current user: public

If you have questions about the server, please let us know.

Query: [S] KOG4147 Uncharacterized conserved protein, from COG1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# E-value Template Links and tools%idFirst MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDIPLRTNLPPPFRNYKYDALKIIHQAHKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYKNYKANPISSWLast
1 1.000e-59UniRef50_U3KGR6 Chromosome 2 open reading frame 76 n=30 Tax=Gnathostomata TaxID=35060 RepID=U3KGR6_FICAL  ali  72  1MSAGRATVTVRLVRSFQHRNFRPVVYHGVPLDQTVKDFMAFVLKDVSSRAGLPPPFKNYKYDTMKIIHQAHKSKTGELVVSLEDDDKLILKEDSTLKAAGVANETELAFFCEEDYRNYRANPVSAW 126
2 2.000e-59UniRef50_Q3KRA6 UPF0538 protein C2orf76 n=70 Tax=Theria TaxID=722675 RepID=CB076_HUMAN  ali  100  1MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDIPLRTNLPPPFRNYKYDALKIIHQAHKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYKNYKANPISSW 126
3 5.000e-59UniRef50_Q32KX9 UPF0538 protein C2orf76 homolog n=31 Tax=Amniota TaxID=32524 RepID=CB076_BOVIN  ali  91  1MASEDVTITVRLIRSFEHRNFRPVVYHGVHLDQTVKDFIVFLKQDIPLRASLPPPFRNYKYDKLKIVHQAHKSKTNELVLSLEDDDRLLLKEDSTLKAAGIASETEIAFFCEEDYKNYKANPISSW 126
4 1.000e-58UniRef50_A0A1U7RDD9 UPF0538 protein C2orf76 homolog isoform X2 n=19 Tax=Euteleostomi TaxID=117571 RepID=A0A1U7RDD9_ALLSI  ali  71  1MSSETATITVRLVRSFEHHNFRPVVYHGVHLDQTVKQFVAFIRNDVSSRAGLPPPFRNYKYDTMKIIHQAHRSKTNELVVSLEDDDKLILRDDSTLKAAGVANETELAFFCEEDYRNYKANPVLAW 126
5 3.000e-58UniRef50_F1RY07 Chromosome 2 open reading frame 76 n=49 Tax=Euteleostomi TaxID=117571 RepID=F1RY07_PIG  ali  90  1MASEEVTITVRLIRSFEHRNFRPVVYHGVHLDQTVKEFIVFLKQDIPLKTSLPPPFRNYEYDKLKIVHQAHKSKTNELVLSLEDDDKLLLKEDSTLKAAGIANETEIAFFCEEDYKNYKANPISSW 126
6 3.000e-58UniRef50_A4IGN3 UPF0538 protein C2orf76 homolog n=28 Tax=Gnathostomata TaxID=35060 RepID=CB076_XENTR  ali  68  1MMPGGATVTVRLVRSFEHRNFRPVVYHGVNLDQTVREFIVQINEDIPHRAALPLPFKKYSYDTLKIIHQPHGAKTNELVVGLEDDERLILAPGGTLREAGVAHETELAFFCHKDYQTYKANPVSKW 126
7 1.000e-57UniRef50_Q9CRW3 UPF0538 protein C2orf76 homolog n=106 Tax=Amniota TaxID=32524 RepID=CB076_MOUSE  ali  83  1MAAEEATLTVRLIRSFEHRNFKPVVYHGVNLHQTVKEFIIFLKQDVPLRTSLPPPLRNYKYDTLKILHQAHKAKTNELVLGLEDDDTLLLKEDRTLKDSGVASETEIAFFCGEDYKRYKANPISSW 126
8 5.000e-57UniRef50_Q66IB8 UPF0538 protein C2orf76 homolog n=20 Tax=Euteleostomi TaxID=117571 RepID=CB076_DANRE  ali  63  1MMCDRAVLTVRLVRSFEHRNFKPLVFKDVNLDQTVDEFISFVKQDISVRAGLPPPFRKFDYDTLKIIHQAHGAKTNELVMSLEDDEKLILREGCRLRACGVANETELAFFKMTDYIKFKADPHSEW 126
9 1.000e-56UniRef50_M0R9J6 Hypothetical LOC288978 n=5 Tax=Boreoeutheria TaxID=1437010 RepID=M0R9J6_RAT  ali  80  1MAVEEATITVRLIRSFEHRNFKPVVYHRVNLHQTVKEFIIFLKQDVPSRTSLPPPLRNYKYDTLKILHQAHKAKTNELVLGLEDDDTLLLKEDRTLKDSGVASETEIAFFCGEDYRRYKANPTASW 126
10 1.000e-55UniRef50_UPI000C6DE551 UPF0538 protein C2orf76 homolog isoform X1 n=1 Tax=Xiphophorus maculatus TaxID=8083 RepID=UPI000C6DE551  ali  63  16.....AVVTVRLIRSFEQRNFKPVVFQEVSLNQTVQDFMRWVRDDIATRDGLPPPFRKYGYDTMKIIHQAHSSKTSELVMSLDDDEKLILQDDQTLKAAGVANETEVGFFRKEDYVFYKANPKSKW 136
11 4.000e-55UniRef50_A0A2Y9PSN3 UPF0538 protein C2orf76 homolog n=8 Tax=Euteleostomi TaxID=117571 RepID=A0A2Y9PSN3_DELLE  ali  82  1MASEDVTITVRLIRSFEHRNFRPVVYYGVHLDQTVKEFIVFLKQDLPIYPSHPLPFGNHKFDKLKIVHQAHKSKTNELVLSLEDDDRLLLKEDSTLKAAGIANETEIAFFCEDDYKNYKANPLSSW 126
12 2.000e-54UniRef50_A0A1S3I8R4 UPF0538 protein C2orf76 homolog isoform X1 n=6 Tax=Bilateria TaxID=33213 RepID=A0A1S3I8R4_LINUN  ali  48  38MAEEGVTVTVRLIRSFPHRNIKHIVFKNVSVSQTAADFMTVVNKDIATCSELPPPFKKYQYDTMKILHKAHGFKTNDPVINTDHEEN-ILDPGRTLSEQGVANETEISYFKREDYEHYKANPVTQW 162
13 2.000e-53UniRef50_UPI000C039A05 UPF0538 protein C2orf76 homolog isoform X1 n=2 Tax=Eumetazoa TaxID=6072 RepID=UPI000C039A05  ali  48  11....GATVTVRLIRSFEYRSIKYVVFKDVSLEQTAEDFMDFVVSEIKKRPDVPLPFRTFAYDTMKIQHKAHGAKTSDPVINTENDEMLMLRHDCSLSENGIGHETEISFFKKEDYERYKDNPMLKW 132
14 1.000e-51UniRef50_A0A210PVH4 UPF0538 protein C2orf76-like n=6 Tax=Eumetazoa TaxID=6072 RepID=A0A210PVH4_MIZYE  ali  49  9......TVTVRLIRSFEHRNIKPVVFQDVDLTQKTRTFMECVDNDLKTRKGIPPPFRTFKFDTMKILHQAHGSKTSDPAINTDCDEELILSPDVTLQDSGIKNETELSYFKREDYEKYKLDPTLKW 128
15 2.000e-50UniRef50_A0A1Y2EWV7 Uncharacterized protein n=5 Tax=Fungi TaxID=4751 RepID=A0A1Y2EWV7_9ASCO  ali  36  1MPVEDSVLTIRVIKSFPYRITKNLVLQHVNLTTTVAQLKDLSKEEINTKPGW-KVYKHVKLDTLKLYTKAHGSKTTNLIINLDHDDWILDDGDATLASLGIENETEISFFNRDDYEAFKADPTEKW 126
16 2.000e-49UniRef50_T2MC28 UPF0538 protein C2orf76 n=1 Tax=Hydra vulgaris TaxID=6087 RepID=T2MC28_HYDVU  ali  45  1MEQNGCVVTVRLIRSFEHRNIRNIVYHQVDTSMTCKSFIDFVLKDIALRTDIPPPFRKFEYNKMKIEHQPFGMKSNDPVINRDNDEKLILQDEKSLADMGVINETVLSFFRFDDYKKYSSNPQLVW 126
17 2.000e-49UniRef50_G7DZQ5 Uncharacterized protein n=2 Tax=Mixia osmundae (strain CBS 9802 / IAM 14324 / JCM 22182 / KY 12970) TaxID=764103 RepID=G7DZQ5_MIXOS :  ali  35  596.SVQDATLTIRVIKSFAYRSTKNLILHHVDLTTTVGQLKARVILDIQTAPGFKP-YRNAKLDTLKLYTKAHGAKTTNLIINMDNDEWILDDDGATLATMGLENETEVSFFGREDYEAFKKDPETKW 720
18 3.000e-49UniRef50_W4XKD5 Uncharacterized protein n=1 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=W4XKD5_STRPU  ali  50  4..SSEVLVTIRLIRSFLHRNIKHIVLHNVNLDDTVEELMNKIKEDIKTRSGLPPPFRKHGYDTLKVEYKKHGSKTSDPVINKEDDDKLMLKPDQTLKACNIENETEISFFNRKEYEQYKTDSTVVW 127
19 4.000e-49UniRef50_A0A0C4EID2 Uncharacterized protein n=6 Tax=Fungi TaxID=4751 RepID=A0A0C4EID2_PUCT1  ali  33  16.PNTDATITVRIIKSFEYRNFKNLVLHHLNLETIKIDDLLALCQKQISSASGWKMFQNVALDTFKLYSKAHGAKTTNLIINLDHDDWILEDRSKSLSDYGLENESEVSLFNRTNYEAFKANPQQKW 140
20 3.000e-48UniRef50_A0A0L0VLL7 Uncharacterized protein n=5 Tax=Basidiomycota TaxID=5204 RepID=A0A0L0VLL7_9BASI  ali  32  16.PSTDATITVRVIKSFEYRNSKNLVLHHIDLETTIDELLTLCLQQISSAPGW-KTFQNVALDTFKLYSKAHGSKTTNLIINLDHDDWILEDRSKSLSDYELENESEVSLFNRASYEAFKLNPQQKW 140
21 3.000e-48UniRef50_A7S4F2 Predicted protein n=9 Tax=Eumetazoa TaxID=6072 RepID=A7S4F2_NEMVE  ali  49  6...DPVTVVVRLIRSFEYRNIKHVAFKNVSLSQTAKDFGEFVKKEVESRKDVPPPFRSFRYDKFKIQHKAHHAKTNDPVIRTDDDDTLILKEELTLDANGVEHETELSFFNYDDYLKYKENPQLKW 128
22 3.000e-48UniRef50_UPI000BA8015A UPF0538 protein C2orf76 homolog n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA8015A  ali  51  29..PNRIIVTVRLIRSFEHHNVRPVVFKDVDPNQTVSFFKNTILTDIKKRTGLPPPVKNYDYDTLKIQHQAHGAKTNDPIINTEMDEELILQDHRTLAESNIRSETEISFFKKIDYIKYKENPHLNW 152
23 4.000e-48UniRef50_A0A0D6EHL0 SPOSA6832_01036-mRNA-1:cds n=34 Tax=Basidiomycota TaxID=5204 RepID=A0A0D6EHL0_SPOSA  ali  34  26.PLTDIFVTVRIIKSFEFRTTKNLLLPHVDTSMTVGALKDFVREQIKAAPGF-KPFRTCQLDTLKLYTKAHGAKTTNLIINMENDEWILNDDSATLESIGIENEAELSFFNRELYEAFKLNPAQAW 150
24 6.000e-48UniRef50_A8NGP9 Cytoplasmic protein n=10 Tax=Agaricomycetes TaxID=155619 RepID=A8NGP9_COPC7  ali  36  14.PKTAATITVRIIKSFKFRTQKSLVLHNIDLTTTVGQLKEIARQAVQTQTGWKP-YRNVQLDTLKVYTKAHGSKTSNLIINLDNDDWILSDDTKVLADLDFENETEVSFFNLEDYNEFKKNPETSW 138
25 8.000e-48UniRef50_UPI00045D7B89 UPF0538 protein C2orf76 homolog isoform X1 n=5 Tax=Cercopithecidae TaxID=9527 RepID=UPI00045D7B89  ali  76  18MAPEEVTITVRLIRSFEHRNFKPIVYHGVNLDQTVKEFIVFLKQDVPLRTSLPPPFRNYKYDTLKIIHQAHKSKTNELVLSLEDDDRLLLKEDSTLKAAGIGERMHRGAHCQDQQRRMLYRCLLTW 145
26 2.000e-47UniRef50_A0A1M2V8Y4 UPF0538 protein C2C4.04c n=1 Tax=Trametes pubescens TaxID=154538 RepID=A0A1M2V8Y4_TRAPU  ali  33  14LPKTDATLTIRVIKSFEYRTEKSLVLHHVNLTTTVGQLKDTVRQAIQTQ-GGWKPYRNATFDTIKLYTKAHGAKTTNLIINLDHDEWIFEDDSQTLADLGLENESEVSFFNRLAYEEFKKHP.... 135
27 6.000e-47UniRef50_Q6FTJ5 Uncharacterized protein n=11 Tax=Fungi TaxID=4751 RepID=Q6FTJ5_CANGA  ali  39  18.PLTNSIITVRVIKSFPYRNVKNLVFHDYDLNKTAGDLLRDCMARISTEGSFRP-FRNVKLDTLKVYTHAHGSKTVNLVINFDHDEDWMLDSNRKLCEYGVENETEISLFNREDYVAYKANPEEKW 144
28 4.000e-46UniRef50_A0A0D2X1E2 Uncharacterized protein n=1 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2X1E2_CAPO3  ali  41  30.....VIITVRCIRSFEHRALKSLVLHGVDLHTSGGDLMALVKQRIQTAPGFAP-FRAIAYDTIKIHSQAFGAKTNNPIINLDHDDW-VLDPARTLHEQGVKHETELSMYRLEDYNTYKAHPSTVW 149
29 4.000e-46UniRef50_A0A1X7VUG6 Uncharacterized protein n=1 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7VUG6_AMPQE  ali  34  7.SSAGLTITIRLIRSFEHRNIRYIVLKDVDPSLTIQDLMDQINKDLQSSHILPVPFRKHQFNCMKINSYAHGHKSNDTAITLGRNEW-ILDPSKTILESNIRNETEISYFNKSDYERYESHPQLLW 130
30 1.000e-45UniRef50_O14037 UPF0538 protein C2C4.04c n=2 Tax=Taphrinomycotina TaxID=451866 RepID=YEY4_SCHPO  ali  37  2...TGATLTVRVIRNFEYRTLKNVVFHDIDLTTTVDQFKKIIDERIQTDPSL-KIYRTTHFDTLKIYVKAQQHKTQNLAINLDHDDWILNDGAKTLSLCGIENETELSYFELAAYKAYQANPVQKW 124
31 3.000e-45UniRef50_A0A0K3CN45 BY PROTMAP:  ali  31  10.PLTDVFLTVRIIKSFTYRTTKNLLLPHIDTTMTVGQLKDLCREQVKTSPGFKP-YRTVELDTLKLYTKAHGHKTMDLIINHETDDDILEDDSKILADVGIENETEISFFNRALYDEYKRNPQQAW 134
32 7.000e-45UniRef50_A0A0B7MQE9 Uncharacterized protein n=40 Tax=Fungi TaxID=4751 RepID=A0A0B7MQE9_9FUNG  ali  36  13.PTSDATLTVRCIKNFEYRTCKNLVLQHVNLETTVADLKKLVLEAIHSQTGW-KPYLKVKFDTLKVYTVAHGHKTMNLIINVEDDDKLILDDEAILKWQGLENETELSFFNLKDYLEFKKHPVMKW 139
33 2.000e-44UniRef50_R9XJG4 AaceriADR201Wp n=3 Tax=Fungi TaxID=4751 RepID=R9XJG4_ASHAC  ali  38  29.....ATITVRVVKSFPYRNVKSFVLHGYDLEKTAKDLLADAVAHVQQSSAFR-AFRTVDYDALKIYTHAHGTKTVNLVINLDHDEWLLDDGTRSLAEWGVRDETELSMFNLAAYREYAAHPEDRW 151
34 3.000e-44UniRef50_UPI00083EF8D4 UPF0538 protein C2orf76 homolog isoform X1 n=6 Tax=Theria TaxID=722675 RepID=UPI00083EF8D4  ali  94  1MAPEEVTITVRLIRSFEHRNFKPIVYHGVNLDQTVKEFIVFLKQDVPLRTSLPPPFRNYKYDTLKIIHQAHKSKTNELVLSLEDDDRLLLKEDSTLKAAGIA........................ 102
35 3.000e-44UniRef50_A0A2T0FJG5 Altered inheritance rate of mitochondria protein 29 n=1 Tax=Wickerhamiella sorbophila TaxID=45607 RepID=A0A2T0FJG5_9ASCO  ali  33  28....SATITVRVVKSFEYRTIKNHVFKDLNLYTTTPQLLERVKQVVQTEGGFRP-YRTVDLNCLKIYTHAHLTKTVKLSINLDKDDEWILDEEKPLYDYGMRNESEISCFNRDMYFTFKENPVEKW 149
36 3.000e-44UniRef50_A0A1C7NR19 Altered inheritance rate of mitochondria protein 29 n=17 Tax=Fungi TaxID=4751 RepID=A0A1C7NR19_9FUNG  ali  35  11.PSSDATLTIRCIKNFEYRTCKNLVLQHVNLETTVGDLKKMVLEEIHTQSGW-KPYLNVQFDTLKVYTVAHGHKTMNLIINVEDDDKLVLDDSAVLAWQGIENETELSFFHLEDYLEFKKHPTMKW 143
37 4.000e-44UniRef50_W1QG64 Uncharacterized protein n=8 Tax=Saccharomycetales TaxID=4892 RepID=W1QG64_OGAPD  ali  36  11.PLTDSVLTVRIIKSFPYRNVRNHVFPHVDLKNTTPKQLFDTIIDTINTTGALRPYRGVNYDTLKIYTHAHGSKTMNLVINMEHDDDWILDNTKTLVDYGIANETELSIFNRAEYEKFKANPEEKW 138
38 4.000e-44UniRef50_A0A2P6NY02 Uncharacterized protein n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6NY02_9MYCE  ali  34  4..SEGVILTIRVIRSFEYRTVKNLIIQNVSLNTTVGQLKETIRQKITSTPGF-KPFLTTSFDTLKIYSKAHGAKSQNLIINLEDDDWTLSDDSAVLSSLGIEEETELSWYNKEQYDKFKSNPEVK. 127
39 7.000e-44UniRef50_F4P915 Uncharacterized protein n=7 Tax=Fungi TaxID=4751 RepID=F4P915_BATDJ  ali  37  11..PKHLTLTIRLIKSFEYRTFKNLVLQHIDPEMLVKDLKILVLEKIKSTPGL-KPYHNTVFDCLKLYVKAHGSKTQHLIINLDHDETFIMDDNLTLSAQSVENETELSFFNHELYTLYKAHPNNKW 136
40 9.000e-44UniRef50_A0A0W4ZIN0 Uncharacterized protein n=1 Tax=Pneumocystis jirovecii (strain RU7) TaxID=1408657 RepID=A0A0W4ZIN0_PNEJ7  ali  37  2...SSAVLTVRLIKSFVHRTIKYLVLHDVDLEQTVSEFQQRIQREISKQPAFQL-YSTFPFDTLKIYSHAYGSKTSNRVINLDHEEWMLLDPSMTLSAYGVQHETELSFFRRSDYEQFKVTLEEKW 124
41 1.000e-43UniRef50_A0A293LIF7 Uncharacterized protein (Fragment) n=1 Tax=Ornithodoros erraticus TaxID=265619 RepID=A0A293LIF7_ORNER  ali  41  5.PKEDWTIPVRVIRSFEHRNIRHLVVKGVSPQCLVNELKALIMTKLKENPNFPPPVRYYAYDTIKIEHLPHKSKTSDPVINTEDDDTLILLDEKNLRESNIVNETELSFFKLEDYIRYKTSKS... 126
42 1.000e-43UniRef50_R7VA95 Uncharacterized protein n=1 Tax=Capitella teleta TaxID=283909 RepID=R7VA95_CAPTE  ali  43  2...TENTVTLRLIRSFPHRNVKNAVFKGVDLNLSAQDFMEKVLEELSKRSDLPPPFRKFSFDAMKIEHQAFGAKTSDPLINTSDDDKLLLVLGKSLKEQGIVHETEISCFKMAEYREYQKN..... 119
43 2.000e-43UniRef50_H9GF86 Chromosome 2 open reading frame 76 n=11 Tax=Euteleostomi TaxID=117571 RepID=H9GF86_ANOCA  ali  74  1MSSGDVTLTVRLVRSFEHRNFKPVVYHGVSLDQTVKEFIQFVKNDVALRTTLPPPFKKYKYDTMKIIHQPHGSKTNELVVGLEDDDKLMLAEDSTLKAAGVEEE...................... 104
44 3.000e-43UniRef50_Q54R16 UPF0538 protein n=3 Tax=Dictyosteliales TaxID=2058949 RepID=U538_DICDI  ali  33  1MENENKILIIRVIRSFEYRTIKNLILKDIDLNTNVSDFKKLVADKIQTTPGFTP-FKTKQYDSMKIFFVPHGQKPNNLTINIENDH-FFLNNNKSLAENGVVYETEISFFVMEDYLKYKENPENKW 124
45 3.000e-43UniRef50_P36154 Altered inheritance rate of mitochondria protein 29 n=95 Tax=Dikarya TaxID=451864 RepID=AIM29_YEAST  ali  39  28.PLKNSVITIRVIKSFPYRNVKNIVLHDYDLDKTAKDLFNDVLNKIQNEGSFRP-FRNVKFDTLKIYTHAHGSKTVNLVINFDHDDDWTLDDKKKLFEYGIENETEISLFNKEDYLRFKENPEEKW 155
46 3.000e-43UniRef50_A0A1B9ICI9 Cytoplasmic protein n=10 Tax=Fungi TaxID=4751 RepID=A0A1B9ICI9_9TREE  ali  35  23.PITDATLTIRIIKSFEFRTQKSMVVKHLNLEETVDNLMELVRKEIKTQSGY-KPYRTLVLDTMKLYTLAHGSKTTNLIINLDHDEW-ILDPSKILKDIGAQNETEISFFNRESYDKFKLNPEVKW 146
47 1.000e-42UniRef50_D5GG38 Uncharacterized protein n=3 Tax=Tuber TaxID=36048 RepID=D5GG38_TUBMM  ali  32  9.PLTSATLTIRVIKNFPYRTAKNLVLHNLDLTTTSGDLKERVRSEILSSTSGWKAYKGVTLDTLKLYTKAHGTKTNNLIINMEDDELIFGDDGRALEGYGCEHETEISFFKLEDYLEFKGNPEEKW 142
48 2.000e-42UniRef50_A0A267EWG3 Uncharacterized protein (Fragment) n=2 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267EWG3_9PLAT  ali  39  13.....STLTVRLIRSFEFKNVRNLVLHSLDLDKTVAELKVAIRNAIATSRSLPPTFKSFNFDTLKIHCLPQAAKPNDLVVNVDNDEALLSDDSAILSSCGLVHEAELSYFNQSEYCAYKANPVTKW 137
49 2.000e-42UniRef50_G3MHB9 Uncharacterized protein (Fragment) n=6 Tax=Ixodidae TaxID=6939 RepID=G3MHB9_9ACAR  ali  37  48..QDRVIISVRVIRSFEHRNIWHIVMRDVCSATTVGEFKKSVLSAISASTSMPATVKTYPYDTVKIEHLPHKAKSSDPVINTADDGKLILPDNTTLSDGGVVNETVLSFFKMDDYLQYKSTKLL.. 169
50 6.000e-42UniRef50_A0A287AK33 Chromosome 2 open reading frame 76 n=30 Tax=Amniota TaxID=32524 RepID=A0A287AK33_PIG  ali  88  1MASEEVTITVRLIRSFEHRNFRPVVYHGVHLDQTVKEFIVFLKQDIPLKTSLPPPFRNYEYDKLKIVHQAHKSKTNELVLSLEDDDKLLLKEDSTLKAAGIG........................ 102
51 9.000e-42UniRef50_A0A1Y1WCN7 Uncharacterized protein n=3 Tax=Kickxellomycotina TaxID=451828 RepID=A0A1Y1WCN7_9FUNG  ali  36  1MSDTQLVITVRVIKNFEYRTCKNLILKVDLANTTIAELKDLCRQKIQTEAGFKP-YRNVELDTLKIYTQAFGHKTQNLIINLE-DEGFLRDELATLEFAGIRNETELSFFNMDAYMAYARDPKMAW 125
52 3.000e-41UniRef50_I4YEX4 Uncharacterized protein n=2 Tax=Wallemia TaxID=148959 RepID=I4YEX4_WALMC  ali  29  9.PITSATLTIRLIKSFEFRTTKNLILKGIDLTTTVEDLVNICKQEITTQSRF-KPFRTVDLNCIKLYTQAHGHKTTNLIINVDNHHWIIDNWSQKLSDIEIENETELSLFNRDLYDQFIQNPEIKW 134
53 4.000e-41UniRef50_UPI00097534F9 UPF0538 protein C2orf76 homolog isoform X2 n=2 Tax=Protostomia TaxID=33317 RepID=UPI00097534F9  ali  56  2.....ATVTIRLIRSFEHRNLKHVVYHDVDLTQSVADFKEFVRK-----------------DTLKISHKAYGYKSNDPVINLEDDEKLILKEESSLKENGVENETEISFFKMEDYLEYKKNPHLAW 105
54 7.000e-41UniRef50_B7PD88 uncharacterized protein n=4 Tax=Ixodoidea TaxID=297308 RepID=B7PD88_IXOSC  ali  39  8..QQQITISIRVIRSFVHRNIHHRVMRAVSPTKLVKHLKEAIFADLRQDPNIPPTVQNYAYDTLKIEHQPHKAKSHDPVINTADDDQLVLRDDQTLHASNVINETVLSFFKMEDYLEYKLSKV... 128
55 9.000e-41UniRef50_A0A1E4TKC1 Uncharacterized protein n=1 Tax=Tortispora caseinolytica NRRL Y-17796 TaxID=767744 RepID=A0A1E4TKC1_9ASCO  ali  36  12.PLQDSFITVRMIKSFEYQTFKSVVLPDVDLTTLTGAQLLEKMKKIVHTENGYKPYKSCQFDTVKIYSKAHGTKTMNLIINLEDDTTLIENLDLPLSQAGVENETELSIFNRDLYEKYKANPVNKW 139
56 4.000e-40UniRef50_A0A1Z5LCD6 Uncharacterized protein (Fragment) n=1 Tax=Ornithodoros moubata TaxID=6938 RepID=A0A1Z5LCD6_ORNMO  ali  43  10......TIPVRIIRSFEHRNIRYLVVKDVSPRCQVKELKALIMTKLKENLTFPPPVRNYAYDTLKIEHFPHKAKSTDPVINTEDDDTLVLQDERTLLESHMVNETELSMFKFDDYTNYKA...... 123
57 4.000e-39UniRef50_A0A0F7S9V7 Uncharacterized protein n=25 Tax=Basidiomycota TaxID=5204 RepID=A0A0F7S9V7_9BASI  ali  30  37.PLTDAVITIRIIKSFEFRSMKAYIIKNIDLTTTISQLETQCREQVKTNSAFR-AFRSYNLDTLKLYTRAHGAKTTNLIINLDRPEWVLEDDNTTLAEIGVENETELSFFNKQAYEAFLANPNTKW 178
58 5.000e-39UniRef50_A0A058ZG09 Uncharacterized protein n=1 Tax=Fonticula alba TaxID=691883 RepID=A0A058ZG09_9EUKA  ali  30  21MNSESAILTIRVIRSITFRNSRNLILRNINLKTTTGDLLEMSLAAIATESAFRP-FRTITFDTLKIYHTAHMSKKGDLIINT-GSEHLVLDPHMSLWDSGVRNESEISLYNKAMYLEYLADPRQLW 145
59 1.000e-38UniRef50_A0A139AZX4 Uncharacterized protein (Fragment) n=1 Tax=Gonapodya prolifera JEL478 TaxID=1344416 RepID=A0A139AZX4_GONPR  ali  38  1.........VRVIKSLEFRTVKSLVLRDVDLDTTVGKLKEIVKERIQTVPGFKP-YLNGNQDTLKIYVSAQGTKSSNLVLNVQDDEFTLSDEGRKLVECGVGHETEISFFNWEAYQAYKTHPVVKW 119
60 3.000e-38UniRef50_M2XQT5 Uncharacterized protein n=1 Tax=Galdieria sulphuraria TaxID=130081 RepID=M2XQT5_GALSU  ali  31  1MSQSDLILNIRLIKSFEYRNIKYLVLKNVAPSTTGRELKELIDSKIRSSQNLT-TFVNCPFDTVKIYTLSQSFKDHSLVINFDQEGWIIGD-GETLQSKGISSGAEVSYFNMEQYRRFKENPILKW 125
61 3.000e-38UniRef50_C1BN97 UPF0538 protein n=1 Tax=Caligus rogercresseyi TaxID=217165 RepID=C1BN97_CALRO  ali  42  2....GVTLRIRIIRSFPHRNIRFITLHNVPLETTVRDLLELTRAEI-SKSSLPPPFRTHPFDALKIEHNAFGAKTNDPVINREDDESLLMCEHELLLGDHIRNESEIALFKLSDYREYLLSPSLAW 125
62 5.000e-38UniRef50_C3YSJ8 Uncharacterized protein n=1 Tax=Branchiostoma floridae TaxID=7739 RepID=C3YSJ8_BRAFL  ali  43  7..SDGLTVTVRLIRSFEHKNLKNVVFHQVDPDTTVETFMDTVRK-----------------DTMKLEFKAHGNKTNNPLMNTEDNDKLMLKPCATLRDSGVENETEISFFKREEYEAFVQNPVTRW 113
63 6.000e-38UniRef50_L5LIH0 Uncharacterized protein n=1 Tax=Myotis davidii TaxID=225400 RepID=L5LIH0_MYODS  ali  74  1MASKEVTITVRLIRSFEHRNFKPVVYHGVNFDQTVKEFMVFLKQERTEKRGLPAGSRTLQSDILSAAEEARISLTNELVLSLEDDDTLMLKEDRTLKAAGIANETEIAFFCEEDYKNYKANPISSW 181
64 1.000e-37UniRef50_A0A098VN14 60S ribosomal protein L30 n=1 Tax=Mitosporidium daphniae TaxID=1485682 RepID=A0A098VN14_9MICR  ali  33  3.......VTIRLIKSFEFRTIFHLIIKDFDTSATVDDLKGYIEKEICKHPIYSKCFLKTTLDTLKIYYQPHGTKSQNLAINLDSDDTLLMGPGRCLSEFPIQNETEISFFNEEAYLNFKANPTYK. 126
65 2.000e-37UniRef50_F7DCS3 Chromosome 2 open reading frame 76 n=2 Tax=Xenopus tropicalis TaxID=8364 RepID=F7DCS3_XENTR  ali  57  1MMPGGATVTVRLVRSFEHRNFRPVVYHGVNLDQTVREFIVQINEGFRTKTKIGPPLGPYSYNLLELIPPPPIPQTNELVVGLEDDERLILAPGGTLREAGVAHETELAFFCHKD............ 120
66 9.000e-37UniRef50_UPI000D7ED17B hypothetical protein n=1 Tax=Acaromyces ingoldii TaxID=215250 RepID=UPI000D7ED17B  ali  32  46.PLTDAVITVRVIKSFAYRSMKALVLRGIDLTMTVEELKERCKEEVGKQPAF-KAFRSAKLDTLKIYTRAHGAKTTNLIINLDHTDWILNDGSKKLQELGLENEAELSFFNRDDYEEFLKDPETKW 204
67 1.000e-36UniRef50_D2VFS7 Uncharacterized protein AM61 (Fragment) n=1 Tax=Naegleria gruberi TaxID=5762 RepID=D2VFS7_NAEGR  ali  36  1.......ITVRLIKSFHYRNIKLLILKDIKVNETGNDLLKLVLEKIEKESGLLPH-RGRKYDTFKLYHHAFSFKANNLVVNLQDDDKLIFKMDKTLKENNVDNEAEISCFIMDEYLEFKKNPELKW 119
68 3.000e-36UniRef50_A0A1R1XBC8 UPF0538 protein n=3 Tax=Smittium TaxID=4888 RepID=A0A1R1XBC8_9FUNG  ali  31  10.....SIITVRVVRNFEYRTVKNCILKFDLKHDTVADLKRRIEKEIQTQPGFLP-YRTVKYDTLKIYSHAFGNKSQNLVINMDRDG-FLDNLDLTLEQAGLKPESEVSFFNIDAYNKFVVDPQIKW 128
69 1.000e-35UniRef50_A0A0P1BIW9 Uncharacterized conserved protein n=2 Tax=Ceraceosorus TaxID=401624 RepID=A0A0P1BIW9_9BASI  ali  29  61.PLTSAVLTIRIIKSFPFRASRNLVLDNLDLTTLVKRLKEIVKVEIGKRVDMKTVRAAGKLDTMKIYTHAHFTKTSNLIINLDRPEWVLDKEEVPLADLGCQNETELSFFNRQEYEEFLKDPKTEW 189
70 2.000e-35UniRef50_A0A0C2MP73 UPF0538 protein C2orf76 n=1 Tax=Thelohanellus kitauei TaxID=669202 RepID=A0A0C2MP73_THEKT  ali  33  9...DKILLTIHPVRSFKHGTFRTIIFRDIDPNMLVGDFISQIKNHIRESEEVPFPMRFHPYDCLKISNKKTIGKGDPTFCSLSDDQKLMLNRSQSLGQAGVKNEDEIAFFNLQDYKKFKESP.... 127
71 3.000e-35UniRef50_A0A2I2UG34 Uncharacterized protein n=6 Tax=Laurasiatheria TaxID=314145 RepID=A0A2I2UG34_FELCA  ali  67  1MISGEVTIIVCLIHSFEHYNYKPVVYHGMNLDQTVEKFIVFLKKKVSLRASLTPPFINYTYDKLKVIHQAHKLNANKLVLNLET-GRPLVKEGSILEAARISNETEIASFHEEDYENCKANPISS. 127
72 4.000e-35UniRef50_A0A1A6AEZ6 Cytoplasmic protein n=1 Tax=Kwoniella dejecticola CBS 10117 TaxID=1296121 RepID=A0A1A6AEZ6_9TREE  ali  36  23.PITDATLTIRIIKSFEFRTQKSMVVKHLNLEETVGALMELVRKEIKTQSGYKP-YRTLVLDTMKLYTLAHGSKTTNLIINLDHDEW-ILDPSSILKDIGAQNETEISFFNRESYDKFKLNPEVKW 199
73 9.000e-35UniRef50_UPI000C2FE592 UPF0538 protein C2orf76 homolog isoform X3 n=1 Tax=Felis catus TaxID=9685 RepID=UPI000C2FE592  ali  91  89............................................DIPLRTSLPPPFRNYKYDKLKIVHQAHKSKTNELVLSLEDDDRLMLKEDSTLRAAGIAHETEIAFFCEEDYKNYKANPISSW 170
74 2.000e-34UniRef50_A0A0C9RS78 Uncharacterized protein (Fragment) n=1 Tax=Amblyomma americanum TaxID=6943 RepID=A0A0C9RS78_AMBAM  ali  37  23..EDRIILSVRVIRSFEHRNIWHIVMRDVLLTTTVGEFKKLVLSAIGANTSMPTTVKTYPYDTMKIEHLPHKAKSSDPVINTADDDKLILPDHTTLSNGGVVNET..................... 125
75 6.000e-34UniRef50_UPI000B9078E8 UPF0538 protein C2orf76 homolog n=1 Tax=Folsomia candida TaxID=158441 RepID=UPI000B9078E8  ali  41  7..KKEATLTIRLIRSFVHTNWKPFVIHKIDLNLTTEDLFKIIYASLP-HAKLPPPFLSYKFDTLKVETHRFGHKTNDPLINCHDDEKLLLKPGMNLSSQGVDHETEISFFNMKDYIAYKESK.... 127
76 1.000e-33UniRef50_A0A090X8H2 Uncharacterized protein (Fragment) n=1 Tax=Ixodes ricinus TaxID=34613 RepID=A0A090X8H2_IXORI  ali  33  2..QQQITISIRVIRSFVHRNIHHRVMRAVSTTKLVKHLKEAIVAELRQDPNIPPTVQNYVYDTPQDSSTSRKPSPTTPVINTADDDQLVLRDDQTLHASNVINETVLSFFXMEDYLEYKLSKV... 123
77 1.000e-33UniRef50_D3B656 Uncharacterized protein n=2 Tax=Acytosteliaceae TaxID=2058183 RepID=D3B656_POLPP  ali  37  1MTDSPRILTIRVVKSLEYRNIKNLLVHGSDLNMKVSEFKKYVLEKIQTTAGFLP-FRTLDLNTMKIFFIPHKQKPNNLTINLENDENYILKDDLTLSEQGVA-----------DYQKYKSNPTDKW 114
78 1.000e-33UniRef50_G4VH08 Uncharacterized protein n=4 Tax=Digenea TaxID=256429 RepID=G4VH08_SCHMA  ali  33  1.MSQSITVPVTLIRSFKYRTTSYLPLSNISQSATVKDLFDRIHHEVKTSSAIPPPFKNLCYDALKVRHKAFNTKSGELLIDLQGD-PIPSNSDLTLESLGIVNETEVAVFRMSDFLAQRDNPEFLW 124
79 2.000e-33UniRef50_UPI000C2F98C3 UPF0538 protein C2orf76 homolog isoform X1 n=2 Tax=Felis catus TaxID=9685 RepID=UPI000C2F98C3  ali  91  158.............................................IPLRTSLPPPFRNYKYDKLKIVHQAHKSKTNELVLSLEDDDRLMLKEDSTLRAAGIAHETEIAFFCEEDYKNYKANPISSW 238
80 4.000e-33UniRef50_UPI000A3335BA UPF0538 protein C2orf76 homolog n=2 Tax=Euarchontoglires TaxID=314146 RepID=UPI000A3335BA  ali  86  1MAAEEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDVPLRTSLPPPFRNYKYDKLKIIHQAHKSKVCSTCI.............................................. 80
81 4.000e-33UniRef50_M3XPD7 Chromosome 2 open reading frame 76 n=3 Tax=Boreoeutheria TaxID=1437010 RepID=M3XPD7_MUSPF  ali  82  1........................................MVNMDIPLRTSLPPPFRNYKYDKLKIVHQAHKAKTNELVLSLEDDDTLMLEEDCTLRAAGIAHETEIAFFCEEDYKNYKANPISSW 86
82 1.000e-31UniRef50_W5PS80 Chromosome 2 open reading frame 76 n=13 Tax=Euteleostomi TaxID=117571 RepID=W5PS80_SHEEP  ali  95  1............................................DIPLRTSLPPPFRNYKYDKLKIVHQAHKSKTNELVLSLEDDDRLLLKEDSTLKAAGIASETEIAFFCEEDYKNYKANPISSW 82
83 2.000e-31UniRef50_Q9CRW3-2 Isoform 2 of UPF0538 protein C2orf76 homolog n=6 Tax=Tetrapoda TaxID=32523 RepID=Q9CRW3-2  ali  72  1MAAEEATLTVRLIRSFEHRNFKPVVYHGVNLHQTVKEFIIFLKQDVPLRTSLPPPLRNYKYDTLKILHQAHKAKPVKLKL-HSSVEKIISD................................... 90
84 4.000e-31UniRef50_A0A1D2MR17 Uncharacterized protein n=1 Tax=Orchesella cincta TaxID=48709 RepID=A0A1D2MR17_ORCCI  ali  31  3.SSSNATLTIRVIRSFEHRNWKPLVIHNINLDMTFGELQALVNDKLVSSSFPPPFKKLVHYDAFKLETSPNNSKSSNALISLSNSTPVLESGPLALSSEQISHESEISYFNCSEFIEYSSS..... 127
85 5.000e-31UniRef50_UPI00064B82F3 UPF0538 protein C2orf76 homolog n=2 Tax=Eutheria TaxID=9347 RepID=UPI00064B82F3  ali  85  29...........................................QDIPLRTSLPPPFRNYKYDKLKIIHQAHKSKTNDLVVSLEDDDRLLLEEASTLKAAGIASETEVAFFCEEDYKNHKTNPVSAW 111
86 2.000e-30UniRef50_G1XAX5 Uncharacterized protein n=2 Tax=Orbiliaceae TaxID=47021 RepID=G1XAX5_ARTOA  ali  30  13...KTATITVRVIKSFPYRTCKNLVVRGLDLTTTIGEFKARAVNDVKTLPGWKP-YQNVELDSMKLYTKAHGTKTQNLIINLDRPDWMFDDDSMTLAEVGCG........................ 111
87 2.000e-29UniRef50_A8PTX8 Uncharacterized protein n=1 Tax=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) TaxID=425265 RepID=A8PTX8_MALGO  ali  26  1....................MKPLVLRDIDLTCTTPQLIERCRHEVRTQPAF-KAYRNVDLDTIKLYTQAHGAKTTNLIINLDHPEWIFDSSDASLASLGVQNETELSLFHRPAYEAFLQHPETRW 109
88 2.000e-28UniRef50_A0A1Q3E3Z2 Cytoplasmic protein n=2 Tax=Fungi TaxID=4751 RepID=A0A1Q3E3Z2_LENED  ali  35  23..............................LTISISKPQLSVNSKIFLVKPGWKPYRNVQLDTLKLYTQAHGAKTTNLIINLDHDEW-ILADDSTLADAGFENETEVSFFNRDLYEQFKQDPETTW 117
89 3.000e-28UniRef50_H3DQK0 Zgc:101851 n=3 Tax=Eupercaria TaxID=1489922 RepID=H3DQK0_TETNG  ali  57  1.MAAGVVVTVRLVRSFQHRNFKPVVFHGVSLDQTVPDFIQLVKDDVARRPGIPPPFRKYDYDTMKIVHQAFGAKVS.................................................. 75
90 4.000e-28UniRef50_A0A1J5WMZ7 Uncharacterized protein n=1 Tax=Amphiamblys sp. WSBS2006 TaxID=1866961 RepID=A0A1J5WMZ7_9MICR  ali  28  4.......LTVRVVVSFEHRNIKNIVLHGVDFYQ---DTLLTIWERVGAEVS-SQAGAHKKYDTMKFHTHAHGAKPDLVVDTADTRVYAREDYDKVLCVLDLASESEVSLFVLGEYETYRGDKRHMW 118
91 2.000e-27UniRef50_E2LBL6 Uncharacterized protein (Fragment) n=1 Tax=Moniliophthora perniciosa (strain FA553 / isolate CP02) TaxID=554373 RepID=E2LBL6_MONPE :_  ali  31  15.PKTSAIITVRIIKSFTYRTEKSLVLHDLNLTTTVGQLKDIARQAIQTQSGW-KPYRNIQLGQ---CFPTHGAKTTNLIINLDHDEWILDDVNKSLDECG.......................... 110
92 1.000e-26UniRef50_A0A2U9C8A4 Putative UPF0538 protein C2orf76-like isoform 2 n=1 Tax=Scophthalmus maximus TaxID=52904 RepID=A0A2U9C8A4_SCOMX  ali  47  1.MADGAVVTVRLIRSFEHRNFKPVVFHRVSLEQTVQDFIQLVRDDIATRPGLPPPFRKYAFGT----YAGHDVSCHYFIISVIDVVR....................................... 82
93 1.000e-26UniRef50_A0A2N1J8C9 Uncharacterized protein n=1 Tax=Malassezia vespertilionis TaxID=2020962 RepID=A0A2N1J8C9_9BASI  ali  36 1004.PLTQATITVRVIKSFEYRTMKALVLRDVDLTATALQLVERCKQDVRTEPSF-KAYRNYKLDTLKLYTHAHGAKTTNLIINLDHPEWILSTDAAALSAFGIG........................ 1108
94 1.000e-25UniRef50_UPI00081019CE UPF0538 protein C2orf76 homolog isoform X3 n=1 Tax=Rattus norvegicus TaxID=10116 RepID=UPI00081019CE  ali  81  88MAVEEATITVRLIRSFEHRNFKPVVYHRVNLHQTVKEFIIFLKQDVPSRTSLPPPLRNYKYGQL.............................................................. 151
95 4.000e-25UniRef50_K0KD36 Uncharacterized protein n=1 Tax=Wickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031)  ali  32  13.PLTQSIITVRIIKSFPYRNVKNYILKDYDISSKKRDLLDDIVNKIKTEGGLRP-YRTVNYDSLKIYTHAHGSKTMNLVINFEHDEDWFLDLNSSLHQLGVG........................ 115
96 2.000e-24UniRef50_D3KGZ7 Uncharacterized protein n=6 Tax=Giardia intestinalis TaxID=5741 RepID=D3KGZ7_GIAIC  ali  28  2.....AVIMVRCISSFEHGVVLYMPVK-VNGGETLADVAQQVCQRVKTEPKYKPLKRVEAFDTFKVYVTPGQAKPPNLVIAPEGNE-FTSDNWRGLDELGIEPGTELSFFSSSAYKRYKE...... 115
97 3.000e-24UniRef50_UPI0005EEA62E UPF0538 protein C2orf76 homolog n=1 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=UPI0005EEA62E  ali  52  4..SSEVLVTIRLIRSFLHRNIKHIVLHNVNLDDTVEELMNKIKEDIKTRSGLPPPFRKHGYDTLKVEYKKHGSKVIN................................................. 78
98 5.000e-24UniRef50_UPI000777C51A UPF0538 protein C2orf76 homolog isoform X1 n=2 Tax=Coturnix japonica TaxID=93934 RepID=UPI000777C51A  ali  68  9MSAENSTVTVRLVRSFEHRNFRPVVYHGVNLDQTVKQFIAFVQKDVPSRTGLPPPFKTYKYEG............................................................... 71
99 5.000e-24UniRef50_UPI00073FE813 UPF0538 protein C2orf76 homolog isoform X4 n=2 Tax=Lepisosteus oculatus TaxID=7918 RepID=UPI00073FE813  ali  63  1MSCEEVVLTVRLVRSFEHRNFKPVVFRNVNLNQTVKEFIAAVKDDVSARPGLPPPFKKFEYDTMKIIHQAHGAK.................................................... 102
100 2.000e-23UniRef50_UPI000775BC47 UPF0538 protein C2orf76 homolog n=2 Tax=Amniota TaxID=32524 RepID=UPI000775BC47  ali  70  37.............................................................DTMKIIHQAHGSKTNELVVSLEDDDRLILEEDSTLKATGVANETELAFFCMDDYRKYKTNPVATW 101
101 7.000e-23UniRef50_M7PE07 Uncharacterized protein n=1 Tax=Pneumocystis murina (strain B123) TaxID=1069680 RepID=M7PE07_PNEMU  ali  31  2.....AILTIRLIRSFTYRVIKYLVLCEINLETTVKDLQTLIFNEIYKNPEY-KAYQLPKFDTLKIYVHSQSAKTSNRIINLDHDEW-ILDPCMTLERCG.......................... 95
102 2.000e-22UniRef50_C9JTA8 UPF0538 protein C2orf76 (Fragment) n=6 Tax=Euteleostomi TaxID=117571 RepID=C9JTA8_HUMAN  ali  100  30MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDIPLRTNLPPPF...................................................................... 85
103 3.000e-21UniRef50_A0A226P0A1 Uncharacterized protein (Fragment) n=1 Tax=Colinus virginianus TaxID=9014 RepID=A0A226P0A1_COLVI  ali  78  1..............................................................TMKIIHQAHKSKTGDLVVSLEDDDKLILKEDSTLKAAGVANETELAFFCEEDYRNYKANPVSAW 73
104 2.000e-20UniRef50_A0A1B9GQ52 Uncharacterized protein n=1 Tax=Kwoniella heveanensis BCC8398 TaxID=1296120 RepID=A0A1B9GQ52_9TREE  ali  41  1...............................................................MKLYTVAHGHKTTNLIINLDHDEW-ILDPTAILKDIGAENETEISFFNREAYESFKANPEIKW 62
105 1.000e-19UniRef50_A0A146KGQ4 Uncharacterized protein (Fragment) n=1 Tax=Trepomonas sp. PC1 TaxID=1076344 RepID=A0A146KGQ4_9EUKA  ali  26  1............INSFEFSTVFYMVV-DVNEDTTLKQIQEQINQKIQQDNKYRPVRSKIAFDRMRIYCYPHQQKDMNLTFNDKQGEDLIIAE-QTIKELKWFDEAEISYYNFAQYQQWKK...... 107
106 1.000e-18UniRef50_F4PVT1 Putative guanine nucleotide exchange factor n=1 Tax=Cavenderia fasciculata (strain SH3) TaxID=1054147 RepID=F4PVT1_CAVFA  ali  45  16.......VTVRVVKSLEYRNIKNLVLRDIDLNMKVSEFKEYVKN----------------------------------------------NEDR-LTDCGVINETEISFFNLEDYNNFKANPKER. 86
107 1.000e-18UniRef50_V6LBD0 Uncharacterized protein n=1 Tax=Spironucleus salmonicida TaxID=348837 RepID=V6LBD0_9EUKA  ali  21  3.....ITVTFRIIQSFEFQTVFYM-QQSLELEFTLLQVQELINKEIQANNKFKPSRGKLKFNMFKEFTRPGIAKTGELCIQQKGEEWPILNGNQTLSQVNWEHGIEISYYVKSE............ 112
108 4.000e-17UniRef50_F6SAX2 RIKEN cDNA 3110009E18 gene (Fragment) n=1 Tax=Mus musculus TaxID=10090 RepID=F6SAX2_MOUSE  ali  81  2...................NFKPVVYHGVNLHQTVKEFIIFLKQDVPLRTSLPPPLRNYKYDTLKILHQAHKAKPGH................................................. 59
109 4.000e-17UniRef50_UPI000947E8E8 UPF0538 protein C2orf76 homolog isoform X3 n=1 Tax=Ailuropoda melanoleuca TaxID=9646 RepID=UPI000947E8E8  ali  64  6...............................HTKKRRLQEMVNMDIPLRTSLPPPFRNYKYDKLKIVHQAHRAKSNELVLSLEDDDTLMLEEDSTLRTAGI......................... 75
110 8.000e-17UniRef50_A0A212C2H9 Uncharacterized protein n=1 Tax=Cervus elaphus hippelaphus TaxID=46360 RepID=A0A212C2H9_CEREH  ali  94  5........................................................................GETNELVLSLEDDDRLLLKEDSTLKAAGIASETEIAFFCEEDYKNYKANPISSW 58
111 1.000e-16UniRef50_A0A2S4UJ58 Uncharacterized protein n=1 Tax=Puccinia striiformis TaxID=27350 RepID=A0A2S4UJ58_9BASI  ali  33  12.PSTDATITVRVIKSFEYRNSKNLVLHHIDLETTIDELLTLCLQQISSAPGW-KTFQNVALGQ............................................................... 73
112 2.000e-15UniRef50_Q4R9P3 Chromosome undetermined SCAF25682, whole genome shotgun sequence (Fragment) n=2 Tax=Euteleostomi TaxID=117571 RepID=Q4R9P3_TETNG  ali  59  1..........................................................................TNELVVSLDDDDQLILQNHQTLRAAGVVNETEVAFFRREDYGLYKANPTCVW 52
113 3.000e-15UniRef50_A0A2H9TKY2 Uncharacterized protein n=1 Tax=Paramicrosporidium saccamoebae TaxID=1246581 RepID=A0A2H9TKY2_9FUNG  ali  30  33...EGATVTVRIIKSFEYKNFRSLVFQNVDLHTTLDTLRAMVWERIRTTPGL-KQYEQCLFDTFKMYYQAHGAKVG.................................................. 115
114 3.000e-15UniRef50_A0A146TKR9 Pol-like protein (Fragment) n=1 Tax=Fundulus heteroclitus TaxID=8078 RepID=A0A146TKR9_FUNHE  ali  51  51.MDVGVVVTVRLIRSFEQRNFRPVVFQQVCLEQTAQDFMRSVRDDIVSRPGLPPP....................................................................... 104
115 7.000e-14UniRef50_A0A1B9HKH7 Uncharacterized protein n=2 Tax=Kwoniella heveanensis TaxID=89924 RepID=A0A1B9HKH7_9TREE  ali  29  24.PIEDATLTIRVIKSFEFRTQKSMVLKHLNLAQSVGELMELVREEIKKQSGFKP-YRTLVLG................................................................ 84
116 9.000e-14UniRef50_UPI000C75E173 UPF0538 protein C2orf76 homolog n=1 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C75E173  ali  41  4..NETVTLVIRAIRSFPHRNIRTLVLKSVPLSSTGGQLLELAKQSVSSSTILPPPFR..................................................................... 58
117 3.000e-13UniRef50_L8GKV6 Uncharacterized protein n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8GKV6_ACACA  ali  32  2....SVVLTIYLVKSFEYRTM----------------------------------------------------KTMPNNIYFINETEEPFDMDKTLAELGVAHETEISCYNAAQFAAFKANPQMKW 71
118 3.000e-12UniRef50_A0A1R1PU20 UPF0538 protein n=1 Tax=Zancudomyces culisetae TaxID=1213189 RepID=A0A1R1PU20_ZANCU  ali  47  3....................................................................................DEGYLRDPSAVLEYCGIKNETEISLFNFEAYKNYKKNPVLKW 44
119 5.000e-10UniRef50_A0A1A6GYT0 Uncharacterized protein n=1 Tax=Neotoma lepida TaxID=56216 RepID=A0A1A6GYT0_NEOLE  ali  57  51.............................................................DTLKILHQAHKAKTNELVLGLEDDDTLLLKEDRTLKDSGIESNDEIARHCRPAPVKLKLHSSVK. 115
120 2.000e-05UniRef50_UPI000C7B98EA LOW QUALITY PROTEIN: UPF0538 protein C2orf76 homolog n=1 Tax=Sarcophilus harrisii TaxID=9305 RepID=UPI000C7B98EA  ali  82  1...............................................................MKIIHQAHKSKTNELVLSLEDDDRLLLREDCTMKAAGVG........................ 39
121 2.000e-05UniRef50_A0A1R1X295 Uncharacterized protein n=2 Tax=Smittium culicis TaxID=133412 RepID=A0A1R1X295_9FUNG  ali  30  3....................................................................................RDGFLDNLDLTLEQAGLKPESEVSFFNIDAYNKFVVDPQIKW 45

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.