current user: public

If you have questions about the server, please let us know.

Query: CPX_91687_91751 Complex of PLMN_HUMAN with STRP_STREQ [Undefined organism], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .  840    .  850    .  860    .  870    .  880    .  890    .  900    .  910    .  920    .  930    .  940    .  950    .  960    .  970    .  980    .  990    . 1000    . 1010    . 1020    . 1030    . 1040    . 1050    . 1060    . 1070    . 1080    . 1090    . 1100    . 1110    . 1120    . 1130    . 1140    . 1150    . 1160    . 1170    . 1180    . 1190    . 1200    . 1210    . 1220    . 1230    . 1240    . 1250
# Score Template Links and tools%idFirst MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNNXMKNYLSFGMFALLFALTFGTVNSVQAIAGPEWLLDRPSVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPAHGGKTEQGLSPKSKPFATDSGAMSHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYKEKPIQNQAKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFDRSHLKLFTIKYVDVDTNELLKSEQLLTASERNLDFRDLYDPRDKAKLLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRPEGENASYHLAYDKDRYTEEEREVYSYLRYTGTPIPDNPNDKLast
1 -271.000CPX_91687_91751 Complex of PLMN_HUMAN with STRP_STREQ [Undefined organism]  ali  100  1MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNNXMKNYLSFGMFALLFALTFGTVNSVQAIAGPEWLLDRPSVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPAHGGKTEQGLSPKSKPFATDSGAMSHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYKEKPIQNQAKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFDRSHLKLFTIKYVDVDTNELLKSEQLLTASERNLDFRDLYDPRDKAKLLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRPEGENASYHLAYDKDRYTEEEREVYSYLRYTGTPIPDNPNDK 1251
2 -153.000CPX_91687_91739 Complex of PLMN_HUMAN with Q6V4K9_STRPY [Undefined organism]  ali follow..  74  1MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNNXRKLKTGTASVAV------------------------------------------------------------------------------------ALTVVGAGLASQTEVKADQPVDHHRYTEANNAVLQGRTVSARALLHEINKNGQLRSENEELKADLQKKEQELKNLN--------DDVKKLNDEVALERLKNERHVHDEEVELERLKNERHDHDKKEAERKALEDKLADKQEHLDGALRYINEKEAERKEKEAEQKKLKEE---------------KQISDASRQGLRRDLDASAKKQVEKALEEANSKLAALEKLNKELQAKLEAEAKALKEKLAKQAEELAKLR---------------------AEKASDSQTPDAKPGNKAVPG-QAGTKPNQNKA----------KETKRQLPS----TG.......... 1121
3 -152.000CPX_91687_91740 Complex of PLMN_HUMAN with Q6V4L1_STRPY [Undefined organism]  ali follow..  69  1MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNNXRKLKTGTASVAVALTVVGAGLASQT-----------------------------------------------------------------EVKAENHPGYTAAQNGVLSELPGQAQAFSLHEREKNGELRLENEGLKTDLKKKEQELEDVEKLKDEVALERLKNERHVHDEE--------AELERLKNERYEHDKKEA--ERKALEDKLADKQEHLNGALRYINEKEAERKEKEAEQKISDASRQGLRRDLDASREAKKQV---EKDLANLTAELDKVKEEKQVSDASRQGLRRDLDASAKKKVEADASRQGLSRDLEASRE-AKKEADLAEANSKLQALEKLNKELEEGKKLSEKEKAELQARLEAEQLAKQAEELAKLRAGKASDSQTPDAKPGNKAVPGKGQAPQA-QNKAPMKETKRQ---LPSTGE......... 1207
4 -151.000CPX_91687_91742 Complex of PLMN_HUMAN with Q6V4L9_STRPY [Undefined organism]  ali follow..  71  1MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNNXRKLKTGTASVAVALTVLGAGFANQTEVKAADHPSYTAAKDEVLSKFSVPGHVWAHEREKNDKLSSENEGLKAGLQEKEQELKNLKADVEKLKDAAELERLKNERHDHDELERDHDKREAERKALEDKLADKQEHLDGALRYINEKEAERKEKEAEQKKLKEEKQISDASRQGLRRDLDASREAKKQVEKDLANLTAELDKVKEEKQISDASRQGLRRDLDASREAKKQVEKDLADLTAELDKKEEKQISDASRQGLRRDLDASREAKKQVEKLEEANSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEAKALK-------EQLAKQAEELAKLRAEKASDSQTPD----------AK---GNK-AVPGKGQAPQAGTKPNQ------------KAP------------K----ETKRQLPS----TGT......... 1201
5 -148.000CPX_91687_91741 Complex of PLMN_HUMAN with Q6V4L4_STRPY [Undefined organism]  ali follow..  70  1MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNNXRKLKTGTASVAVA------------------------------------------------------------------------------------LTVVGAGLASQTEVKADQPVDHHRYTEANNAVLQGRTVSARALLHEINKNGQLRSENEELKADLQKKEQELKNLN--------DDVKKLNDEVALERLKNERHVHDEEVELERLKNERHDHDKKEAERKALE--DKLADKQEHLDGALRYINEKEAERKEKE-------------AEQKKLKEEKQISDASRQGLRRDLDASAKKQVEKDLAN---REAKKQVEK-NLTA--LDKVKEEKQISDASRQGL--RDLDASREAKKQVEKALEE-KLAALEKLNKEEESKKLTEKEKAELQAKLEEAKALKEKLAKQAEELAEKASDSQTPDAKPGTKPNQNKAPM 1194
6 -139.000IDP91687 gene: PLG; plasminogen isoform 1 precursor [Homo sapiens] NP_000292 [Homo sapiens]  ali follow..  100  1MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN......................................................................................................................................................................................................................................................................................................................................................................................................................................................... 810
7 -35.800IDP01495 serine protease, putative VCA0803 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  23  13.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TRVSAVEISPYIVNGTNANVANYPSFASLAQYSSGTYCGATVLNSRYILTAAHCIYGNSYTMLYTVVVPQLEDESQNGNVQLARAAEFYYPDNYNDIAIIKLESDLNVSNFVGVLNSSINN-SYDENGTYKAIGHGYVNGNVAGTRLLETTLTFVPFATCSAY--YGANLGPGHVCFTGPQIGNSTCSGDSGGPVYWDSGSGYVQIGITSFGSTCGNPALPSVFTEVSDYYSWILRVMNGLETPKYYVTESNGVRQLVAGGTTTVSVSESSS.......................................................................................................................................................................................................................................................................................................................................................................................................................... 305
8 -35.200IDP91751 STRP_STREQ [Streptococcus dysgalactiae subsp. equisimilis]  ali follow..  46  1..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MKNYLSFGMFALLFALTFGTVNSVQAIAGPEWLLDRPSVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPAHGGKTEQGLSPKSKPFATDSGAMSHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYKEKPIQNQAKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIV-THDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFDRSHLKLFTIKYVDVDTNELLKSEQLLTASERNLDFRDLYDPRDKAKLLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRPEGENASYHLAYDKDRYTEEEREVYSYLRYTGTPIPDNPNDK 440
9 -13.300IDP01738 putative protease [Salmonella typhimurium LT2] STM1484 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  18  30............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................DASDVKTLFFNHDDADPTQSPWDAIGQETASGNLCTATLISPHIALTAGHCLLTPPKGKPDKAVALRFVARKGVWRYEIHGIEGRVEAAASWDFGLVILRYPPSGITPVPLFTGDKAAALKAADRKVTQSGYPEDHLNA-----------LYSHQDCVVTGWAQNAV--SHQC--------DTLPGDSGSPLLLHTDSGWQLIGVQSSAPAAKRWRADNRAISVTGFRDKLKALAQD.......................................................................................................................................................................................................................................................................................................................................................................................................................................................... 273
10 -13.300CPX_91686_91680 Complex of A1L467_HUMAN with INLB_LISMO [Undefined organism]  ali follow..  14 1101....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................DGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRN--LAARNCMLDEKFTVKVADFGLARD-------------MYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSD-----------VWSF-GVLLWGRRLLQPEYDPLYEVMLK---WISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPASFWETSXMKEKHNPRRKYCLISGLAIIFSLWIIIGNGAKVQAETITVPTPIKQIFSDDAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLFLNGNKLTDIKPLANLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPLALQNLYLSKNHISDLRALAGLKNLDVLELFSQECVPNTVKNTDGSLVTPEIISDDGEKPYQPVTRFHLKVYTVSY-DVD-GTVIKTK--ITATEKN-DFT-LY-PREKAKLWYRSLDRYDKMEYTAYARVRNKH--VNKL-SVYQGKNP-GKNTFYKQSMEKPRYVSANKAGESYYK---VPVADNPNQK 1985
11 -13.200IDP00217 putative pepetidase YPO2319 [Yersinia pestis CO92]  ali follow..  17  12............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LISITTAFALDKPDGSNSIEDQTALFFGKDTNSRQWPWEAIGQETASGNPCTATLISPRLVLTAGHCVLTPPGNIDQAVALRFISDKGHWKYQITDLKTRVDAKLGQYDFALIQLTNAAPIPIKPLPLWEGTANELTKVNRKVTQAGY--------------------PLDNLNTLYKHEDCLVTGWAQQGVLAHQCDTLPGDSGSPLLLKNGNSWSLIAIQSSAPAAKRYLADNRALSVTAINNRLKKLVNKIADT...................................................................................................................................................................................................................................................................................................................................................................................................................................................... 276
12 -11.700IDP91758 VWF_HUMAN [Homo sapiens]  ali follow..  12  245.PFVALCEKTLCE-LECACPALLEYAAQEGMVLYGWTDHSPAGMEYRQCVSPCART----CQSLHINEM-------------------------CQERCVDGCSCPEGQLLDEGLCVESTECPCV-----------HSGKRYPPGTSLSRDCNT---------CICRNSQWI---CSNEECPGECLVTGQSHFETVQCADDRDAVCTR--DWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSGGNAWKDCQ-PCALNPRMTRFSEEACAVLTSPTFEA----------CHRAVSPLPYLRNCRYDVCSCSDGRECLCGALASYAA--CAGRGVRVAWGRCELNQCGTPCNLTCRSSYPDEECNEACLEGCFCPPGLYMD-------ERGDCVP---------------------AQCPCYYDGEIFQP------EDIFSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALER------CFHQGKETVKIGCNTCVCRDRKWNCTDHVCDATCSTIGMAHYLTFDGLKYLFPGECQYVLVQDYCGSNPGTFRILVGNKGCSHPSVELFDGEVNVKRPMKDETHFEVVESGRYIILLLGKALSVVWISVVLKQTYQEKVCGLCLTSSNLQVEEDPVDFGNSWKVSSQNIMKQTMVDSSCRILTSQDCNKLVDPEPYLDIYDTCSCESIGDCACCDTIAAYAHVCAQHGK-----VVTW-EGCHAHCPPGKILDELL-------VDPEDCPVCEVAGRRFASGKKVTLNPSDPEHCQICHCDVVNLTCEACQEPGGLVVPPTDAPVSPTTLYVEDISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRITLLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRCDLAPEAPPPTLPPDMAQVTVGPGLLGVSTLG----KRNSMVLDVAFVLE-GSDKIGEADFNRSKEFM-----EEVIQRMDVGQ-VTVLQYSYMVTVEYEAQSKGDILYGNRTNTGALRYLLVSQGD--REQAPNLVYMVTGKRLPGPNAPI-LIQDFETLPREAPDLVLQR--TLSPAPDQPLD. 1691
13 -11.000IDP05754 pepdidoglycan bound protein [Listeria monocytogenes EGD-e] lmo0627 [Listeria monocytogenes EGD-e]  ali follow..  18  9..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................VFVVMVAVALIFQ-----------------LVP----WSNI----AG---AEENQTKTTQQIAQPDDQKVADE-NKT-----TV---D-TTKNLVNGKQLLKGSDANGNTKETYAPGDSLKFLYSELDTFWIQDFTFVNPAIDG-DDSNGV-TLKFNQSPEATNAKFDMTITTKEIVIEDDKDVDISNIEVPVTPPTPDDN 248
14 -10.400IDP95480 Phosphatidylinositol 4-kinase Q5CVD3 [Cryptosporidium parvum]  ali follow..  13  811.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................IHDNELSDEDIFINKDWPQETWSSKIKRYRKESPYSKLKSWGIKTLLLKSSDDLRQEYLASQ---QQFD-FKINKLPLWLHPYEILVIGEYIQDTFSIDSLKRRFQTDNLLN--SKARKCFESHAAYSLVSYFL--QVKDRHDKHGHIIQIMLSNSPGNEQSPFKLTQESSDFQYFQQKGFLASRTSASKLPC..... 1056
15 -9.900CPX_91688_91668 Complex of B1AP14_HUMAN with Q914E0_9ENTO [Undefined organism]  ali follow..  11  681........................................................................................DYAAQASEYVPVTVTIAPMCAEYNGLRLAYQQGFPVLNTPGS---NQFMTSDDFQSPSAMPQFDVTPHMDIPGEVHNLMEIAEVDSVVPVNNIKVNLQSMDAYHIEVNTG-NHQGEKIFAFQMQPGLESVFKRTLMGEILNYYAHWSGSIKLTFTFCGSAMATGKLLLAYSPPGADVPATRKQAM------GTHMIWDIGLQSSCVLCIPWISQTHYRLVQQDEYTSAGNVT---CWYQTGIVVP---TPNKCV---LCFASACDNAIARVADTVASGPSNSTSIPALTAVETGHTSQVEPSDTMQTRHVKNYHSRSESTVENFLSRSACVYIEEYYTKDQDNVNRYMSWTINAR---------------RMVQLRRKFELFTYMRFDMEITFVI---------TSRQLPGTSIAQDMPPLTHQIMYIPP---------------PNSVTDFAWQTSTNPSIFWTEGNAPP------RMSIPFISIGNAYSNFYDG---------WS----HFSQNGVYGYNALNNMGKLYARHVNKDTPYQMSSTIRVYFKPKHIRVWVPRPPRLSPYISNVNFNPTNLTDERSSITYPDTIRP----RTNGAFGQQSGAVYVGWEDYNRDLLVSTTTAHGCDIIARCRCQESEYYPKRYQSHLLAAGFSE------PGDCGGILRCEHG----VVGIVTMG--------EGVFADIRDLL-WLEDAMEQGIKDYVEQ--LGNAFGSGFTNQICEQVNLLKESLVGQDSILEKSLKVLVKIISALVIVVRNHDDLITVTATLALIGCTSSPWRWLKQKVSQYYGIPMAERQNNGWLKKFTE------MTNACKGMEWIAIKIQKFIEWLKVKILPEVREKHVFLNRLKQLPLLESQIATIEQSAPSQSDQEQLFSNVQYFAHYCRKYAPLYAAEAKRVFSLEKKMSNYIQFKSKCRIEPVCLLLHGSPGAG---KSVATNLIGRSLAEKL------NSSVYSLPPDPDHFDGYKQQAVVIM---DDLCQNP--------------DGKDVSLFCVSSVDLEEKGILFTSPFVLASTNSINAPTVSDSRALARRFHFDMNIEVISMYSQNGKINDEE-NFKRCCPLVCGKAIQFIDRRTQVRYSLDMLTEMFRE-YNHRHFQGPPVPETP... 1837
16 -9.770IDP05573 cell surface protein, anchor [Bacillus anthracis str. Sterne] BAS4798 [Bacillus anthracis str. Sterne]  ali follow..  21  1....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MKKSLKCFNVVTIIALLLSITLPSPSAFAEIDELQGNDVRIKAEQVNAEIY----RGE-QYTPIQELVLK--EITFLDFYVEEKDKGGKLLS---SNLKIRDL-KSHEKMTVLIKNKEQIGSMSFNVEGKVEANADD-------------EADSSKEEVGPSPDSTPKKITEKLK------VSVEDTNNP. 226
17 -9.500IDP91701 gene: SLIT3; slit homolog 3 protein precursor [Homo sapiens] NP_003053 [Homo sapiens]  ali follow..  11  781......................................................DLSNNSISMLTNYTFSN--TLILSYNRLRCIPVHAFNGLRSLRVHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQ-NACLSSPCKNTCTQDPVELYRCACPYSYKGKDCTV---------------------PINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDND-NNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPLDKGFCECVPGYSGKLC-----ETDNDDCVAHKC----------------------------------------RHGAQCVD-------------------TINGYTCTCPQGFSGPFCEHPPPMLQTSPCDQYECQNG---------------------AQCIVVQQ-EPTCRCPPGFAGPRCEK-TVNFVGKDSYVELASAKVRPQANISLQVATDKDNGILLYKGDNDPLALELYQGHVRLVYDSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSEC--PGWGPLCDQEARDPCLGKCVATGTSYMCKCAEGYGGDLCDNKNCSAFKCHHGQCHISDQGE-PYCLCQPGFS-------GEHCQQEN............................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1447
18 -9.150CPX_91662_05666 Complex of CADH1_HUMAN with INLA_LISMO [Undefined organism]  ali follow..  13 1011.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................NNNQIALTNLTGLTLFNNQITDI-LELSSNTISDISA--LSGLTSLQQLSFGNQVTDLK-PLANLTTLERLDISSNKVSDISVLAKLTN-----------------------LESLIATNNQISDITPLGILTNLDEL------SLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----------APLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTL----------NISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGHNQISDLTPLANLTRITQLGLNDQAWTNAPVNYKA-----NVSIPNTVKNVT--ALIAPATISDGGSYTEPDITWNLPSYTNEVSYT-FSQPVTIGKGTTTF-----------------SGTVTQPLKAIFNVKFHVDGKETTKEGNLLTEPAKPVKEGHTFVGWFDANDINLFSINYTDVTTSQTVDYQGLLTATKEGYTFKGWYDAKDKSKMPAKNITLYA--SYTATFDV-DGKSTTQAV---YQGKEPKAPTAGYTFKYDEDFATDKANDITLYAQFTKNPVPPTTNN. 1606

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 5 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.