0P9S0 Ubiquitin-related modifier 1 homolog n=1 Tax=Trypanosoma theileri TaxID=67003 RepID=A0A1X0P9S0_9TRYP  ali  37  6.RITVQFAGGCELLFDKQTVLRLDDVVPHETTINGLVQLLKERYVKERPDLFVDHSGKLRPGILTLVNSCDAEVVGGLDYVLNEGDVVEFISTLHGG................ 102
455 2.000e-15UniRef50_D5MEV6 Molybdopterin synthase sulfur carrier subunit n=4 Tax=cellular organisms TaxID=131567 RepID=D5MEV6_9BACT  ali  20  1MNIRVRCFAAVREIVG---VGELVVELPEGSTLDQLIHQLQSQFPKLQ---------ALTGSLLFSVNREYASA----DTRLAAGDEVALIPPVSGGTD.............. 83
456 2.000e-15UniRef50_UPI0007822C11 MoaD/ThiS family protein n=1 Tax=Methanogenium cariaci TaxID=2197 RepID=UPI0007822C11  ali  19  16MRITLRSFARFREIFGGEEQ---TIETTSAATPKTVLSALCEEKG--CKDTLFAADGTFHPHITVILNGRRLSAEEIEETSLADNDALVVYPPVSGG................ 107
457 2.000e-15UniRef50_A0A0X8D368 Molybdopterin synthase sulfur carrier subunit n=6 Tax=Aneurinibacillus TaxID=55079 RepID=A0A0X8D368_9BACL  ali  18  2..ITIKLFAAMAEEAGKE---TIEMTWQEGMTTEDVKRWLAEQYPSLASRI---------PAAMVAVNQEFAAFAN----PLQDGDEVAFIPPVSGG................ 80
458 2.000e-15UniRef50_D6TJF3 Thiamine S protein n=7 Tax=Ktedonobacteria TaxID=388447 RepID=D6TJF3_9CHLR  ali  17  1MKIRIRYFASLREVTGQSDEL---LDIADGTSIAEIKKDLVTRYPRLQD---------ILERCLCALNRAYVP----PETALHENDELVFIPPMGGGSEP............. 84
459 2.000e-15UniRef50_A0A2A5FKE2 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2A5FKE2_9BACT  ali  21  3...TLIIPTPLRKFTEGESIYT-----ASASNVKELLVALYTSH-DGIKKHLFDDEGELRSFIRVYLGDEDINELEGVNTKLEDRDEVSIIPAIAGGS............... 91
460 2.000e-15UniRef50_A0A1I8AWT7 Ubiquitin-related modifier 1 homolog n=1 Tax=Steinernema glaseri TaxID=37863 RepID=A0A1I8AWT7_9BILA  ali  40  1MKLALEFAGGSQTLVKNQSRHEIELEDGKEWLMSDLLDWILQNLLVDCSPDLLIKDGNVRPGILVLVNDTDWELLGNVDTVISEGDTVTFLSTLHGG................ 98
461 2.000e-15UniRef50_A0A2E7JL17 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A2E7JL17_9BACT  ali  17  1MKIKALFFASCRDIVGNR---EMDLDVAEGARVQELRSELLGNYPRLA---------ALDEVLSIAVNSEYVDDT----TILNPGDEVAFIPPVSGG................ 81
462 2.000e-15UniRef50_D2RGC9 MoaD family protein n=3 Tax=Archaeoglobaceae TaxID=2232 RepID=D2RGC9_ARCPA  ali  20  1MRVKVQLFATLRRF---GKEFEVE-----GNSLEEILKKLAERLGEEFYREIFDENGKIRSDRIITVDGRNIKDERP---KLKEGSVIAIFPPIAGG................ 86
463 2.000e-15UniRef50_F9X499 Ubiquitin-related modifier 1 n=54 Tax=cellular organisms TaxID=131567 RepID=F9X499_ZYMTI  ali  46  5INIVVEFTGGLELLFSDQRQHKISLPAKDPTSVAYLIKWLCDNLMKDPRKDMFVLDDTVRPGILVLINDADWELEGEDKYELQNGDNIIFVSTLHGG................ 105
464 2.000e-15UniRef50_A0A2H0ZD99 Ubiquitin-related modifier 1 n=4 Tax=Clavispora/Candida clade TaxID=1540022 RepID=A0A2H0ZD99_CANAR  ali  45  21IKVKVEFLGGLDVISNKVREHRLTLPLEEGATLRDVIEHITKEIIADEKDIVFIEEGTVRPGILVLINDTDWELEEREDYVVEAGDVFTFTSTLHGG................ 119
465 2.000e-15UniRef50_A0A0G4N3V4 Ubiquitin-related modifier 1 (Fragment) n=3 Tax=Verticillium TaxID=1036719 RepID=A0A0G4N3V4_9PEZI  ali  44 1050...TVEFSGGLEMLFEDQRKHAVSIEDGQPATIAHLIDHLCKNVMKDSRKELFVLDDHIRPGILVLINDADWELEGEEAYELKAGDNILFVSTLHGG................ 1147
466 2.000e-15UniRef50_A0A2E8RKQ4 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2E8RKQ4_9BACT  ali  16  1MKIEVRYFAFFRQQIGRTSD---EINLPSPATVADLLNSLRTIYPEVKDAL---------NTAQISVNMEFV----TLDTPLSARDEVALIPPVSGGNMNSDELGLFK..... 92
467 2.000e-15UniRef50_G7VAH0 MoaD family protein n=2 Tax=Synergistales TaxID=649776 RepID=G7VAH0_THELD  ali  23  3...KVKLFATLVEIA-KRKEIEIE-----AKTAREVLDKLKGLYGPSFEKEL-------EHGMIFLVNGRDIAHLQGLDTPVNEDDVISLFPPIGGG................ 83
468 2.000e-15UniRef50_A0A1H0NQC7 Molybdopterin synthase subunit MoaD n=2 Tax=Arthrobacter sp. ok909 TaxID=1761746 RepID=A0A1H0NQC7_9MICC  ali  23  16.AISVVLPSVLQPLAGGQSI--LTAPAEEAVTVEWVLDTVTGDYPALSRR-LRDETGTVRRYVNIYVNGNEIRRLQGLVTTVAPGQEVLIIQSVAGG................ 108
469 2.000e-15UniRef50_A0A2V6QVP9 Uncharacterized protein n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6QVP9_9BACT  ali  17  231.HVTVRLPRLLAGLIGGALETTVEAD-----TLAAALDTLIARHPEL-GVHLFDESGKFRGHVLCFHNEDNTRWLPSLERPVKSGDVITIMQAVTGG................ 320
470 2.000e-15UniRef50_E8QXB9 ThiamineS protein n=1 Tax=Isosphaera pallida (strain ATCC 43644 / DSM 9630 / IS1B) TaxID=575540 RepID=E8QXB9_ISOPI  ali  15  3...TVRIPPMLRAQTGGKDTLEV-----PGGTVAEVLARVAADHPDLGERM--YKNGELQRFLNIYLNDEDVRYLDELNEPVKETDEIAIIPNVAGG................ 90
471 2.000e-15UniRef50_Q148F0 Ubiquitin-related modifier 1 n=4 Tax=Bovidae TaxID=9895 RepID=URM1_BOVIN  ali  41  6.SVEVEFGGGAELLFDGVKKHQVTLPGEEPWDIRSLLVWIKKNLLKE-RPELFIQGDSVRPGILVLVNDADWELLGELDYQLQDQDSVLFISTLHGG................ 101
472 2.000e-15UniRef50_Q9P3U9 Ubiquitin-related modifier 1 n=6 Tax=Ascomycota TaxID=4890 RepID=URM1_SCHPO  ali  98  1MAIKVELLGGLDLLFNKQKALSLSLSNLGSTKLGSLIDYMAQIIEKPSQKDLFILNGTVRPGIIVLVNDQDWELLEKEEYNLEEGDEVVFVSTLHGG................ 97
473 2.000e-15UniRef50_A0A2E8FG50 Uncharacterized protein n=3 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E8FG50_9PLAN  ali  18  1MNVTVEYAAQVKQVAGIGSE---SIELAAPCTIAELARQVAERHGGPLSNILLDGEGAPRRSILVFLGEDQVRW-DDDSTLVRDGDTVTLLSPVSGG................ 93
474 2.000e-15UniRef50_A7C5P4 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A7C5P4_9GAMM  ali  18  1MTIIVKFFASLREEMG---KSEVQLEATDSLTVAQVWAQVCNNTP-------------LPSHILIAINQEYSEQ----NALVKDGDEIAFFPPVTGG................ 77
475 2.000e-15UniRef50_V4GU32 MoaD and/or ThiS family n=9 Tax=root TaxID=1 RepID=V4GU32_9DELT  ali  18  1MSITIAVPGSLKGLLNGSNQATCE-----GKTIRECIDALDSKIPG-FKNKVLDEKGEINKSFMIFLDGQNLRILDGLATSVKDGDEVNIIPFAAGG................ 91
476 2.000e-15UniRef50_X0SYH1 Uncharacterized protein n=4 Tax=root TaxID=1 RepID=X0SYH1_9ZZZZ  ali  17  6IKVTVEVMSWLKEDFGGWDTLVIEEAVPTGASVMDLLHTLAGKYSAFGKKAFAVEQKITFDYCAVIWNGTFLADLAELDTELKDGDTVKLIPNLYGG................ 104
477 2.000e-15UniRef50_A0A1Q9PEU2 Uncharacterized protein n=1 Tax=Candidatus Heimdallarchaeota archaeon AB_125 TaxID=1841596 RepID=A0A1Q9PEU2_9ARCH  ali  13  3.NVEIITFTRIKEIIGKKKFYY------EANSIEDLLNSFFEKYGDILKDEILDNDGKIKKHYRIIVNGRNINILDGFRTKLNDGDMVALMPAIAGG................ 92
478 2.000e-15UniRef50_H5SQW8 Molybdenum cofactor biosynthesis protein D n=3 Tax=Bacteria TaxID=2 RepID=H5SQW8_ACEAU  ali  22  1MRVRVKLFSLLREAVGT-GEFFVNF---SGETAGELWEELERQHPALA---------PFRPARAIAVN----RHHAREDARLSDGDEVAFFPPVSGG................ 80
479 2.000e-15UniRef50_A0A2M8QDF3 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8QDF3_9CHLR  ali  13  3...KVWIPSLLRGLTGGLAEVQ-----ADGVTVRQVIEDLDRRYPGIAARLIEADRDRLKPNLTLVVDGVN--SKQGLRHPVSETSEIHFVPAMSGGCSTLRWHQREKA.... 101
480 2.000e-15UniRef50_A0A132N3F7 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Streptomyces thermoautotrophicus TaxID=1469144 RepID=A0A132N3F7_9ACTN  ali  29  1MQISVLYFGVLREQLAKTAE---TIVLPDGSTLQSLLDTLRERYPSLDR---------VKHMIKVAVN----EDLASMEHVLREGDEVALLPPIAGGAEGP............ 85
481 2.000e-15UniRef50_A0A2V9MB36 Uncharacterized protein n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9MB36_9BACT  ali  18  1MKIKVLLFARLREIVGCE---MVELYRNEMLTVRDVWDTLRAQFPQVEG---------FGKSLLFCVNQE----FADLDTRIKEGDELAIFPPVSGG................ 81
482 2.000e-15UniRef50_A0A0T9KJ46 9.5 kDa culture filtrate antigen cfp10A n=29 Tax=Bacteria TaxID=2 RepID=A0A0T9KJ46_YERKR  ali  22  1MAVTLLIPSALRAFTDGQGKVGLE-----GENVGELVAALAEHYP-DIRQHLYEDDGSLRSFINLYVGDANIKTTGGLDTPVNSGDEVILVP..................... 86
483 2.000e-15UniRef50_A0A1T5FP88 Molybdopterin synthase subunit MoaD n=11 Tax=Actinobacteria TaxID=201174 RepID=A0A1T5FP88_9MICC  ali  21  16.TISVVLPSVLQPLAGGQSI--LTAPAEAAVTVEWVLDTVTGDYPALSRR-LRDETGSVRRYVNIYVNGNEIRRLQGLVTAVAPGQEVLIIQSVAGG................ 108
484 2.000e-15UniRef50_A0A0M8ZR18 Ubiquitin-related modifier 1 homolog n=1 Tax=Melipona quadrifasciata TaxID=166423 RepID=A0A0M8ZR18_9HYME  ali  44  23......FRGGAELLFDKKKKHSVNLPGND-WTIQKLLFWMKNNLLKE-RPELFMQDDTVRPGILVLVNDTDWELLN..................................... 90
485 2.000e-15UniRef50_A0A212C386 Ubiquitin-related modifier 1 n=1 Tax=Cervus elaphus hippelaphus TaxID=46360 RepID=A0A212C386_CEREH  ali  33  28LSVEAEFGGSVAILFNSVEKHQVTLPGQEPWDIPNLLSRVARAVFP--RQQLFIPAGRDSG---VLINDADWELLN---YQLQDQDSVLVISTLHGG................ 117
486 3.000e-15UniRef50_Q12W49 Molybdopterin synthase small subunit n=34 Tax=Methanosarcinales TaxID=94695 RepID=Q12W49_METBU  ali  20  22..VKIKLFANLREIAG---VSELELE---GENIQEILDILQNDHPQIQELIYDDDRGEIRAYINILINGNNIQHLEGSDTVLNEGDEIAIFPPVSGG................ 112
487 3.000e-15UniRef50_R4TID8 Thiamine S protein n=82 Tax=Actinobacteria TaxID=201174 RepID=R4TID8_AMYOR  ali  19  2..VRVLLPAMLRPLAGGAGTLDVDAP-----TLDAVLDSLGAGFPALERR-LRDETGALRRYVNFYVDGEECRRLDGAKTSLAEAEEVQIIPSVAGG................ 90
488 3.000e-15UniRef50_A0A1Q7PM49 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium 13_1_40CM_3_65_7 TaxID=1805024 RepID=A0A1Q7PM49_9BACT  ali  17  9MNVRVVLFAKPRELVGQP---NIDLSLPAGATAADAWGQLSTRY----------DLGPLPRSFRCAVNSEYA----GWDDPLKDGDELAVIPPVSGGAIGQRRGIV....... 97
489 3.000e-15UniRef50_A0A1Q7HX41 Uncharacterized protein n=3 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1Q7HX41_9CHLR  ali  20  7.AVTVRLPGSLREIVGGTGKIE-----ARGETLGDVIANIEARFPGFAGRVL-DEKGALRTYVTVFIGEKDARAIGGTAARIPEGAEVMLVPAMAGGQAG............. 99
490 3.000e-15UniRef50_B0NIZ1 ThiS family protein n=12 Tax=Firmicutes TaxID=1239 RepID=B0NIZ1_CLOSV  ali  17  1..MQIKFFAYLRDYTGCKTT-----DFPYEEDLYHLAHSLCDVYGDRLRKKMLTPDGELGEEIIILVNGRHVAHLGGIHAKLLPGDVVSIFPVVAGG................ 91
491 3.000e-15UniRef50_A0A2S8GJ10 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Blastopirellula marina TaxID=124 RepID=A0A2S8GJ10_9PLAN  ali  16  1MRITVQIPSSLRAESGGASVLKVT-----AADVQEALHQLEHSQPGLYRS-VCDETGSLRKHMNLFVNDSLLPRDGGLLTKLREGDVLYIMTAVSGG................ 91
492 3.000e-15UniRef50_A0A2E8WCD3 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A2E8WCD3_9BACT  ali  20  1MTLRVLLFAQCSDIVGSRK---VDLDLPDGSTVQDLMDHFSAKYPPMKK---------LDRSIMLSVNQEYVEREQ----LLKDGDEVAVITPVSGG................ 81
493 3.000e-15UniRef50_A0A2T2XGZ9 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Sulfobacillus thermosulfidooxidans TaxID=28034 RepID=A0A2T2XGZ9_SULTH  ali  18  27MKIVVRYFALFRDITGTDQD---TIVVDEGAPISDLLVRIRDKYPDM---------GRTKRDVLVSVNRNFASH----ELQLKDGDEVAIFPPVSGG................ 107
494 3.000e-15UniRef50_Q1E493 Ubiquitin-related modifier 1 n=44 Tax=Opisthokonta TaxID=33154 RepID=URM1_COCIM  ali  46  17..ITVEFTGGLEMLFSNQRKHKISLPSLDPSNIAYLIKYLCQNLMKDERKELFVLDDSVRPGILVLINDADWELEGEEQYRIQQNDNILFVSTLHGG................ 115
495 3.000e-15UniRef50_A0A1V4W817 ThiS family protein n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V4W817_9DELT  ali  22  1MKVKVHSILQLKEILGGK---DVEIIVPDGTNVSGLLAGMVEIWGDSLSPHIFKPQDEVLPYIRLMINGTAIQSLDGMETILNDGDEVLLIPLAAGG................ 95
496 3.000e-15UniRef50_C4Y2E3 Ubiquitin-related modifier 1 n=2 Tax=Clavispora lusitaniae TaxID=36911 RepID=C4Y2E3_CLAL4  ali  43  102MKIKVEFLGGLDVISNHVREHKLSLPLEEGATMKDVISHVVSSVIADPKDIVFLEEGTVRPGILVLINDTDWELEGMEDYVVESGDVFTFTSTLHGG................ 200
497 3.000e-15UniRef50_A0A2D5VJ38 Uncharacterized protein n=2 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2D5VJ38_9BACT  ali  18  1MKIHVTYTGQLKAITKTAAE---TIHLPEGETVNSLLFQIAEHYGELAHMMLVGPNQKIHRALIRFVNNTQI--TPGANPKLGDGDSVTLIPPISGGVNPKNWNQILTMEC.. 108
498 3.000e-15UniRef50_A0A226EE36 Multifunctional fusion protein n=1 Tax=Folsomia candida TaxID=158441 RepID=A0A226EE36_FOLCA  ali  39  309MDVTLNFGGGAELLVGGKKQQII--PLPTGSSIKNLLEWMISDHGVKERPELLILNDDVRPGILVLINDTDWELCDKTVYLLQPGDEVTFISTLHGG................ 404
499 3.000e-15UniRef50_A0A2H9N868 Uncharacterized protein n=2 Tax=unclassified Candidatus Bathyarchaeota TaxID=1700837 RepID=A0A2H9N868_9ARCH  ali  27  1MVITVKFIGSFRNVSGKGK---LTIKSEGIIPLREAIKKIVEELPKLKRVLIDPELENPRPNTLILVNGKEISVLNGLDTMLEDEDEMVFVPVVHGG................ 94
500 3.000e-15UniRef50_A0A2D6CVX1 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2D6CVX1_9BACT  ali  20  1MEVTVRFFAGCREAV---KRDEATLSLPDGATLADLQVALAEEYPAIA---------HYAQRVRYSVNWEYAAA----DAKLDDGDEVAMIPPVAGGSDRSR........... 86
501 3.000e-15UniRef50_A0A2N0KFE3 Uncharacterized protein n=5 Tax=unclassified Chloroflexi TaxID=167963 RepID=A0A2N0KFE3_9CHLR  ali  19  1MRITVHLFAGLRDVMGGDLTEEFE---AESITVAALRERLGERHDKLR---------PYLTGVAIAVNEDYILDDSE---PLKDGDTVALIPPIAGGSDDPP........... 87
502 3.000e-15UniRef50_A0A151BS96 MoaD family protein n=1 Tax=Candidatus Bathyarchaeota archaeon B63 TaxID=1779372 RepID=A0A151BS96_9ARCH  ali  23  1MRVKVRVMGRLTDLLGS----ELDVELSSDAKIRDLIAKLKEKAPMLDEEAL-TRYVRDEPELTILLNGKNIHMLEALRTPLKDGDIVVLLPPVVGG................ 92
503 3.000e-15UniRef50_A0MDQ1 Ubiquitin-related modifier 1 homolog 1 n=167 Tax=Eukaryota TaxID=2759 RepID=URM11_ARATH  ali  36  1MQLTLEFGGGLELLCDSEKIHKVNVDLPNGATMKHLLSWVRTNLIKE-RPEMFMKGDTVRPGVLVLVNDCDWELSGQLDTVIEDKDVVVFISTLHGG................ 101
504 3.000e-15UniRef50_A0A0L0DUU1 Ubiquitin-related modifier 1 homolog n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0DUU1_THETB  ali  37  1MDVTVHLSGGLDVLFGGASEVSVHMAKTDNVRLIEVLNELMETLVAKDRGDMLMLDGEVRPGILVLINDADWALLGENEAVVTPGDEITLISTLHGG................ 98
505 3.000e-15UniRef50_A0A2I4GUP2 Ubiquitin-related modifier 1 homolog n=1 Tax=Juglans regia TaxID=51240 RepID=A0A2I4GUP2_9ROSI  ali  31  1MQLTLEFGGGLELLCESVKIHNVNVDPQEKLIMKDLLRWVRTNLIKE-RPEMFMKEDSVRPGVLVLVNDCDWELRYGEEIPI............................... 84
506 4.000e-15UniRef50_H6L2B3 Thiamine S protein n=2 Tax=Saprospira grandis TaxID=1008 RepID=H6L2B3_SAPGL  ali  16  3...TVIIPTPLRKFTDQQASVKLDAE-----TVQAAIDRLIELYPVLA-QHLLDKEGQVRAFVRIFLEDEDILALDGPNTALKSDSTLSIIPAIAGGID.............. 92
507 4.000e-15UniRef50_A0A0E3NNW8 Molybdopterin converting factor small subunit n=10 Tax=Methanosarcina TaxID=2207 RepID=A0A0E3NNW8_9EURY  ali  16  3.EVKIKLFANLREAAGTPEL------LLSGEKVIDVLLSLTDKHSELKGLIFEKSDEKLCGSINVLVNGNNVRHLEGLDTLLKDSDEIGVLPPVSGG................ 97
508 4.000e-15UniRef50_A0A1V4YUK2 ThiS family protein n=1 Tax=Methanocella sp. PtaU1.Bin125 TaxID=1811677 RepID=A0A1V4YUK2_9EURY  ali  15  4.RIRVNIIGAAATVFDRKS---CEADARPGMRLRDLLAGLSDSAGPDYKEKVYDDTGKINEYLAVFINAREARSLQGPDTILKDGDVVTIMPPMAGG................ 97
509 4.000e-15UniRef50_A0A1F4QES4 Molybdopterin synthase sulfur carrier subunit n=1 Tax=candidate division NC10 bacterium RIFCSPLOWO2_02_FULL_66_22 TaxID=1801658 R  ali  22  1MQIRVKLFASVKDIVGRR---EVVLDLPEGITAAGLLERFAADHPGLRG---------LAPSLLLAVNREYVEG----NRVLAEGDEVAFIPPVSGGVD.............. 83
510 4.000e-15UniRef50_A0A2N2P4Y5 Uncharacterized protein n=1 Tax=Chloroflexi bacterium HGW-Chloroflexi-10 TaxID=2013724 RepID=A0A2N2P4Y5_9CHLR  ali  17  1..MRISFFATYRNISG---VHSVDLPIPAGSSISQAIRIVLQHFPQLTS-HWQNEVGELHAHLTIVLNYIDCASLEGLETRLESSDELYFIPPVGGGA............... 93
511 4.000e-15UniRef50_A0A075G9Q0 UBA/THIF-type NAD/FAD binding protein (MOCS3, UBA4, moeB) n=2 Tax=Thaumarchaeota TaxID=651137 RepID=A0A075G9Q0_9ARCH  ali  17  3.NITFTIPSVL---NGGAGEKKTNLDAD---TLNDAFAKISETMGDDFKRRVLNEDGTPRSLINIYINGKNAKFSSGLETTLSDGDEVSILPAVAGGSSG............. 95
512 4.000e-15UniRef50_UPI00040A29B0 MoaD family protein n=1 Tax=Desulfovibrio cuneatus TaxID=159728 RepID=UPI00040A29B0  ali  18  2..VTITFQTTLRRSLG---VHTMQVERP-GATVGDVLAQCEEALGQPVLAHLTNAQGELLRGVMILVNGKNVLLLQGLGTALKAEDEVVVFPPAGGG................ 92
513 4.000e-15UniRef50_A0A2D6NA97 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Dehalococcoidia bacterium TaxID=2026734 RepID=A0A2D6NA97_9CHLR  ali  22  1MRVQVRYFAAVREIIGDNEAL---LELPEYTTINDLWERLAATHPRLQ-----------QLTCTAALNQEYVS----PEAVIEDGDEVVFIPPVSGGA............... 80
514 4.000e-15UniRef50_A0A1D2NJU9 Multifunctional fusion protein n=21 Tax=Metazoa TaxID=33208 RepID=A0A1D2NJU9_ORCCI  ali  43  293IKITVLFGGGAEILVGGVREKELEV--TGGWKMSDFLTWMQDNLIKE-RPELLIKDGDVRPGILVLINDVDWELLDKVDYNLENGDKVTFISTLHGG................ 386
515 4.000e-15UniRef50_Q9D2P4 Ubiquitin-related modifier 1 n=19 Tax=Bilateria TaxID=33213 RepID=URM1_MOUSE  ali  40  7..VKVEFGGGAELLFDGVKKHQVALPGEEPWDIRNLLVWIKKNLLKE-RPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG................ 101
516 4.000e-15UniRef50_A0A2E9F3Z5 Uncharacterized protein n=3 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2E9F3Z5_9BACT  ali  19  1MKITIEYSAQIRRALG---VSEETIDLENSQNLHDLVLYLAEKHGQLFKDLILDMEGNLSRMILASVNGVQVQGRTSAD--LKDGDLVNLMSPISGG................ 92
517 4.000e-15UniRef50_B6SXH2 Ubiquitin-related modifier 1 homolog n=5 Tax=Poaceae TaxID=4479 RepID=URM1_MAIZE  ali  37  1MHLTLEFGGGLELLLENTKVHKVEVDGQGKVTMKFLLSWVKENLIKE-RPEMFLKADSVRPGVLVLINDCDWELCGGLDAELEEKDVVVFISTLHGG................ 101
518 5.000e-15UniRef50_D3P2W3 Protein n=11 Tax=Azospirillum TaxID=191 RepID=D3P2W3_AZOS1  ali  21  1..MKISYFALLRDATRKHSEV-WERPAP---TLRVLMDDLAAEYGANFARWVM-KNGELAGYAIILVNGKDVRGLQGLDTPLAADSDVFIFPPLAGG................ 90
519 5.000e-15UniRef50_UPI000D3EB0C2 molybdopterin synthase sulfur carrier subunit n=1 Tax=Euzebya sp. DSW09 TaxID=2052804 RepID=UPI000D3EB0C2  ali  17  2.......PGVLRPAIGGVREVVVE-----GTTVRAAVEDLCRQHPTLTVR-LFDEDGHLRRHVLCVHNGATTRLDDDL--PLADGDELAILPAVSGG................ 83
520 5.000e-15UniRef50_X7ECP6 Uncharacterized protein n=2 Tax=Roseivivax TaxID=93682 RepID=X7ECP6_9RHOB  ali  21  1MTIVIELPATLRPYASGESRVALDGQDSFG----EALDALVTRHPRL-RKRLLTSSGAIYDFVGVFLNDRRLARDDMPDLTLADGDVVSFVPAMAGG................ 92
521 5.000e-15UniRef50_A0A2V9QS06 Molybdopterin synthase (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9QS06_9BACT  ali  21  1MQVRVLFFGVLKDLAGRGSE---ELTLPEAATVSDVIEVYERRVTSLRSML---------PSIAISVNQEY----SGPETRLQPGDEVALLPPVSGGSERE............ 85
522 5.000e-15UniRef50_B4LE67 Ubiquitin-related modifier 1 homolog n=48 Tax=Opisthokonta TaxID=33154 RepID=URM1_DROVI  ali  42  5.KIILEFSAGAELLFGNIKRRELALDGDQKWTIANLLKWMHANILTE-RPELFIQESTVRPGILVLINDTDWELLGELDYELQQNDNVLFISTLHGG................ 99
523 5.000e-15UniRef50_G3PZD9 Ubiquitin-related modifier 1 n=7 Tax=Eukaryota TaxID=2759 RepID=G3PZD9_GASAC  ali  39  5IAIHLEFGGGAELLFNGVKKHHVDLPSSEPWDVKQLLVWIQRNLLRE-RPELFVQGDSVRPGILVLINDADWELMGELDYQLQDQDNVVFISTLHGG................ 101
524 5.000e-15UniRef50_A0A1U8PAS3 Ubiquitin-related modifier 1 homolog n=22 Tax=Eukaryota TaxID=2759 RepID=A0A1U8PAS3_GOSHI  ali  37  1MHLTLEFGGGLELLCKSVKFHNVNVDLPKGASMRDLLAWVRTNLIKE-RPEMFMKGESVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG................ 99
525 5.000e-15UniRef50_A0A2D6V417 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Thaumarchaeota archaeon TaxID=2026795 RepID=A0A2D6V417_9ARCH  ali  28  3.EIEVLLPGVLTRGTGPKRVK------AQASTLGELVEVLARDKEAEVSRLL-DDQGKLRRLLNVYVNGKNVRLTGSLETVLKDGDEVSILPTVAGG................ 91
526 5.000e-15UniRef50_A0A2E5IVJ4 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5IVJ4_9CHLR  ali  13  4....IRIPNVLRHHTEGARSVTVS-----ASTVGEALEALFKQHPSL-RDSLIPKSGDIFEAVNLFLNDTDIGSADRLDTQVSEGDSITILPAMAGG................ 90
527 5.000e-15UniRef50_A0A0C9MT34 Ubiquitin-related modifier 1 n=14 Tax=Fungi TaxID=4751 RepID=A0A0C9MT34_9FUNG  ali  43  4LTINVEFSGGMELLFQNVSKHSIQFPATNPSNLQDLILHIRDTMMTE-KKDLFVEKDTVRPGILVLINNVDWELCDELEYELEDKDEIVFISTLH.................. 101
528 5.000e-15UniRef50_A0A2P6K9M2 Ubiquitin-related modifier 1 homolog n=3 Tax=Eukaryota TaxID=2759 RepID=A0A2P6K9M2_NEPCL  ali  43  1................................MKSFITWVKGNLLQE-RSELFVQGETVRPGILVLINDFDWELLGELEYVIQPQDTICFISTLHGG................ 64
529 6.000e-15UniRef50_A0A2N2HDK9 Uncharacterized protein n=3 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2N2HDK9_9DELT  ali  22  2IAVRVRTILTIKKILGKG---ELEFSIPEGSTLRDLVATMVSRWKELSPHLMQPATGPI-PRVRFMINGRDIAFLNRMETVLRNGDEVLILPPVSGG................ 94
530 6.000e-15UniRef50_A0A101XIR5 Uncharacterized protein n=1 Tax=Thermocladium sp. ECH_B TaxID=1714261 RepID=A0A101XIR5_9CREN  ali  24  1MRIKVWFLATLFNLAGD---LWINMAVPDGATINDLLQAISNIKPAVIHAVM--DGERLKRDYIITVNGRDIAFLSGSMTVLREGDEVAIFPSL................... 89
531 6.000e-15UniRef50_A0A140L641 Uncharacterized protein n=2 Tax=Thermoanaerobacterales TaxID=68295 RepID=A0A140L641_9THEO  ali  27  3.NVKVIFFGQLRTFTGTRER---TISLEDSADLSHLISRLNEEYDN------FEAQINSIKGLRILVNGREYELTGGLNTPLYEGDTVVFLPPVFGG................ 89
532 6.000e-15UniRef50_A0A2E9TCQ6 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E9TCQ6_9CHLR  ali  19  20MKIAIKLFAGLRDRAGTG---DLSVELPEGATVRDAIEA--AQHNAPKKW-------AAPTSLMAAVNNEYVEFTD----TVADGDELALIPPVSGG................ 100
533 6.000e-15UniRef50_A0A2E4DP19 Uncharacterized protein n=3 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2E4DP19_9BACT  ali  18  35MKVTVRYFAICRQMFNRDEE---DIELPEGAILQDVLDQLKEEKP---------EISELFETMQMSVNWQYADH----ETKLSNNDEVALIPPVTGGSP.............. 117
534 6.000e-15UniRef50_A0A2V5INJ8 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2V5INJ8_9MICC  ali  17  20.EVTVLVPQLLRPLVGGSGELRLDV--GDGASVGELLDVISAQFPV-FGRRLRDETGTLRRHVNIYLDGDEVRRLDGLQTHVAAGRELMVIQSVAGG................ 112
535 6.000e-15UniRef50_A0A2E8EEH6 Uncharacterized protein n=2 Tax=TACK group TaxID=1783275 RepID=A0A2E8EEH6_9ARCH  ali  19  17.SVTVKYFAIMREITGMKEEIIV---LGPRITIEQAIKKIAQTHGSKLEEFVFRDD-RLREGLTILVNGQTVEEDKFGLVVLKGGDEIVILPPIGGGS............... 109
536 6.000e-15UniRef50_A0A2E5Z778 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5Z778_9CHLR  ali  18  11MKVTVRLFASYRDLAGKSR---IELNHAQLDDVGQAIALLVEKLPVLPKN---------FKPHLIAVNEEFASF----DYKIKDGDEIALYPPVSGGVDAKI........... 96
537 7.000e-15UniRef50_F5SIP0 Molybdopterin synthase sulfur carrier subunit n=11 Tax=Bacillales TaxID=1385 RepID=F5SIP0_9BACL  ali  21  1MKINVLLFAGVAEAVGKR---DLRLELPEKTTVHTLIDRLATEYP---------DAADLIRHSVIALNQDYAEA----DQVIRPGDEIALIPPVSGGEERQPAPLLF...... 91
538 7.000e-15UniRef50_A0A2H5XCJ5 Molybdopterin synthase catalytic subunit n=1 Tax=bacterium HR17 TaxID=2035412 RepID=A0A2H5XCJ5_9BACT  ali  15  5VQVHVQFFGPTKDLTGCERVTTV---LPATTSVATVMATLAERFPSLQ---------ELLPHCRLALNGRYVEGA----LQLRDGDHLALIPPVSGGSVTASPFVAVTDQPIN 101
539 7.000e-15UniRef50_J2JSS5 Uncharacterized protein n=6 Tax=Actinobacteria TaxID=201174 RepID=J2JSS5_9ACTN  ali  18  1MPVTVRIPTVLRTYTAGAAEVSL-----NTGTVGEAFTALEGDFPGICSRIL-DDDGKLRRFINVYVEDQDIRGADSLGTVTPDGSKISVIPAVAGGC............... 92
540 7.000e-15UniRef50_A0A1G0FTV5 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium RBG_16_66_13 TaxID=1798267 RepID=A0A1G0FTV5_9GAMM  ali  18  1MPVRVHIPSLLRRLYSTQPIESVE-----ASTVREMASALDARFPG-IGERLLEPDGNLRPYVNVFINGEDARWQGDARARLGPDAEVWIVPNVAGGSRQLP........... 96
541 7.000e-15UniRef50_A0A1V5RV35 Molybdopterin synthase catalytic subunit n=1 Tax=Chloroflexi bacterium ADurb.Bin325 TaxID=1852859 RepID=A0A1V5RV35_9CHLR  ali  17  1MRVRVRAFAALREALGFTERL---LTLPEGATAADAIERLSAEHPT---------AGLVDRRFAVAVN----RAYAGRQAALADGDELALIPPVSGGAGRPFEIV........ 89
542 7.000e-15UniRef50_A0A2K5AP10 Sulfur carrier protein CysO n=4 Tax=Archaea TaxID=2157 RepID=A0A2K5AP10_9ARCH  ali  17  3.RVEVTIPSVLNKNAG-ERKVSVEAD-----TLKDAIDSLVKMMGNDFARKVLDSNGKPKALINIYINGRNSRFSGGLDARLNDGDSVVILPAVAGG................ 92
543 7.000e-15UniRef50_A0A151BLK8 MoaD family protein n=2 Tax=unclassified Candidatus Bathyarchaeota TaxID=1700837 RepID=A0A151BLK8_9ARCH  ali  21  1MLVKVRYLGVLRSKLGLK---EGEYNLEDGASLSDLFNKIVEVHGGSVRRLFEADRSRVDPSFVVTVNGVAVDRLRGKDVQLKNGDVVAIMSLISGG................ 94
544 7.000e-15UniRef50_A0A177VJY2 Ubiquitin-related modifier 1 n=4 Tax=Tilletia TaxID=13289 RepID=A0A177VJY2_9BASI  ali  38  379LKITIEFGGGTELLTSTKKAHEVRIPAQRPADARYLIKWIAENLIAE-RHELFVEGDTVRPGILVLINDADWELEGEGDYQLQAGDRLIFISTLHGG................ 481
545 8.000e-15UniRef50_A0A2M8NS45 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8NS45_9CHLR  ali  10  3...TITIPTPLRTFTEQNKAVEVT-----GSTVRQALDDLTRQYPALRDHLF--NGAELRRFVNIYIGEEDIRFLSGLDTEISADESLRIIPTVAGGKGA............. 92
546 8.000e-15UniRef50_A0A1I6WFD4 Molybdopterin synthase subunit MoaD n=14 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1I6WFD4_9BACL  ali  19  1MRIQVSVPLLLSDCTKGKSAFELEAE-----TLQEALQLLVEEYP-LLKVHLYTEQGEVRKHVLLYYNADNIAWLERLDIPLAAGDKLRVLQAVSGG................ 91
547 8.000e-15UniRef50_A0A2U2S6G0 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Anaerolineae bacterium TaxID=2052143 RepID=A0A2U2S6G0_9CHLR  ali  15  5...KILFFATLRHQAGVRST---EMDLPEGTTVHQLKQLLIERFPGL--------DWQVMDHCLASVNQEYCDD----ETPIPTGAEVAFFPPVSGGSPT............. 86
548 8.000e-15UniRef50_A0A059C4M0 Ubiquitin-related modifier 1 homolog n=13 Tax=Embryophyta TaxID=3193 RepID=A0A059C4M0_EUCGR  ali  39  51MQLTLEFGGGLELLCDSVKIHNVNVETPKGAAMRDLLVWVQKNLIKE-RPEMFIKGDTVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG................ 149
549 8.000e-15UniRef50_H1Z2R5 Thiamine S protein n=1 Tax=Methanoplanus limicola DSM 2279 TaxID=937775 RepID=H1Z2R5_9EURY  ali  18  1MRIKIKFYARFQEYFG--SEIIKEIDNNSTDTLKSIAKSVTEDNPEGQ-AFIFDDAGNFYDYVILMKNGERIYSDDADEISAEDGDEIRIFPPVSGG................ 94
550 9.000e-15UniRef50_A0A0S8I5C1 Uncharacterized protein n=1 Tax=Anaerolineae bacterium SM23_ 63 TaxID=1703387 RepID=A0A0S8I5C1_9CHLR  ali  19  1MKVHLKIFLPLPEAIGDNK---LDFEF-SGATVNDLIESLVKRYGQKAWQALYDEKGEFDPLVQVLLNGEQWVTRDQLDTALQNGDDLIFMMMIAGG................ 94
551 9.000e-15UniRef50_A0A2D6GB38 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A2D6GB38_9CHLR  ali  17  9.KITVRFFASYREKAGTSETV---VDIPDGATVGDLTSRLAESFPDLTSRPI---------GLVVAVNQEYRDHSFG----LSDGDEAAVIPPVSGG................ 88
552 9.000e-15UniRef50_A0A1V5YJV5 Molybdopterin synthase sulfur carrier subunit n=4 Tax=cellular organisms TaxID=131567 RepID=A0A1V5YJV5_9CHLR  ali  19  1MMVRVRFFASLREAVGLEQE---DVKLPPGATIKTLLQTLARAHPGLGALL-------EGRGVRFAVNRCYVP----PDAGLQEGDEVALVPPVGGG................ 83
553 9.000e-15UniRef50_D5BW53 Molybdopterin synthase sulfur carrier subunit n=32 Tax=Proteobacteria TaxID=1224 RepID=D5BW53_NITHN  ali  18  1MAITVKFFASLRERLGCTER---QIDFSEPITVAEVWT-------------LVGDGQPISENVLIAVNMEYA----GAETVVRDGDEVAFFPPVTGGGGP............. 80
554 9.000e-15UniRef50_A0A2N2KE67 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-12 TaxID=2013739 RepID=A0A2N2KE67_9DELT  ali  18  10MKITVKFHSKFRKVFQTDKTM---IELPESATVRNLLEAICNS--SLQRKTIYAPGGELRHDVLITKNRMFIFHMKRLETELKDGDEIEILYPAGGG................ 102
555 9.000e-15UniRef50_A0A2D6PZL6 Uncharacterized protein n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D6PZL6_9BACT  ali  23  1MQIQLEFPAALATVLGMRG-----LLIDGGGTLRETFRRIADEYPKL-GLHLFDESGGLREHVLCFWNGTNTRWLPSLDVAMTEGDELVIMQAASGG................ 91
556 9.000e-15UniRef50_A0A177BAZ4 Ubiquitin-related modifier 1 homolog n=1 Tax=Intoshia linei TaxID=1819745 RepID=A0A177BAZ4_9METZ  ali  33  1MNLKLQFTAGAELFLGGVKDHDVEISSEIR-NMRQLIKWIRDDLIQDKFKTLFMLTDDLRPGILVLINDSDWEIFDTYNYELVDKDNILFISTLHGG................ 96
557 1.000e-14UniRef50_A0A1V4S4W0 Uncharacterized protein n=2 Tax=unclassified Desulfobacteraceae TaxID=231684 RepID=A0A1V4S4W0_9DELT  ali  19  6.KVETTFYGLLKRVFQEEKK---QVDLSKALNIRTLLLGLCNS--RERHDRIFDEYGNVRQNISIFINGRNILFLKGLETELNAGDSVAIFPPMAGG................ 96
558 1.000e-14UniRef50_A0A257AGQ1 Molybdopterin synthase sulfur carrier subunit n=2 Tax=GOM Arc I cluster TaxID=1978122 RepID=A0A257AGQ1_9EURY  ali  15  2..VRIRFSQALNR---TTKERETTINLTDEITVRELINKLTEKYGKELERRLL-EEGELKRFINIYIDGEDIRYNKKLETQINDTNEVSILPAISGG................ 92
559 1.000e-14UniRef50_W0JYK2 Uncharacterized protein n=1 Tax=Halostagnicola larsenii XH-48 TaxID=797299 RepID=W0JYK2_9EURY  ali  22  1MKVDVHAFGPLREVIG-EKRYQCTLESD--STVGDLLDRLCAEF-DGARAILGEADERDTTAVVVTINKRSTKTLEGRETVLTDGDLVRISPPIHGG................ 93
560 1.000e-14UniRef50_A0A2R6JV23 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Halobacteriales archaeon QS_9_67_17 TaxID=1919190 RepID=A0A2R6JV23_9EURY :_  ali  16  25MRVTCEFHATVREAVGEKR---IEREIPAGTTVQALLDQLDADHDGL-GPLLFDGERRLRQNMNLLVADGPVRDTDR--TELSDGDTLILAPSVAGG................ 115
561 1.000e-14UniRef50_D3TB68 MoaD family protein n=3 Tax=Archaea TaxID=2157 RepID=D3TB68_ACIB4  ali  17  3...KVKFFATLREITGKREEII------EGDNVGDVLKVL-------YEEYGEEFEKELKERSMILVNGKNIEHLEGLKTKVSEEDTISIFPPAGGG................ 83
562 1.000e-14UniRef50_A0A1Q7TNF0 Uncharacterized protein n=1 Tax=Euryarchaeota archaeon 13_1_20CM_4_64_14 TaxID=1805139 RepID=A0A1Q7TNF0_9EURY  ali  22  13.EVQVYVPYPLREFTRGVATVDL-----RANDLAEAINEMNRRYPGLAYRIL-DDQGGLRRFVNVFVNDESVSHRAPREVPLHPGDEVTILPSVAGG................ 102
563 1.000e-14UniRef50_A0A2V6XYL2 Uncharacterized protein n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6XYL2_9BACT  ali  17  49.HVTVRLPRLLAGLIGGALETTVEAD-----TLAAALDTLIARHPEL-GVHLFDESGKFRGHVLCFHNEDSTRWLPSLERPVKSGDVITIMQAVTGG................ 138
564 1.000e-14UniRef50_A0A2R6DX42 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Halobacteria TaxID=183963 RepID=A0A2R6DX42_9EURY  ali  20  4.....RLFANLAEGAGTRRVTVETVDAGAGDTVEDAFDQLLDAHPELAAEVL-DDEGEIRDHISVLRNDHDFVTDEGYDTVLEECDELALFPPVSGGCEA............. 103
565 1.000e-14UniRef50_A0A1F8RL66 Molybdopterin synthase sulfur carrier subunit n=7 Tax=root TaxID=1 RepID=A0A1F8RL66_9CHLR  ali  16  1MKARVRLFARLADLAGTR---ETEVELGEGLSAADAFRLLCQRFPELADH---------SDSVMYAVNAEYVNS----DHSLRDGDELALIPPVSGG................ 81
566 1.000e-14UniRef50_A0A1Q9N7F6 Uncharacterized protein n=1 Tax=Candidatus Odinarchaeota archaeon LCB_4 TaxID=1841599 RepID=A0A1Q9N7F6_9ARCH  ali  16  1MKVTVKFLANM-GIFMGIRELNLELDDGKEYTIKDIIERITRETGKDLKGKIMDERGQSTGRVRIVLNGRDIVSLSRFDTKVADGDNISMFPALGAG................ 96
567 1.000e-14UniRef50_A0A1D1W7E5 Ubiquitin-related modifier 1 homolog n=7 Tax=Eukaryota TaxID=2759 RepID=A0A1D1W7E5_RAMVA  ali  41  6..IRVEFAGGVELLFDNQKQLDIPIDPSHPATVRDLLQLLKDRYLK-QRLELFLQGDNVKPGILVVINDCDWELMGGPDYELEPGDRVVFISTLHGG................ 109
568 1.000e-14UniRef50_A0A098VM25 Ubiquitin-related modifier 1 n=2 Tax=Fungi TaxID=4751 RepID=A0A098VM25_9MICR  ali  40  1MKVTAEFTGGLEYLFGGHKTIPLELQSP--AFIRDVVAALVSDHLKE-RKELFIAENTVRPGILVLRNNTDWELEEGQDTMLCGNDVVTFISTLHGG................ 94
569 1.000e-14UniRef50_L0PFH5 Ubiquitin-related modifier 1 n=5 Tax=Pneumocystis TaxID=4753 RepID=L0PFH5_PNEJ8  ali  42  341..VVVEFSGGLETLFGHQRVHHISLSLADPATIAYLIHFLSQNLMQDSRKDLFTKDNTVRPGILVLINNEDWELNNQTQYIIQPKDQITFISTLHGG................ 441
570 1.000e-14UniRef50_Q9BTM9 Ubiquitin-related modifier 1 n=94 Tax=Theria TaxID=722675 RepID=URM1_HUMAN  ali  39  6.SVEVEFGGGAELLFDGIKKHRVTLPGEEPWDIRNLLIWIKKNLLKE-RPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG................ 101
571 1.000e-14UniRef50_Q602K9 Molybdopterin synthase sulfur carrier subunit n=15 Tax=Proteobacteria TaxID=1224 RepID=Q602K9_METCA  ali  16  1MTIRVRYFAALREQMGRAEE---QLAFEDLASVADVWKAVCR-------------GKRLPEDVLCAVNMDYA----GADTPVKDGDEVAFFPPVTGG................ 77
572 1.000e-14UniRef50_A0A257RSV2 Uncharacterized protein n=1 Tax=Gemmatimonadetes bacterium 21-71-4 TaxID=1970514 RepID=A0A257RSV2_9BACT  ali  17  1MTVRVLLFASYADALGGP---EIRLDLPDGSTVRELLDALQRRPGA----------HRLPPAPLVAVNQRYAS----LGTPVTAADEVAIIPPVAGG................ 80
573 1.000e-14UniRef50_A0A1F5DEM1 Molybdopterin converting factor subunit 1 n=1 Tax=Candidatus Bathyarchaeota archaeon RBG_13_60_20 TaxID=1797380 RepID=A0A1F5DEM1_  ali  22  1MKVKVRYYASFRDVTGKQEEW---LDVPEGTTVQGIREHVRGLY----------ESIARREQVLVAVNG----AFPALDRVIEEGDDVAFFPPVSGG................ 80
574 1.000e-14UniRef50_V6M3G1 Molybdopterin synthase sulfur carrier subunit n=55 Tax=Paenibacillaceae TaxID=186822 RepID=V6M3G1_9BACL  ali  17  1MTITILLFAGLAERANQR---EIQLTLPEQATVRDLLQAAAEQYPAL---------SPLLGSCFVSLNHEYAA----PDHVIQASDEIALLPPVSGG--EEPLFSITT..... 90
575 1.000e-14UniRef50_A0A257A537 Molybdenum cofactor biosynthesis protein MoaD n=2 Tax=unclassified Desulfurococcales (miscellaneous) TaxID=221496 RepID=A0A257A53  ali  21  1MKVKVRFFAVFRDIVG---KNELTLSFKEKLTVAKLLKHIRSSFPEINRYI----DEYEIEPIIVLVNGKPAS----ENMMLKNGDEVAVFPPAAGGVGEGKIVK........ 94
576 1.000e-14UniRef50_A0A1P8YGH7 Sulfur carrier protein CysO n=4 Tax=Bacteria TaxID=2 RepID=A0A1P8YGH7_9NOCA  ali  19  3...........................ATGSTLAAVIDDLEANHAGLKDRLIND--GKLHRFVNVYVNDEDVRFSGGLDTEVADGDSVTILPAVAGG................ 70
577 1.000e-14UniRef50_A0A1J5DZC1 Molybdopterin synthase sulfur carrier subunit n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1J5D  ali  14  1MQVSVRYFAGVRERLGASSE---TLELAEGSTVEAVWESLCLRHPALVG---------LRRYIRLALNLEFVDA----DQLVAEGDEIALIPPVAGGSSA............. 84
578 1.000e-14UniRef50_F6CPB1 MoaD family protein n=1 Tax=Desulfotomaculum kuznetsovii (strain DSM 6115 / VKM B-1805 / 17) TaxID=760568 RepID=F6CPB1_DESK7  ali  24  11VTISVVFLGNYRLLTGQGR---VEIQLPQGSSVNDLIAWLAGRYGGDLRDQLIDPGGKVWNLMALAVNGKILNSVEKFSLILKTGDEVLFLPPALGG................ 105
579 1.000e-14UniRef50_A0A258B4U2 Uncharacterized protein n=2 Tax=Verrucomicrobia TaxID=74201 RepID=A0A258B4U2_9BACT  ali  14  1MKLRVLFFSVLRDITGTD---EITLELSAGATMGDLLAQIESRWPKLRDW---------QNSLLLALDQTYVKR----DEPLHDGGEVAIMPPVQGG................ 81
580 1.000e-14UniRef50_D1YWA7 Uncharacterized protein n=3 Tax=Methanocella TaxID=570266 RepID=D1YWA7_METPS  ali  21  1MAVCVDIVGYARSLFDRPR---YSFEARRGFTLKGLMEELSKLARPDFRKRIYDATGKMNEHIAVFINSREARSLRGLDTELKDGDVVTILPPMAGG................ 95
581 1.000e-14UniRef50_A0A2V7I2M8 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V7I2M8_9BACT  ali  17  3.SVQVYIPTPFRRATSNKDRVSVDAP-----DVRTLLDELEEHFDGL-RGLVRNERGEVHDHVNIYVNNEGIEALQGLGTALRDGDEVSIIP..................... 87
582 1.000e-14UniRef50_A0A2M8CTP9 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Anaerolineae bacterium CG_4_9_14_3_um_filter_57_17 TaxID=1973904 RepID=A0A2  ali  18  3...TLRVPALLTYYLDQHSQLPLT-----GDTVAAALRDLTTRHPAIA-PHLFDSAGNLRRHINLFVNAENIRSLNGLQTPLGENDILKIVPSVTGG................ 90
583 1.000e-14UniRef50_A0A1V5VD89 ThiS family protein n=1 Tax=bacterium ADurb.Bin236 TaxID=1866925 RepID=A0A1V5VD89_9BACT  ali  12  5.EVTVRFYAALRARAGSDEI------LCRAANVKDVIRHLKSSFGTDFNRVL--------NSCHIFLNEENIVFMRGLSTRLKEGDTLHILPPTGGG................ 86
584 1.000e-14UniRef50_G2LGG6 Uncharacterized protein n=3 Tax=Chloracidobacterium TaxID=458032 RepID=G2LGG6_CHLTF  ali  25  1MAVTIELSSVYLPLTDNQRAVTVE-----ATTVGEALRKLTEKYTKLSKE-IYNGRGLRQPSVSIYVNSRDINTLDDINTRLENGDVVTVVPSVG.................. 89
585 1.000e-14UniRef50_A9BF62 MoaD family protein n=8 Tax=Petrotoga TaxID=28236 RepID=A9BF62_PETMO  ali  21  1..MKIKFFSLIKLDL---KKDEVDYQLSGSKSVKEIIKLLDQEFDNYFSRKLL-ENGELKSGTIVLLNGRNIRHLQGLDTLVENKDEITIFPPSGGG................ 91
586 1.000e-14UniRef50_A0A1F2QVQ8 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Bacteria TaxID=2 RepID=A0A1F2QVQ8_9BACT  ali  19  6VRVHVRLFASLREAAG---RSEAELELPPGATAEDAWRSLAGEVPALAAR---------RTGLAAAVNRRYAPF----SAALADGDELVFIPPVSGG................ 86
587 1.000e-14UniRef50_A0A192WYC6 Molybdenum cofactor biosynthesis protein MoaD n=5 Tax=Bacteria TaxID=2 RepID=A0A192WYC6_9BACT  ali  20  5...TIRIPTPLRNLTAGAGFVEVD-----AGTVGEALTLLERRHEGILQRVL-DEHGRLRGFVNVFVGERNIQALGGLDAGLEEGAVISIVPAVAGGT............... 93
588 1.000e-14UniRef50_D9QPR6 MoaD family protein n=2 Tax=Acetohalobium TaxID=28186 RepID=D9QPR6_ACEAZ  ali  16  1MILQINFFATFRKVTGNKQYDY----QGSVENIKELLLELSDNFGTEFREMVLV-GEELSPEVIILVNGINIEHLAQEETELNDKDKVSIFPVVAGG................ 92
589 1.000e-14UniRef50_A0A2X2HMC7 Molybdopterin biosynthesis protein n=24 Tax=Actinobacteria TaxID=201174 RepID=A0A2X2HMC7_9NOCA  ali  15  5..VTVRVPRALASIVGGERSVHV--PLDTASTVSHVLDVLAGDFPILGRR-IRDETGALRRYVNVYVDGEDVRLLGGVGTEVTPGQELQILQSVAGG................ 96
590 1.000e-14UniRef50_A0A0F9HM18 Uncharacterized protein n=2 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9HM18_9ZZZZ  ali  18  3.NVTLKLVAIFTDDVGLTY-----INYDNVDTLGEIINQFMDQYGRKIRKSFVDSQGKLENHAIILVNGRNHLFLDGLDTKLRDGDEIVLSPPIVGG................ 93
591 1.000e-14UniRef50_A0A1G6RBM1 Molybdopterin converting factor, small subunit n=11 Tax=Bacteria TaxID=2 RepID=A0A1G6RBM1_9ACTN  ali  18  2..VDVKLPAALASECAGQRHLHVDL--PDDATLADVLDAIATTHPRLARR-LRDESGKLRRYVNIYIGDDENRRLQGLATPVEGRD-IQILPSIAGG................ 92
592 1.000e-14UniRef50_A0A2I0RNR4 Ubiquitin-related modifier 1 n=6 Tax=Eukaryota TaxID=2759 RepID=A0A2I0RNR4_9PEZI  ali  44  8...TVEFTGGLELLFSDQRQHKISLPTRDPATVAFLIKWLCDNLMKDPRKDMFVLDDTVRPGVLVLINDSDWELEGEEKYEVQPRDNIVFVSTLHGG................ 105
593 1.000e-14UniRef50_L9VRI5 MoaD family protein n=1 Tax=Halalkalicoccus jeotgali (strain DSM 18796 / CECT 7217 / JCM 14584 / KCTC 4019 / B3) TaxID=795797 RepID=L  ali  16  4.....KLFADLAELAGGKR---VAVDAGPGDTVGEALAALLDSQPALEERVL-DGEGQLAEHINLLHNGSNVFIQGGLDTELESGDELALFPPV................... 89
594 1.000e-14UniRef50_A0A2R6J8F5 Uncharacterized protein n=1 Tax=Halobacteriales archaeon QS_7_69_60 TaxID=1919185 RepID=A0A2R6J8F5_9EURY  ali  18  111.................DREKTIEREFDADATVGDVLGAIESEFPELVGELL-DDGGDVQPQLSVLKNGREVVHLDGTETDLEDDDRVSVFPPVAGG................ 189
595 1.000e-14UniRef50_A0A0S8H8T4 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Gemmatimonas sp. SM23_52 TaxID=1703359 RepID=A0A0S8H8T4_9BACT  ali  18  1MRVKCLFFAVYREILGTG---ELEIELPPGARLAELIQLVRTRPGADA----------LPRALVVAVNHEYAPA----DSVLADGDEIAFIPPVAGG................ 80
596 1.000e-14UniRef50_A0A1L2ZPT3 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Neomicrococcus aestuarii TaxID=556325 RepID=A0A1L2ZPT3_9MICC  ali  14  8..VTLVMPAVIANVTGGERERNVNLPAP--ATIKALLDQVSGEFPV-FGRRVRNEVGEIRRYVNVFVGKRNIRNAQGQDTVLTPGDRVTIVQSVAGG................ 99
597 1.000e-14UniRef50_A8P008 Ubiquitin-related modifier 1 n=11 Tax=Agaricomycetes TaxID=155619 RepID=URM1_COPC7  ali  48  11.NIKIEFGGGLELLFSNQRSHKVSIPLLKPADITYLIHHMRD-HLLQEREELFVENGTVRPGILVLVNDTDWELEGEGDYVLKDGDEVVFISTLHGG................ 124
598 1.000e-14UniRef50_A0A2S5B6Y9 Ubiquitin-related modifier 1 n=1 Tax=Rhodotorula taiwanensis TaxID=741276 RepID=A0A2S5B6Y9_9BASI  ali  40  32INVTIQMSGGMELLFNNEPVHKVTLEGAEETDVRFLIWYLREFLLEDRRPELFSQGETVRPGILVLINSTDWELEGELDYVLQDGDEVVFISTLHGG................ 160
599 1.000e-14UniRef50_A0A135VFB8 Uncharacterized protein n=1 Tax=Candidatus Thorarchaeota archaeon SMTZ1-83 TaxID=1706445 RepID=A0A135VFB8_9ARCH  ali  21  1MRVTVRFRGPLAYQMTNQ---QYSVEVEEESSLRTVLQTLVDSEEAVERT--WTDPETIDREALILCNEVDIGLTGGLETGLKDGDELIVLPLVHGG................ 92
600 1.000e-14UniRef50_B0D4J6 Ubiquitin-related modifier 1 n=34 Tax=Opisthokonta TaxID=33154 RepID=URM1_LACBS  ali  42  8MFLKIEFGGGLELLFSNQRSHRITIPSTPATRPADVLLHHLRDHLLKEREELFMENGTVRPGILVLINDTDWELEGEGEYLLKDGDEIVLISTLHGG................ 122
601 1.000e-14UniRef50_Q7GBC8 Ubiquitin-related modifier 1 homolog n=7 Tax=Oryza TaxID=4527 RepID=URM1_ORYSI  ali  39  1MHLTLEFGGGLELLLEKTKVHKVDLDGDGKVVMKGLLAWVKSNLIKE-RPEMFLKGDSVRPGVLVLINDCDWELCGGLDAELEEKDVVVFISTLHGG................ 100
602 1.000e-14UniRef50_A0A2C5X896 Ubiquitin-related modifier 1 n=1 Tax=Ceratocystis fimbriata CBS 114723 TaxID=1035309 RepID=A0A2C5X896_9PEZI  ali  47  13VTLKVELAGGLDILFDGKPQLEVAVDGAPSIRMSELITHLSEEVMTDSRKDLFVLDGSIRPGIMVLINEVDWELEGEEECVLVSGDEVLFVSTLHGG................ 116
603 1.000e-14UniRef50_A0A0E9NFG2 Ubiquitin-related modifier 1 n=2 Tax=Opisthokonta TaxID=33154 RepID=A0A0E9NFG2_9ASCO  ali  36  5ISVTLELSGGAELMFANTRLHTLEIPADL--TLQSFLLYLADEKMTDKRRDLFIQGDTVRPGMLVLINDADWELEGEGEYVIQDRDVIHLISSLHGG................ 99
604 1.000e-14UniRef50_A0A2G9TMI0 Ubiquitin-related modifier 1 homolog n=2 Tax=Teladorsagia circumcincta TaxID=45464 RepID=A0A2G9TMI0_TELCI  ali  34  18VNVNLEFSGGCEFLVGNQKRHKVSLPSEDFVTVGDVVSYVNDVMLKDCRRELLIDDGKIRPGVLVLVNDCDWELVG..................................... 95
605 1.000e-14UniRef50_A0A1V2KZR9 Ubiquitin-related modifier 1 n=1 Tax=Cyberlindnera fabianii TaxID=36022 RepID=A0A1V2KZR9_CYBFA  ali  41  3VDIKVEFLGGLDVIFESERYHKVKLNEKDPLILRDLIHHISTKMIKDEKDVVFLENGTIRPGILTLINDADWELEGEEEYELESGDVISFTSTLHDLFYVSKL.......... 109
606 1.000e-14UniRef50_A0A1A8VYY2 Ubiquitin-related modifier 1 homolog n=37 Tax=Plasmodium TaxID=5820 RepID=A0A1A8VYY2_PLAMA  ali  30  3IKIELKFLGGLESYLENKSKNVVSLEESDEFNFENLIAYIRNNIIREYSNYNLNDKAKIKPGVIVLVNEYDWEILDTYSYKIKNDDKICFLSTLHGG................ 125
607 2.000e-14UniRef50_A0A0T5ZMH2 Molybdopterin converting factor subunit 1, molybdopterin synthase catalytic subunit n=3 Tax=unclassified Chloroflexi (miscellaneo  ali  13  1MRVTVRLFALQRQQLGTR---EVRLELPEGATIQAAWETLAAAHPVL---------EPARDSVRFARNGEYASS----DETLADGDELAVIPPVAGGADDLP........... 86
608 2.000e-14UniRef50_A0A2H5VN88 Molybdopterin synthase sulfur carrier subunit n=10 Tax=Bacteria TaxID=2 RepID=A0A2H5VN88_9BACT  ali  14  2ITVSVRFFAQCRELAGTA---ECEVQLPPSATVTHALEAVCERFPALR---------ELQGRVLVAVNERYAA----PETLLHSGDVLALLPPVSGGQEADIFALV....... 91
609 2.000e-14UniRef50_A0A2R6Y2X0 Molybdenum cofactor biosynthesis protein MoaD n=1 Tax=Candidatus Carbobacillus altaicus TaxID=2163959 RepID=A0A2R6Y2X0_9BACL  ali  17  3.SIQVLFFAGLRERFGDRHQVAWE----EGLTVEGLLNRLHETYPDLA---------PFLKGTMIAVNEAYAAR----DTSLHPGDQVAIIPPVSGG................ 81
610 2.000e-14UniRef50_Q1D990 Molybdopterin synthase sulfur carrier subunit n=25 Tax=Cystobacterineae TaxID=80811 RepID=Q1D990_MYXXD  ali  10  7VRITVLYFAAARERTGQVREA---LDLPEGSHVRDVLRLLSAKYAALA---------PLLPHLRVAVDQEFV----GPDAPVRDGAEMALIPPVAGGAPGKFLVV........ 95
611 2.000e-14UniRef50_A0A261Y1A0 Ubiquitin-related modifier 1 n=8 Tax=Eukaryota TaxID=2759 RepID=A0A261Y1A0_9FUNG  ali  44  5.HIDVEFGGGMELLFKNVREHKIDM--PEGSNLKDLITYIRDNLMT-AKQDLFVMNDTVRPGILVLINEADWELCDGIEYKLEDGDRIIFISTLHGG................ 97
612 2.000e-14UniRef50_A0A0Q7M9V7 Uncharacterized protein n=1 Tax=Cellulomonas sp. Root485 TaxID=1736546 RepID=A0A0Q7M9V7_9CELL  ali  13  1MTATMLLPAVLAGRAGGARTLHVT-----GATIAEVLEHVGAEHADLV--EVIRGREGLSRYVNVYVNEVDVRGSGGLDTPVAAGDEIAVIPAVAGG................ 90
613 2.000e-14UniRef50_A0A1M7HH22 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Caldanaerovirga acetigignens TaxID=447595 RepID=A0A1M7HH22_9FIRM  ali  22  2..IKIKVITG-SEIAKIVGAHEKIIYLPEGATVNDFLTYLKTEYGEPMEKFLFKSNRELSQ--VVMVNGKNIAFLEGKDTKLKDGDEIFLVPIAAGG................ 93
614 2.000e-14UniRef50_A0A1Y3GGG6 Molybdopterin converting factor small subunit MoaD n=1 Tax=Methanonatronarchaeum thermophilum TaxID=1927129 RepID=A0A1Y3GGG6_9EUR  ali  10  2..VNIKLFANYRETVGKD---QIQIEIKNKTTLNEILNKLQTKHPELKKQI--SNQQQLKKEVNILINEKTINNNQINEKTINNNDTIALLPPVSGG................ 91
615 2.000e-14UniRef50_A0A2R6LWU0 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Halobacteriales archaeon SW_6_65_15 TaxID=1919201 RepID=A0A2R6LWU0_9EURY :_  ali  17  11.TVELRFYAPFKDAVDQKS---VAFELPDDATLSDALARAVEEYPDLDGK-LVAEDGELSSGVRALHNG---HARAEADTRLEDGDEVSFTTPIHGG................ 99
616 2.000e-14UniRef50_A0A0B4DN59 Thiamine biosynthesis protein ThiS n=11 Tax=Actinobacteria TaxID=201174 RepID=A0A0B4DN59_9MICC  ali  20  3.EISLVLPSVLQPLAGGQSV--LTAPADGPVTVASLLDAVAAEYAVLGRR-LRDETGALRRFVNIYVDGDEVRRLQGLDTRVSPGQEILVIQSVAGG................ 95
617 2.000e-14UniRef50_A0A075ID24 UBA/THIF-type NAD/FAD binding protein (MOCS3, UBA4, moeB) n=1 Tax=uncultured marine thaumarchaeote SAT1000_22_D06 TaxID=1456395 R  ali  12  3.NITFTIPSVL---NGGAGEKTTDID---ANTLNDAFAKISETMGDDFKRRVLNEDGTPRSLINIYINGKNAKFSSGLDTTLSDGDVINILPAVAGGSSG............. 95
618 2.000e-14UniRef50_A0A1J1AFK6 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Halodesulfurarchaeum formicicum TaxID=1873524 RepID=A0A1J1AFK6_9EURY  ali  14  4.....KLFADLAETAGEKR---VAVDPAPEPTVEDALEALFESHPALRDRVLAD--GEVADHVNLLLNGESVTDREGLGTQVESGDELALFPPVSGG................ 91
619 2.000e-14UniRef50_UPI000A04E2E8 hotdog fold thioesterase n=2 Tax=Micromonosporaceae TaxID=28056 RepID=UPI000A04E2E8  ali  22  2.......PSALRVEVEGAKELSVE----AAGTLGSVFDAVDQRWPRLGRR-LRDEQKQLRRYVNVYVDGEDCRGLAGLATPVRDGAEVQVLPSVAGGS............... 87
620 2.000e-14UniRef50_A0A2D8UXI1 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Pedosphaera sp. TaxID=2024890 RepID=A0A2D8UXI1_9BACT  ali  20  1MPVIIRIPSSLRNLADAR-----DNFLTEASTVGEALDCLLKDXPDL-KPHLEDERGNLPPFINVFLNEEDIRFLDGKASQCQQGDEXSIVAAIAGG................ 91
621 2.000e-14UniRef50_A0A0K2SG06 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A0K2SG06_9FIRM  ali  21  1MQVRVLYFAAARDAAGRKEEA---LELPEGATLQTLLDELTRLHP---------EIGRLRPALRVAVDESY----QAVEYVLRGGEEVALIPPVAGGS............... 82
622 2.000e-14UniRef50_I7MCR2 Ubiquitin-related modifier 1 homolog n=3 Tax=Eukaryota TaxID=2759 RepID=I7MCR2_TETTS  ali  41  1MKVTIELSGGLDLCFDGHKTFEVVLENQENIKMGDLITVIAKNYVKKKPEFFVGADNQLRAGILVLINDADWELEGKDEANVENKDRISFISTLHGG................ 97
623 2.000e-14UniRef50_T0C8U5 Molybdopterin synthase sulfur carrier subunit n=10 Tax=Alicyclobacillus TaxID=29330 RepID=T0C8U5_ALIAG  ali  16  1MQLRIALFANLREHF---QTRELTLTVPNGTTVAQLLPILCEEYP---------EAKPSLEKVMVAVNQVLVPA----QTVLQETDEIALLPPVGGGSPGLEENTRLRISPV. 96
624 2.000e-14UniRef50_UPI00037AD5EA MoaD/ThiS family protein n=1 Tax=Salinispora arenicola TaxID=168697 RepID=UPI00037AD5EA  ali  17  1..MIVKLPATLSR---QGRPGTLTLDVPAAATLGLVLAEIEKQLPGTVAK-IVDRDGKLYGYVNLYVNGDDVRHGAGVDTPVTEHDEILILPAISGG................ 91
625 2.000e-14UniRef50_Q1J1K2 Molybdopterin synthase sulfur carrier subunit n=13 Tax=Deinococcus TaxID=1298 RepID=Q1J1K2_DEIGD  ali  22  1MQVNVVFFARLKHETGLEAA---TIEAPAGATVRELAAQVEQTYGLSLR------------GCMVAVNETYAQ----PEQVLRDGDEVAFLPPVAGGAEE............. 81
626 2.000e-14UniRef50_M7MUQ4 9.5 kDa culture filtrate antigen cfp10A n=4 Tax=Micrococcaceae TaxID=1268 RepID=M7MUQ4_9MICC  ali  16  4..ITVEVPSVLSSALEGQRSLQV--PLPAEGTVRALLEVLGAQYPVFARR-VRDERGEIRRYVNIFVGPENIRDLSGLDSQLYPGRTVLIMQSVAGG................ 95
627 2.000e-14UniRef50_W6QL97 Ubiquitin-related modifier 1 n=18 Tax=Penicillium TaxID=5073 RepID=W6QL97_PENRF  ali  43  14ISITVEFTGGLELLFGNERKHKVVLPLEDGSNISYLLKYLVNNLMKDQRIDMFIMEDNVRPGILVLINDADWELEGEETYELQQGDNIVFVSTLHGG................ 114
628 2.000e-14UniRef50_A0A1P8W9T2 MoaD family protein n=1 Tax=Fuerstia marisgermanicae TaxID=1891926 RepID=A0A1P8W9T2_9PLAN  ali  18  1MKIEVLYEAQLRQLAGAPSMH---FEMAEDSTLLDVLRRAAEEGGSEFGAKLLSPEGGLQPGILVFIGEQAVAADAVPQQSVQDGDSILLLPPISGG................ 94
629 2.000e-14UniRef50_A0A101HTJ8 MoaD family protein n=1 Tax=Petrotoga mobilis TaxID=69499 RepID=A0A101HTJ8_9BACT  ali  17  1..MKIKFFSLIKFDL---KKDEVDYQLSGSKSVKEIIKLLDQEFANYFNRKLL-KDGELKSGTIILLNGRNIRHLQGLDTLVENKDEITIFPPSGGGYGLR............ 95
630 2.000e-14UniRef50_A0A2E3HSG1 Uncharacterized protein n=1 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2E3HSG1_9BACT  ali  18  1MKVTVKYFAVCRQMLNRDEE---DMELPEGAILQDVLDRLKDEKPEISG---------LFETMQMSVNWQYADY----ETKLSDNDEVALIPPVTGGSP.............. 83
631 2.000e-14UniRef50_A0A081BPQ6 Molybdopterin converting factor, subunit 1 n=2 Tax=Bacteria TaxID=2 RepID=A0A081BPQ6_9BACT  ali  17  1MTITIRLFARFRDLAGAA---VMAREINDGATVEDAIRLVEAEFPEF--------QGKLERMALVAVNEAYASR----QTRLQANDVVAFFPPVSGG................ 82
632 2.000e-14UniRef50_A0A251X3X8 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Thiotrichales TaxID=72273 RepID=A0A251X3X8_9GAMM  ali  22  1MAVTVKFFASLREQL---QQSEVKLELTVPTTVSALWRQICGDLP-------------LPINILMAVNLSYVTA----ETVVKDGDEVAFFPPVTGG................ 77
633 2.000e-14UniRef50_A0A2H5YDE5 Molybdopterin synthase sulfur carrier subunit n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2H5YDE5_9BACT  ali  21  1MRITVRLFALYRERLGAD---TLTLEVREGAQVADALALLSQRFPRML---------PLVDNTRVAVNLEFAE----PTHPLREGDEVALIPPVSGGA............... 82
634 2.000e-14UniRef50_A0A2E5J987 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E5J987_9GAMM  ali  23  5MNINVKYFASIRDLIGKDSEI---FDLNDGADVSDLWDLIIADRNKPAK-------------LLIAVNHEYV----GKKHKLKDGDEVAFFPPVTGG................ 81
635 2.000e-14UniRef50_S9UN30 Ubiquitin-related modifier 1 homolog n=3 Tax=Angomonas deanei TaxID=59799 RepID=S9UN30_9TRYP  ali  35  8..ITIGLSGGCELLFNHQHEIKIENAVPKNSTLQDFVSFLDENHYIKERKELFLDGAYVRPGVLVLINNCDSEVYGGASYGLQEGDEIEFISTLHGG................ 104
636 2.000e-14UniRef50_A0A1Y2FVD8 Ubiquitin-related modifier 1 n=2 Tax=Ascomycota TaxID=4890 RepID=A0A1Y2FVD8_9ASCO  ali  40  3VTVTVEFFGGLELIFAKRRKIKVTLPEAATFKISDLVNYLVETNPDKSRELLVSTDGQVRPGILVLINETDWELEGEGEYVLQQGDQIMFVSTLHGG................ 131
637 2.000e-14UniRef50_A0A1B7THZ0 Ubiquitin-related modifier 1 n=1 Tax=Hanseniaspora valbyensis NRRL Y-1626 TaxID=766949 RepID=A0A1B7THZ0_9ASCO  ali  38  5INIVVEFLGGLDSIFDNKRSYKVEVDNEEIVTLRDLIKYIAKELLVKPEDSIYIQDDTIRPGILTLINDVDWELEDELDYVLQNRDVISFTSTLHGG................ 104
638 2.000e-14UniRef50_A0A1Y3E4R9 Multifunctional fusion protein n=2 Tax=Trichinella TaxID=6333 RepID=A0A1Y3E4R9_9BILA  ali  35  924MQLTLEFVGGSERLLKCQQMHEIELDDGRAWTLASLFQWIKQNMLLVNNCSMLICGNSVRPGILVLINEVDWELCNGLQYVLKPNDKVTFISTLHGG................ 1025
639 2.000e-14UniRef50_W2TCC6 Ubiquitin-related modifier 1 homolog n=2 Tax=Strongylida TaxID=6308 RepID=W2TCC6_NECAM  ali  42  73.....................KVTVPDNDSLTVSELIQYVNDVMLKDTRKELLIEGKTVRPGVLVLINECDWELLGCEKAELHNGDLVTFLSTLHGG................ 150
640 2.000e-14UniRef50_A0A0L1KWG6 Ubiquitin-related modifier 1 homolog n=1 Tax=Perkinsela sp. CCAP 1560/4 TaxID=1314962 RepID=A0A0L1KWG6_9EUGL  ali  29  1MPLTVQFGGGCESFFGDQTKFLFTSQPTDPENMRELICLLKNKLLTVKEELFLTPEFTIRPGILTLIDDVDWEILGTLEASLKEVHRVTFISTLHGG................ 117
641 2.000e-14UniRef50_A0A016UVV7 Ubiquitin-related modifier 1 homolog n=5 Tax=Strongylida TaxID=6308 RepID=A0A016UVV7_9BILA  ali  36  4VHLNLEFSGGCEFLVGNQKEHKVTVPDGDSVTVFELIRYVKEVMLKDCRSDLLVEGGTVRPGVLVLVNECDWELLG..................................... 81
642 2.000e-14UniRef50_A0A286UE59 Ubiquitin-related modifier 1 n=1 Tax=Phellinus noxius TaxID=418867 RepID=A0A286UE59_9HOMO  ali  36  8IPLKIEFGGGLELLFSNQRSHRINLPSRKPADVNYLLRYLRDNLLKE-RVELFMENDTIRPGILILINDADWELEG..................................... 104
643 3.000e-14UniRef50_A0A2R4ZTX4 Uncharacterized protein n=2 Tax=Desulfurococcaceae archaeon AG1 TaxID=2027460 RepID=A0A2R4ZTX4_9CREN  ali  21  1MKVNVRFYAILRDLYGADKD---QIEIPEGSTIRDLLDILSKKNNKLGSFL-----EKRLSSIITLVNGLYAP----LEHKLGNGDTVDLLPPASGGCD.............. 87
644 3.000e-14UniRef50_UPI0006891CE1 hypothetical protein n=1 Tax=Desulfosarcina sp. BuS5 TaxID=933262 RepID=UPI0006891CE1  ali  17  3MSITMVLPGSLKKWMGNNSEAECE-----GATVLECVEFLENKFNG-FKKNIVDENGNLRDEVLVFKNGTNIMNLEGPATSIVDGDDISVIPFAAGG................ 93
645 3.000e-14UniRef50_A0A212UEC2 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Cytophagales TaxID=768507 RepID=A0A212UEC2_9BACT  ali  21  1MNLKIALFGIAREIVGQP---TLDLTAPEGQSVQELLGQLRQEYPGLSR----------LSSLAVAVNNEYAPD----DAPLHERDEIALIPPVSGG................ 80
646 3.000e-14UniRef50_A0A2S8WMS4 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Micrococcaceae TaxID=1268 RepID=A0A2S8WMS4_9MICC  ali  18  3.AIIIEVPSVLATTLGGNRK--LEAHIPTGASIGSLLDDLGEAYP-LFARRVRDERGQVRRFVNIFIDHDNIRALQGLDTVLLPGSTVMIMQSVAGG................ 95
647 3.000e-14UniRef50_A0A2V7RVV8 Molybdopterin converting factor subunit 1 n=29 Tax=Bacteria TaxID=2 RepID=A0A2V7RVV8_9BACT  ali  20  1MTVTVLLFASYADAVG---RSEIELDVTSGATVKDVIERVRQ----------MADAQRLPAAPMVAVNEQYASR----DRELRHGDEVALIPPVAGG................ 80
648 3.000e-14UniRef50_G7WND8 Molybdopterin synthase subunit MoaD n=3 Tax=Methanothrix TaxID=2222 RepID=G7WND8_METH6  ali  22  1MRVVVRSFARFREVVGEEAAF----DLPEGSTLADLLEEVASAHPGLER-VLSELEGAGGIGVTVLLNRRGADPSDLRRTVLEEGDEVAILPPFSGG................ 92
649 3.000e-14UniRef50_D1JBL1 Uncharacterized protein n=1 Tax=uncultured archaeon TaxID=115547 RepID=D1JBL1_9ARCH  ali  18  294..MKVKFPRALHELT---KMRETELDFDGPTTIVEVMEKLVEEYGETFREAIMDQNENIKRSFNVYLNGMNIKNLQGIRTEVHESDELIILSWVSGG................ 386
650 3.000e-14UniRef50_A0A0P6Y2D6 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Chloroflexi TaxID=200795 RepID=A0A0P6Y2D6_9CHLR  ali  23  1MSLRVLLFAHLREAVG---HHQLVLYLPEGSRVRDLKQALLDRHPEL---------GSRLSNVIVAVNQV----FSGDEDILEEGAEVALFPPVSGGSLPPTFVAV....... 90
651 3.000e-14UniRef50_A0A1F8RR58 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_16_64_43 TaxID=1797659 RepID=A0A1F8RR58_9CHLR  ali  17  1MAM-VILPAPLRPYAAGQKEVSV-----NGSTVADALSDLTRQHPAL-HQHIFDERGDLRAFVHLFVDGEELESAVHDKVSLASGARLTLLPSIAGGYTAA............ 94
652 3.000e-14UniRef50_E6SFU5 ThiamineS protein n=17 Tax=Actinobacteria TaxID=201174 RepID=E6SFU5_INTC7  ali  23  6...RVILPGLLRDLVGGIGELEVPAD-HGGQTVGQLLDAAFREHRILDGK-VRDERGLLRPHVKVFVNGEDVSRAEGLATTVPPGARVHIINAVSGG................ 97
653 3.000e-14UniRef50_A0A1F9ZKG9 Molybdopterin converting factor subunit 1 n=4 Tax=unclassified Euryarchaeota (miscellaneous) TaxID=115531 RepID=A0A1F9ZKG9_9EURY  ali  20  3IKVHVKLFSSFREIVGAKEE---DLQLDDGATVQVLLEHYIAKFPQM---------GKFREHIILSVNKEY----GAPTKVLKAGDEVSFLPPVSGG................ 83
654 3.000e-14UniRef50_A0A2H9QVZ8 Molybdopterin synthase sulfur carrier subunit n=2 Tax=unclassified Euryarchaeota (miscellaneous) TaxID=115531 RepID=A0A2H9QVZ8_9E  ali  19  1MKITVKFFAGHRDAVGKEK---IKMNVKKDAIINDVMNSLIKRYPAL---------EQLKDYTIASLNHSYA----KLNEKLKEGDELAFFPPVGGG................ 81
655 3.000e-14UniRef50_I3J7T7 Ubiquitin-related modifier 1 n=33 Tax=Vertebrata TaxID=1261581 RepID=I3J7T7_ORENI  ali  40  5IAIHLEFGGGAELLFNGVKKHPVTLPSSEPWDMKQLLVWIQRNLLKE-RPELFVQGDSVRPGILVLINDADWELMGELDYQLQDQDNVVFISTLHGG................ 101
656 3.000e-14UniRef50_A0A2E8HAX2 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Gemmatimonadaceae bacterium TaxID=2026741 RepID=A0A2E8HAX2_9BACT  ali  17  1MRVEVLFFAGARDKVGQRAMG---VSLAPGATVEKLLQQLSDSYPGF---------STMAATAQVAVNEEYAPKT----LTLKEGDEIAVIPPVSGGACQAAFRVVDR..... 92
657 3.000e-14UniRef50_A0A2H5YFG3 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A2H5YFG3_9BACT  ali  16  1MKARVLLFARLKDLAG---VSEAEVEIGEGLTAADVFRLLQGLYPGLAS---------YDAPLAYAVNARYVS----PEHPVRDGDEVAFIPPVSGGGTCTSR.......... 87
658 3.000e-14UniRef50_E1IIL5 Molybdopterin converting factor, subunit 1 n=3 Tax=Bacteria TaxID=2 RepID=E1IIL5_9CHLR  ali  22  1..MQIRFFAGHRDIVGQTSQAR---QLEPGTTLAQLWHTLVAEYPQL---------EPYTGRLLYAVNQEFAE----PERILGEGDEVAFIPPVSGGAPFSPFRI........ 87
659 3.000e-14UniRef50_A0A2A4SYZ0 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2A4SYZ0_9GAMM  ali  16  1MSVTVKYFASLREHVG-QAEEQCQVP-ECGCSASEVWVQLNAAL-------------ELPSNILVAVNQDYAS----LDTRINDGDEIAFFPPVTGG................ 78
660 3.000e-14UniRef50_A0A2D6BTZ5 Molybdenum cofactor biosynthesis protein MoaE n=7 Tax=Bacteria TaxID=2 RepID=A0A2D6BTZ5_9DELT  ali  16  1MQVMVKLFGSIREATGAE---ELAVPLADGSRVSALRSLLVEQEPAFALAH-----GELGERLRVSVNMEIVTG----DPPLSDGDEVAFLPPVAGGQDDPPARCRLRDSALD 101
661 3.000e-14UniRef50_L0E1Q4 Molybdopterin converting factor, subunit 1 n=4 Tax=Ectothiorhodospiraceae TaxID=72276 RepID=L0E1Q4_THIND  ali  21  1MTITVHYFARLREDVGRASD---EVPSDGITTVAELWQHLHRAPPP--------------PRLMAAVNQAHAR----LDSAVADGDEVAFFPPVTGG................ 76
662 3.000e-14UniRef50_A0A2E6VW71 Uncharacterized protein n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E6VW71_9DELT  ali  19  9MKIRLLYFAVIKDLVGKNQE---DMVLDGYATVRQLLVRFAEHYPT---------TEGVLQACRVAVNQDFV----DLDHALQDDDEVVFIPPVAGGQPEPQQFRMLQKDALS 106
663 3.000e-14UniRef50_A0A2U3CL44 Uncharacterized protein n=1 Tax=Candidatus Heimdallarchaeota archaeon B3-JM-08 TaxID=2012493 RepID=A0A2U3CL44_9ARCH  ali  20  1MKILLVFLGSLQYDLG---QMELTYNFKEEASVKSAVQELSALPKYKELSKFFTDSYESTRSVLVFINEQDISVLRGMDSPLQQGDKLTFIPVIHGG................ 94
664 3.000e-14UniRef50_A0A146ZDB2 Ubiquitin-related modifier 1 n=1 Tax=Fundulus heteroclitus TaxID=8078 RepID=A0A146ZDB2_FUNHE  ali  31  4..ITVEFEGGAETLFGAKRKFRIRL-LTNPTTAGHLLYWMR-LSLRCKRPDILFDSAGLQPGFLVVINDVDWEVNGREKAEIKEGDTVCIISTVHGG................ 124
665 4.000e-14UniRef50_A4RS06 Uncharacterized protein n=3 Tax=cellular organisms TaxID=131567 RepID=A4RS06_OSTLU  ali  16  3.TITVLFFARARELAETSSAS-VDLDADASPTVATARARLLELYPQLESVLL---------TAVFALNQSYVDRAREADTALKPGDELAVVPPISGG................ 88
666 4.000e-14UniRef50_F5T271 Molybdopterin synthase sulfur carrier subunit n=16 Tax=root TaxID=1 RepID=F5T271_9GAMM  ali  20  1MSIQVKFFASLREKLGQA-----DMELTTASTALDAWNQATQNKP-------------VPDNLLVAIN----LDYAKLNTPVQDGDEVAFFPPVTGG................ 75
667 4.000e-14UniRef50_A0A1G0AGT2 Uncharacterized protein n=1 Tax=Euryarchaeota archaeon RBG_19FT_COMBO_69_17 TaxID=1797984 RepID=A0A1G0AGT2_9EURY  ali  18  7.RIHVSVPYALREFTRGEDLVDVEAE-----TLAQAIAGLASRYPGLGYRIL-DDQGRLRRYVNAYVNDDPVSHMDPHDVRLRRGDTVTILPSVAGG................ 96
668 4.000e-14UniRef50_A0A0C1YIY4 Molybdopterin synthase sulfur carrier subunit n=15 Tax=Cyanobacteria TaxID=1117 RepID=A0A0C1YIY4_9CYAN  ali  22  3ISITVKLFAAYQDAYGQP---EVRLELPAGATAAEVRDRLIAEHPELAQWRDLTRFG---------VNLQFVE----PDTPLQSGDEVVLIPPVSGG................ 83
669 4.000e-14UniRef50_UPI000C2916DF MoaD/ThiS family protein n=1 Tax=Alteromonas sp. P0211 TaxID=2048003 RepID=UPI000C2916DF  ali  15  33IKVTVKFFAFFREQLGISA---IDVECAQNSRVQDVLNRLYQDFPRLA-------EMVKSQNTLCAVNHQLV----GLEHALNNGDEVAFLPPVTGG................ 115
670 4.000e-14UniRef50_D6U1G2 Thiamine S protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=D6U1G2_9CHLR  ali  13  3.SVTVIFPSVLRAKINNNSSITVI-----GHTIREVIEAL-EQYAPGMQFNLCYETGELRPYVNIFLEKENIRFLQGLDTPVPAGARIRILQSVAGG................ 92
671 4.000e-14UniRef50_A0A2P5WWL0 Ubiquitin-related modifier 1 homolog n=1 Tax=Gossypium barbadense TaxID=3634 RepID=A0A2P5WWL0_GOSBA  ali  38  536..ITVVLSGGLELLCKSVKFHNVNVDLPKGASMRDLLAWVRTNLIKE-RPEMFMKGESVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG................ 632
672 4.000e-14UniRef50_A0A1G0APA2 Uncharacterized protein n=2 Tax=unclassified Euryarchaeota (miscellaneous) TaxID=115531 RepID=A0A1G0APA2_9EURY  ali  18  11.............AVATRGEREIDIEYEG--TLAGLFDAVAERYGREFRQRIFDGDGGLKRFVNVYVNGEDARYLRGLETPVGRDATVDLLPAIAGG................ 92
673 4.000e-14UniRef50_A0A2E5YN43 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E5YN43_9DELT  ali  15  28.SMRISFYATLRKIVG---EKHIELPLPEPTSLAEVLEAVVLAHPDLGAEML-DESGELDRGIHLFVDGRSSRFLSGEMATVVDGSQIEFFPAVAGG................ 120
674 4.000e-14UniRef50_A8JJB2 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Chlorophyta TaxID=3041 RepID=MOC2A_CHLRE  ali  19  1MQIKVLYFAKSREVAG---VNEQTFELGDGAHTEDLLAQIIAAHPAL---------DSVMKTCVFALNQEYVRPQDKE--ALKDGDEVAIIPPLSGG................ 83
675 4.000e-14UniRef50_L0AM36 Molybdopterin converting factor, small subunit n=11 Tax=Halobacteria TaxID=183963 RepID=L0AM36_NATGS  ali  13  1MQLECVFFGPFRDAVGEKSVHEVD---AEPATVGDLLADLEVTYSDLEGELLADDEKGLAGDTVVTVDERNVGHLDGLETELDEASVVRMIPSVYGG................ 95
676 4.000e-14UniRef50_A0A170PHR5 Putative molybdenum cofactor biosynthesis protein D/E n=5 Tax=Chloroflexi TaxID=200795 RepID=A0A170PHR5_9CHLR  ali  19  1MEIEIRLFATLKDRAGSDR-IRVRLP-ADPTTVGLLLEAVGADYPALAPAL---------RSALVAVN----RAFAGSETPVTLGDEVAIFPPVSGGQTPFP........... 87
677 4.000e-14UniRef50_A0A2N3G6D1 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-3 TaxID=2013648 RepID=A0A2N3G6D  ali  15  3...TIQFFAALRQIAGAR-----EIEMEAG-TVKEALERLSTDYGGRLDRYLRIST--------VLINGKNVAQRKGRRTKLEPDDVVSIFPPLGGG................ 82
678 4.000e-14UniRef50_A0A2N0L201 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2N0L201_9CHLR  ali  20  1MELKVRFFALYRERAG---KNLVSLDLPDKSTVADLTAEVRRRYPNLAPPEV---------SIVVAVNADYAE----PETMLRPGDDVCLIPPVSGG................ 81
679 4.000e-14UniRef50_A0A087S327 Sulfur carrier protein ThiS adenylyltransferase n=64 Tax=cellular organisms TaxID=131567 RepID=A0A087S327_9ARCH  ali  15  16...............GGEKKVEVSAE-----SLQDAFAKISESMGDDFKRRVLEGDGTPRSLINIYINGKNAKFSDGLNTVLKDNDEVYILPAVAGGSEELSKKELDK..... 103
680 4.000e-14UniRef50_A0A0S8HXZ5 Molybdopterin synthase sulfur carrier subunit n=1 Tax=bacterium SM23_31 TaxID=1703762 RepID=A0A0S8HXZ5_9BACT  ali  19  1MKIKVRFFAICRELAGTD---IAELELPKNADKQLLWNELYKLYPDL---------SAVSAHVALAVNDEYSAG----DFTLHDGDEISLIPPVSGG................ 81
681 4.000e-14UniRef50_A0A147K2W6 Uncharacterized protein n=1 Tax=Hadesarchaea archaeon YNP_N21 TaxID=1776333 RepID=A0A147K2W6_9EURY  ali  26  1MKVNVKYIGQLSYITKKKSE---TFDLENETRIGPLIELIINKYPGLREYV-----DLKRGPSIVLLNGQRIEFLEGENSMVKDGDEITLLPPLGGG................ 89
682 4.000e-14UniRef50_A0A1F8KCV9 Uncharacterized protein n=1 Tax=Chloroflexi bacterium GWB2_49_20 TaxID=1797612 RepID=A0A1F8KCV9_9CHLR  ali  17  4ITVSISYFNILASYAGTRK---VEVSLPEGATLRHVVEHLDKNASQQLHQVLF-QKGEFSKYIKIFLNQQLV-GEGRLETPLKNGDEMMIFPAIAGG................ 95
683 4.000e-14UniRef50_A0A2E0KVU4 Molybdopterin synthase sulfur carrier subunit n=13 Tax=Bacteria TaxID=2 RepID=A0A2E0KVU4_9CHLR  ali  19  1MQIKVLLFATLKDIAGQNS-LLLDL-TGDVATVADVRQGLTARYPKIQANV---------EVAIASVNEEYAQN----DTVVHDGDTLAFFPPVSGGEGDYPEIFRLAHEPIN 98
684 4.000e-14UniRef50_A0A1G0NQL2 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Ignavibacteria bacterium GWA2_54_16 TaxID=1798420 RepID=A0A1G0NQL2_9BACT :_  ali  14  1MKITLRLFSVARDLAGFREQ---TMEIPAGSRAANILEILQDRNPKFA---------EWQHAVRIAVNQEYVSN----DHPLHDGDDVAVIPPVSGG................ 81
685 4.000e-14UniRef50_A0A2M8PT62 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A2M8PT62_9CHLR  ali  20  39MEIHVLLFATLKDIAGQSR---LTLSLPENATVDDVRQALIERFPALEANV---------KSAIAAVNEEFAFAGD----VIQDGDEVAFFPPVSGGS............... 121
686 4.000e-14UniRef50_A0A1F5CUW7 Uncharacterized protein n=1 Tax=Candidatus Bathyarchaeota archaeon RBG_16_48_13 TaxID=1797381 RepID=A0A1F5CUW7_9ARCH  ali  18  2MNIKVQYYALIRELV---QKEEEGVELVEGSSLRDLLEQLTKEYGADFRDLFFERDGDVAHRILMFADGAEVDLAKDGNRRLKNGSNVQFFQPVGGG................ 95
687 4.000e-14UniRef50_A0A0C4EU40 Ubiquitin-related modifier 1 n=9 Tax=Pucciniales TaxID=5258 RepID=A0A0C4EU40_PUCT1  ali  39  20IDLKVEFGGGLESLFSNQTSLEIQL--AQPHTMGHLVSILSAQVKPQKSLSLFCSREPEWPGILPLVNDEDWELLEGMNAVLKQGDNVMFISTLHGG................ 119
688 5.000e-14UniRef50_A0A1L8F1D4 Ubiquitin-related modifier 1 n=3 Tax=Euteleostomi TaxID=117571 RepID=A0A1L8F1D4_XENLA  ali  41  49....LEFGGGAELLFDGIKRHQVTLPNSNPWDIRQLLVWIRDNLLKE-RPELFIQGDTVRPGILVLVNDADWELMGELDYQLQDKDNIVFISTLHGG................ 141
689 5.000e-14UniRef50_A0A0S8GAM4 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A0S8GAM4_9PROT  ali  19  1MSIQVRYFASLRERLGRTQE---TVDAVSAATVADLWLHVSAGAP-------------WPSNTLVAVNHEYSHAGQ----RLRDGDEVAFFPPVTGG................ 77
690 5.000e-14UniRef50_A0A151AVV0 ThiS family protein n=2 Tax=Moorella TaxID=44260 RepID=A0A151AVV0_9THEO  ali  22  1MKIKFSAFADLKEIVGQK---HMEFELEDGATVGDFLAFLLKRYGKPMERFLLKSAGGYWPFLL-LVNQQDVR-PDNYQKKLHEGDEIIILFPAEGG................ 92
691 5.000e-14UniRef50_A0A1K0FCI1 Uncharacterized protein n=1 Tax=Couchioplanes caeruleus subsp. caeruleus TaxID=56427 RepID=A0A1K0FCI1_9ACTN  ali  22  3...KIFVPTIMRKHTANQSAVEV-----AGSTVSEAIDNLLVSYPT-VGELLRGSDGRLRAYLNVFVNGDDIRGLDGEQTGLTEKDEVLVLPAMAGG................ 90
692 5.000e-14UniRef50_A0A1Q1FER0 Uncharacterized protein n=4 Tax=Halobacteriales TaxID=2235 RepID=A0A1Q1FER0_9EURY  ali  20  1MHVAFVTYATIRDSIGEKR---LEREFESGTTVGAALTALADEYENL-GPLLFDSDGDLRPNVNVLVDEENVRNGEGPATVLSDGATVSLAPGVAGG................ 93
693 5.000e-14UniRef50_Q6BVZ7 Ubiquitin-related modifier 1 n=4 Tax=Saccharomycetales TaxID=4892 RepID=URM1_DEBHA  ali  42  3IKVKVEFLGGLDVISNGVREHKCEVPLEEGATMIDLIKYITATIISDPKDVVFIEEGTVRPGILVLINDTDWELEGMEDYVVESGDVLTFTSTLHGG................ 101
694 5.000e-14UniRef50_A0A0D5ZE17 Uncharacterized protein n=1 Tax=uncultured archaeon TaxID=115547 RepID=A0A0D5ZE17_9ARCH  ali  20  4.KVKIRYFALYRDLSGKSDE---TMDLKDGSTLDSLLDEVRESHPIFRKQ---------SGEFLLAVNEEYAA----PETVLKDGDEVAIFPNVSGG................ 83
695 5.000e-14UniRef50_R7Q6Y1 Ubiquitin-related modifier 1 homolog n=1 Tax=Chondrus crispus TaxID=2769 RepID=R7Q6Y1_CHOCR  ali  39  36.TIVLEFGGGLEALFSDAKSLSVT-PPADIQSLGKLITWVRDHLIT-ARHDMFVSGDALRPGVLVLVNDVDWELEDTVNYRFAGGDRIAFISTLHGG................ 129
696 6.000e-14UniRef50_A0A2N2NB10 Uncharacterized protein n=4 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A2N2NB10_9CHLR  ali  21  2MKIKVNLVAAYKLIA---QKGQLTLVLPEKSSIHDVISGVIKAAPAL-KTHWLDKDGSPSHHLHPFLNGDDVYTLEGLNTCLVDGDSLEFIPPLSGG................ 95
697 6.000e-14UniRef50_A0A2C7A6E2 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Roseomonas rhizosphaerae TaxID=1335062 RepID=A0A2C7A6E2_9PROT  ali  17  1MPV-IQVPSALRRYTGQQARIPV-----AGATVADALDNLVEAAPEMRNHLFA--AGALRPFVLVSRNGQDIRLLQGLGTPVAGDDEIRILASIAGG................ 89
698 6.000e-14UniRef50_A0A2E7MNE7 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E7MNE7_9BACT  ali  16  36MKVRVLFFASSSEIVGCK---EAETEIAEGATVGSFKRDLMLQYPDLLR---------LKNVLSIAVNTEFADDLR----VLKAGDEIAFIPPVSGG................ 116
699 6.000e-14UniRef50_H1Z2S2 Thiamine S protein n=2 Tax=Methanomicrobiaceae TaxID=2194 RepID=H1Z2S2_9EURY  ali  13  1MKLKIKFFARFAEIFPK----ETDFEYDGENTVYDALKMFCGKYPEGT-ESIFNQDGSFQDYVLIMHNFVRIDKDDVKAIQIVSGDEIAVYPPVAGG................ 92
700 6.000e-14UniRef50_A0A1D2UES4 Uncharacterized protein n=3 Tax=Acidobacteriales TaxID=204433 RepID=A0A1D2UES4_9BACT  ali  22  1MRVNVLYFGTLKDLFALPHEP---LDVPDGATVETTLSLLRAR---------TSKQSEVWRALAVAVNREYA----GPATVLHEGDEVALLPPVSGGTQGR............ 85
701 6.000e-14UniRef50_A0A062V7T5 MoaD family protein n=1 Tax=Candidatus Methanoperedens nitroreducens TaxID=1392998 RepID=A0A062V7T5_9EURY  ali  13  2..VIVKFFSTLRNITEVREAI-----IEQEGSVYDILNALLSNYGDL-KEAIFDEKGDI--YINILLNGRNIEYLNGPATMVSQHDTLYLFPPIAGG................ 88
702 6.000e-14UniRef50_X8JCU3 Ubiquitin-related modifier 1 n=8 Tax=Dikarya TaxID=451864 RepID=X8JCU3_9HOMO  ali  44  35.TIKVEFGGGMELLFSNQRSHTVQLPPTKPSDLHYLIFHMKD-HMLKEREELFIEGDSVRPGILVLINDTDWELEGEGAYQLKSGDEIVFISTLHGG................ 133
703 6.000e-14UniRef50_A0A1X7SE31 Ubiquitin-related modifier 1 homolog n=1 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7SE31_AMPQE  ali  34  7..............................WTIRDLIGWIKQNLL-CERPELFVQGESVRPGILVMINNIDWDLVGGLDYVINNDDIILFISTLHGG................ 72
704 7.000e-14UniRef50_A0A196SIC7 Ubiquitin-related modifier 1 homolog n=2 Tax=Blastocystis sp. subtype 1 (strain ATCC 50177 / NandII) TaxID=478820 RepID=A0A196SIC  ali  42  14..ITVEFGGGMDILFHNRKKIEL---ATIPKTVNELIAYLKEK-ELSERPELFVDGDRLRSGILVLVNDVDWEVLEGGDTELADGDNVLFLSTLHGG................ 104
705 7.000e-14UniRef50_A0A2J8AJZ0 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Tetrabaena socialis TaxID=47790 RepID=A0A2J8AJZ0_9CHLO  ali  16  1MRIKVLFFARSREVAG---VSEQTFELADGADTETLLADITSAYPALQS---------VMKTCVFALNQEYVR--PGDKEALKEGDEVAIIPPLSGGPALSKEQQAAGSSA.. 97
706 7.000e-14UniRef50_A0A0K1FD16 Uncharacterized protein n=2 Tax=Arsenicicoccus TaxID=267408 RepID=A0A0K1FD16_9MICO  ali  19  1MSVTMRLPAPLQAMV--QAPPEVVLDLPADASLADALDELRRRHPTVENK-VRDERGALREHVNVFVDGADVKRGAGLVTVLPQGATVIVLSAVSGG................ 94
707 7.000e-14UniRef50_I3ZJN0 Molybdopterin synthase sulfur carrier subunit n=8 Tax=cellular organisms TaxID=131567 RepID=I3ZJN0_TERRK  ali  22  1MQVNVLFFGVLREAIGASETVEV----ADMTTVADLLTYFEERSREDLAEMW--------PRIAVAVNREYV----GREHVLMEEDEVALLPPVSGGASTR............ 85
708 7.000e-14UniRef50_A0A2G5KYM2 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Reichenbachiella sp. 5M10 TaxID=1889772 RepID=A0A2G5KYM2_9BACT  ali  20  1MRVSVLAFGIARDILGTR---TLDLDLATGQTVGTVVAELMQRYNDLAK----------LSSMLVAVNESYVPD----DYVVKEGDELAIIPPVSGG................ 80
709 7.000e-14UniRef50_UPI0008F9C945 ubiquitin-related modifier 1 n=1 Tax=Bemisia tabaci TaxID=7038 RepID=UPI0008F9C945  ali  37  30.KVNIEFMGGAEMMFDNQKKLNVTLPPAEKWTIRSLLAYMKEHCAKGGGLERFFTGDSVTPGILCVINDQDWELLDTLNYELEPNDNIIFISTLHGG................ 126
710 7.000e-14UniRef50_F8IKK9 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Alicyclobacillus TaxID=29330 RepID=F8IKK9_ALIAT  ali  15  1MRVDIRLFANVKELAGQDK---LELDVPDDATVSDVLRALRQAYPALHDAL---------DHVMVAVNLE----LADPSRHVRPTDEIALIPPVGGGESEHAYARLTR..... 92
711 7.000e-14UniRef50_UPI000A02E713 cyclic pyranopterin monophosphate synthase MoaC n=1 Tax=Patulibacter minatonensis TaxID=298163 RepID=UPI000A02E713  ali  15  16MRVDVRVFAGLREYAGTSRT---TVEVPGGSTARDAVEALWSALGRP----------DPGRAMVLAVNRDYVAD----DAVLHDGDELALIPPVSGGAELPP........... 100
712 7.000e-14UniRef50_B8D487 MoaD family protein n=12 Tax=Archaea TaxID=2157 RepID=B8D487_DESA1  ali  17  3.KVKIRLFASLREKYG-VSEIEVEVESDE---FREAIEKAGEILGRDFIDEVLTSEG-YRSDRIILVNGRHIQFIEEL--KLRDGDVIAIFPPIAGG................ 91
713 7.000e-14UniRef50_A0A2V8RCF7 Uncharacterized protein n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8RCF7_9BACT  ali  16  37IRVRLLLFGAAREAAATDEAV---LDLGERATAREAFERVLDAYPDLRR---------FRSSLLVAVNQEYAR---DLEVELKDGDEIALFPPVSGGSGER............ 122
714 7.000e-14UniRef50_A0A212RK95 Molybdopterin synthase catalytic subunit n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A212RK95_9CHLR  ali  16  3MEVQVRLFATLKDRAGRE---VITVRLPDGASVADLLRAVAEAYPSLQ---------PYLPSTVVAINHEFAFPEDD----VRPGDEVALFPPVSGGGPEPPEVIALTAEPID 101
715 7.000e-14UniRef50_P0CT26 Ubiquitin-related modifier 1 n=7 Tax=Eukaryota TaxID=2759 RepID=URM1_USTMA  ali