current user: public

If you have questions about the server, please let us know.

Query: CPX_91689_91672 Complex of C4BPA_HUMAN with ARP4_STRPY [Undefined organism], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .  840    .  850    .  860    .  870    .  880    .  890    .  900    .  910    .  920    .  930    .  940    .  950    .  960    .  970    .  980
# Score Template Links and tools%idFirst MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTPSCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKELXMARKDTNKQYSLRKLKTGTASVAVAVAVLGAGFANQTEVKAAEIKKPQADSAWNWPKEYNALLKENEELKVEREKYLSYADDKEKDPQYRALMGENQDLRKREGQYQDKIEELEKERKEKQERQEQLERQYQIEADKHYQEQQKKHQQEQQQLEAEKQKLAKDKQISDASRQGLSRDLEASRAAKKELEAEHQKLKEEKQISDASRQGLSRDLEASREAKKKVEADLAALTAEHQKLKEDKQISDASRQGLSRDLEASREAKKKVEADLAEANSKLQALEKLNKELEEGKKLSEKEKAELQARLEAEAKALKEQLAKQAEELAKLKGNQTPNAKVAPQANRSRSAMTQQKRTLPSTGETANPFFTAAAATVMVSAGMLALKRKEENLast
1 -348.000CPX_91689_91672 Complex of C4BPA_HUMAN with ARP4_STRPY [Undefined organism]  ali  100  1MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTPSCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKELXMARKDTNKQYSLRKLKTGTASVAVAVAVLGAGFANQTEVKAAEIKKPQADSAWNWPKEYNALLKENEELKVEREKYLSYADDKEKDPQYRALMGENQDLRKREGQYQDKIEELEKERKEKQERQEQLERQYQIEADKHYQEQQKKHQQEQQQLEAEKQKLAKDKQISDASRQGLSRDLEASRAAKKELEAEHQKLKEEKQISDASRQGLSRDLEASREAKKKVEADLAALTAEHQKLKEDKQISDASRQGLSRDLEASREAKKKVEADLAEANSKLQALEKLNKELEEGKKLSEKEKAELQARLEAEAKALKEQLAKQAEELAKLKGNQTPNAKVAPQANRSRSAMTQQKRTLPSTGETANPFFTAAAATVMVSAGMLALKRKEEN 984
2 -113.000IDP91689 gene: C4BPA; C4b-binding protein alpha chain precursor [Homo sapiens] NP_000706 [Homo sapiens]  ali follow..  95  1MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTPSCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALE--------VYKLSLEIEQLELQ-RDSARQSTLDKE........................................................................................................................................................................................................................................................................................................................................................................................... 596
3 -66.200IDP91688 gene: CD55; complement decay-accelerating factor isoform 1 preproprotein [Homo sapiens] NP_000565 [Homo sapiens]  ali follow..  20  2............TVARPSVPAALPLLGELPRLLLLVLLC---LPAVWGDCGLPPDVPNAQPALEG--RTSFPEDTVITYKCEESFVKIPGKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKTQNYFPVGTVVEYECRPGYRREPSPKLTCLQNLK---WSTAVEFCKKKSCPNPGEIRNGQIDVPGG-ILFGATISFSCNTGYKLFGSTSSFCLISGS-SVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNGEWSGPPPECRGKSLTVPPTVQKPT----------------TVNVPTTEVSPTSQKTTTKT---------------------------------------------------------------TTPNAQATRSTPVSRTTKHFHETTPN-----KGSGTTSGTTRLLSGHTCFTLTGLLGTLVTMGLLT.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 381
4 -40.600CPX_91688_91668 Complex of B1AP14_HUMAN with Q914E0_9ENTO [Undefined organism]  ali follow..  14  53......TSFPEDTVITYKCEESFVKIEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSSPKLTCLQNLKWSTAEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNND-EGEWSGPPPECRGKSLTSKVPPTVQ---------KPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKG-----------SGTTSGTTRLLSGHTCFTLTGLLGTLVTMGLLTXMGAQVSTQKTGAHETGLNASGNSIIHYT------NINYYKDAASNSANRQDFTQFTEPVKDIMIKTMPALNSPSAEESGYSDRSLTLGNSTITTQESANVVVGYGRWPEYLRDDEAAEDQPTQPDVATCRFALKDMGLFGQNMLYHYLGRAGYTIHVQCNASKFHQGCLLVVCVPEAEMGCSQTDKEVAA----NLTKGEAAHKFEPTKTTGEHTVQSIV---CNAGMGV-GVGNLTIYPHQWINLRTNNCATIVMPYVNSVPMDNYNFTLMVIPFAPLDYAAQASEYVPVTVT------APMCAEYN-----------------LRLAYQQGFPVLGSNQFMTSDDFQSPSAMPQMEIAEVDSVVPVNNIKVNLQSMDAYHIEVNTAFQMQPGLESVFKRTLMLNYYAHWSGSIKLCGSAMAADVPATRKQAMLGTHMIWDIGLQSSCQDEYTSAGN--VTCVPPGTPNKCVVLCFASACNDTPFIGQTALLQGDTETAIDNAIARVADTVASGPSNSTLTAVETGHTSQVEPS-DTMQTRHVKNYHSRSESTVENFLSRSACEYYTKDQDN-TINARRMVQLRRKFELFTYMRRQLPGTSTSTNPFWTEGNAPPRMSIPFISIGNAYSN 1144
5 -18.800IDP90280 oocyst wall protein COWP, putative [Toxoplasma gondii ME49] TGME49_004420 [Toxoplasma gondii ME49]  ali follow..  11  33.................SCPPGFSLEQRG---CVRSRQVPPIM-----RCAKKSVLAGNECVTTE--------FAPSIEVCPEGFIEKNRQPQLGCKPGFTLQNGGDCIRVRCPPKSKHTSKGCVTVEK----LDVVPSCPRGYELKKNA---CIMTQNIEP---------VPSCPQGFAFESGACVRTG-----AVPPRVSCPRGYKRQDNG---CVLFEK-----HDLEAFC----------RDGEYDGKKHCRKTTTQPALPHCPAGFSFQNGERLECGKGFTLHED--RCVKEQCPPGATLMKDKCAILTS----------EKPAVTCPDKFIMADG-----VCKSADVRPAEFVCGTGGCVRSTTAKPALSCERGELKKGECSMIQTVPAETACILGGALTPDGCVFIDTAPLSHRC----------GANFKMDIKGQCATVETIDPICPPGFAPSGTKKATCERFLTSPAAIKCP--------AGFEPAGTKCMKTARIQAIASCPHGFVFHEGA---CIP......................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 490
6 -17.400IDP91750 SPG2_STRSG [Streptococcus sp. `group G`]  ali follow..  25  493..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................FTVTEMVTEVPGDAPTEPEKPEASIPLVPLTPATPIAKDDAKKDDTKKED--AKKPEAKKEDAKKAETLPTTGEGSNPFFTAAALAVMAGAGALAVASKKED 593
7 -16.600IDP91694 gene: FBLN2; fibulin-2 isoform b precursor [Homo sapiens] NP_001989 [Homo sapiens]  ali follow..  440............DLIETCCAAGQQW-AIDNDECLEIPESGTEDNVCRHCC----------------------VSYLQEKSCMAGVLGAKEGETCGAEDNDSCGISLYKQCCDC--------------------------CGLGLRVRAEGQSCESNPNLGYPCNHVMLSCCEGEPLIVPEVRRPPEPAAAPRRVSEAEMAGRLSLGTEAELPNSLPGDDQDE-----LLLPGELCQHLCINTV-----------------GSYHCACFPGFSLQDDGR-TCRPEGHPPQPEAPQEPASNTIPLPLPQPNTCKDNGPCKQVCSTVGGSAICSCFPGYAIMADGVS---C------EDINECVTDLCS-------------RGEHCVNTLGSFHCYKALTCEPGYALKDECEDVDECAMGTHTCQP-----------GFLCQNTKGSFYCQARQRCMDGFLQDPEGN--CVD------INECTSL-SEPCRPGFSCINTVGSYT--QRNPLICARGYHASDDGT-KCVDVNECETGVHRCEGQVC-----------------HNLPGSYRC------DCKAGFQRD-AFGRGCIDVNECWASPGRLCQHTC----------ENTLGSYRCSCASGFLLAADGK-RCE-------DVNECEAQRCSQECANIYGSYQ-------YCRQGYQLAEDGH-TCTDIDECAQGAGILCTFRCLNVP------------------GSYQCACPEQGYTMTANGRSCKDVDECALGTHNCSEETC-----------------HNIQGSFRCLPNYVQVSKTKCECQNSNFQTGLLVPAHIFRIGPAPAFTGDTIALNIIKGNEEGYFGTRRLNAYTGVVYLQREPRDFALDVEMKLWRQGS............................................................................................ 1167
8 -15.700IDP91660 LAMA5_HUMAN [Homo sapiens]  ali follow..  94......PNQTIRGQYCDICTAANSNKAHPASNAIDGTWWQSPPLSRGLE-PRPDLWVLERSMDFGRTYQPWQFFASSKRDCLERFERITRDDAAICTTEYS-VSLVNGRPGAMNFSYSPLLREFTKATNVRLRFLRTNTLLG---LMGKALRDPTVTRRYYYSIKDISIGGRCVCHGHADACDAKDPT--------DPFRLQCTCQHNTCGGTCDRCCPPATANSANECQSCNCYGHACYYDPEVDRRRASQSLDGTYQGGGVCIDCQHHTT--GVNCERCLPGFYRSPNHPLDSPHVCRRCNCESDFTDGTCEDLTGRCYCRPNFS---VCAEGFTGFPSCYPT-SNDTREQVLPAGQIVNCDCSAAGTQGNACRKDPRVGRCLCKPNFQGTHCE-LCAPGF----------------PGCQPCQCSSPGVADDRCDPDTG----------QCRCRVGFEGATCDRCAPGYFH--FPLCQLCGCSPAGTLPEGCDEAG----------RCLCQPEFAGPHCDRCRPG-----GFPNCQACTCDP----------------RGALDQLCGAGGLCRCRPGYT-----GTACQECSPGFHGFPSCVPCHCSAEGSLHAACDPRSGQC--SCRPRVT------LRCDTCVPGAYNFPYCEAGSCHPAGLAPVDPALPEAQVPCMCRAHVE--GPSCDRCKPGGLSPSNPEGCTRCSCDLRGTLGG----------VAECQPGTGQCFCKPHVCGQACASCKDGGLDQADYFGCRSCRCDIGGALGQS----------EPRTGVCRCRPNTQGPTCSEPARDHYLP---DLHHLRLELEEAATPEG----------HAVRFGFNPLEFENFSWRGYAQMAPVQPRIVARLNLTSPDLFWLVFRYVNRGAMSVSGRVSVREEGRSATCANCTAQSQPVAFPPSTEPAF----ITVP-QRGFGEPFVPGTWALRVEAEGVLL....... 1007
9 -14.900IDP06014 SR2 [Toxoplasma gondii] AAZ94423 [Toxoplasma gondii]  ali follow..  392.........................................................................DKDVRVVDAYGKLSSTG--RLEIRRNGVW------------------------------GSV----CK---------------QGDFTVFTSARKACHELGYLHGMYLEDGCDSVEGQYVCAGAK-GVMCM------GPEKADCTFEEPPARCADHSMDVCTNTPPAEPPLGSLRIVDESGAPATNGVGRLQFYNEGWGSV------C--SDGWTSEKVACLQMGYTGIKHGGYSDDGCDDVNGVNLCGPDTEKIGVACG------GEETSLRHCPHEISSD-------IYC------------------------VHEEDIIVGCRGDGDPSGMGLFRTEDIPALSKRSLPPKIELNCGDRPLSQKQMGGQAGAMFVATCPEGCSEEPGSLKGTYIYTDDSPI--CKA-----AIHVGVVGPLGGNIVVVLGEGQDSFMESERNGVKSESFGRYDRTFMVSIPINSVKARTAKKYVDGATYAGRSAIPGGGKFPAFRESDTVTLVDVLPERFRWFAPEDFTGFRGRPEDYVDTEKLPGAKALTGFSDFTFALQMTGKRKWRSI-LTQSGCEGFTFAIDDKDECHPKFISTGIKPAIGEPLHIAVSYYSPEKVVNIYVNGRQVVSEKTDFD--FNLKSKLIIGRAADALSPEQVRHVAAEAGSGLGAGGPVPRGERRTDDGRVCLSPCSSEEPPTNPAIQLTCEDTLRREE------NGITEQRFLVSCPSD----------CTSKKVYSEASSLCKAALHSGALATQGGEVIIVTHS----GLKSYSGSTGLKAPNFRKLTCRDDGALKMNPGDKELVICP-----------------PGCLAASEGTVYGTKSPISSVCRAAIHS-GHLTNEGGEVELQATGQHEEFKGSDKNGIQSVNS-PVKPQQEE 1248
10 -14.400CPX_91687_91742 Complex of PLMN_HUMAN with Q6V4L9_STRPY [Undefined organism]  ali follow..  18  85IIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNG----------ITCQK----SSTSPHRPRFSPATHPSEGLEENYCRN-----NDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGE-------------NYDGKISKTMSGLE---CQ------AWDSQSPWCFTTDCDIPRCTTPPPSSGPTYQCLKGTGENYTCQH-FPCKNLDENYCRNPDGKRAPWQVRWEYCKIPSCDSSPVSTEQLATPVVQDCYHGDGQSYRGTSSTTTTGKK---CQ---SWSSKGPWCFTTDCNLKKCSGTEASVVAPPPVVLLPDVETPSEE-DCMFGNGKGYRGKRATTCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWG-------------ETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGQSTELCA--GHLAGGTDSCQ---------------------------------------------GDSGLVCFEKDKYILQGVTSWGLGCARPN-------KPGVYVRVSRFVTWIEGVMRNNXRKLKTGTASVAVALTVLGAGFANQTEVKAADHPSYTA-------KDEVLSKFSVPGHVWAHEREKNDKLSSENEGLKAGLQEKEQELKNLKADVEALRYINEKEAERKEKEAEQKKLKEEKQISDASRQGLRRDLDASREAKKQVEKDLANLTAELDKVKEEKQISDASRQGLRRDLDASREAKKQVEKDLADLTAELSDASRQGLRRDLDASREAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEAKALKEQLAKQAEELAKLRDSQTPDAKQAPQANQNKAPMKETKRQLPSTGETT.......................... 1202
11 -14.200CPX_91687_91741 Complex of PLMN_HUMAN with Q6V4L4_STRPY [Undefined organism]  ali follow..  17  85IIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNG----------ITCQK----SSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYD---YCDILECEEECMHCSGE-------------NYDGKISKTMSGLE---CQA------WDSQSPWCFTTDCDIPRCTTPPPSSGPTYQCLKGTGENYTCQHNFPCKNLDENYCRNPDGKRAPWCHTTNYCKIPSCDSSPVSTEQLAPTAPPELTPVVQ---DCGDGQSYRGTSSTTCQ---SWSSKGPWCFTTDCNLKKCSGTEASVVAPPPVVLLPDVETPSEE-DCGNGKGYRGKRATTVTGTPCQDWAAQEPCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGTFGAGLLKEAQLPVIENKVC---NRYEFLNGRVQELC-AGHLAGGTDSLVCFEKDKYILQGVTSWGLGCARPNKPVYVRVSRFVTWIEGVMRNNXRKLKTGTASVAVALTVVGAGLASQTEVKADQPVDHHRYTEANNAVLQGRTVSARALL------------HEINKNGQLRSENEELKADLQKKEQELKNLNDDVKKLNDEVALERLKNERHVHDEEVELERLK--NERHDHDKKEAERKALEDKLADKQEHLDGALRYINEKEAERKEKEAEQKKLKEEKQISDASRQGLRRDLDASREAKKQVEKDLANLTAEL--DKAKEEKQISDASRQGLRLDASREAKELDKVKEEKQISDASRQGLRRDLDASREAKKQVEKALE----------ANSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEAKALKEKLAKQAEELAKLPGNKAVPGKGQAKPNQNKAPMKETKRQLPSTGETT.......................... 1208
12 -13.300IDP01916 hypothetical protein lmo0327 [Listeria monocytogenes EGD-e] lmo0327 [Listeria monocytogenes EGD-e]  ali follow..  333LAPPVILNGKDGDPYTTTQKPGYTLVATPA---NQNGAFTLNPATVNYVYSANDDAQGQELKAPVVDTKDYHIQDNYTTT--PGYSLVSTPAN----QNGTFGAGNV----------------NYVYKKDDYTLTSTYKDTNGQELKAPVVDA-TTYHYQDTYTTTAAVFPGYTLVATPTNATGTFGSSNITVHYQLTSTFKDQQGKTISPDDVDT--KTYHVNDPYTTTAKTIPGYTLVTTPTNNQGNFGTSDITVDYTLTSTYKDAQGKELKQPVVDS-HIQDNYSTSAATIPGYTLVATPANETGTFHTSDVTVN-KLTDLKLTSTYKDAQGTELKPPVVDSKTYHIQDNYATTAA------ATPANQSGTFGSTDIQVNYVYQAVAYKLTSTYKDQQGNDLALPKVDTKT-TSDIAIPGYTLVAAPTNQTGTFGASDVTVNYTLTSTYKDAQGKELK------------------------TPVIDSQKYHINDTYTTTGATI-----PGYTLVAAPA---NQSGTFGAANVTVNYVYKADDYTLTNGKELKAPVVDSKTYHTKDNYSTSAATIPGYTLVAAPA---NQTGTFNTSNVT----------NYFYKANEYTLTSTFKNVQGTELKPAIVKKGFIIKDYSTSGVTIPGYTLVATPSNKKGTFGASNITTYKDTQGKDLKPLAIDT-NINDPYTATALNIPGYTLTTTPANEKGVFGASDEKANDYTLTTTYKDANGKELQAPKVDA-HIQDTYKTTAAVIPGYTLVAIPKNDQGTFGANN-DYTLTATFKDAQGNELKATEVDA-HIHDTYTSKAAVIPGYTLEKTPTNETGTFNASDIQVNY--TSTFKDQQGNEIALPTVDAKTYH-AYTTKARLIPGYSLVAAPKNQIGAFGTSDVTVNYV-YKKDAIIKPITPAKPTILKTPASKVIKTKVVKQTLPKTGDDDAGLLNLLRLILVLILGVFLAVGSKK. 1346
13 -13.200IDP91740 Q6V4L1_STRPY [Streptococcus pyogenes]  ali follow..  53  217..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................EKQVSDASRQGLRRDLDASREAKKKVEADLAALTAEHQKLKEEKQISDASRQGLSRDLEASREAKKKV-EADLAEANSKLQALEKLNKELEEGKKLSEKEKAELQARLEAEAKALKEQLAKQAEELAKLRAGQTPDAK-APQANQNKAPMKETKRQLPSTGETT.......................... 398
14 -12.700CPX_91687_91740 Complex of PLMN_HUMAN with Q6V4L1_STRPY [Undefined organism]  ali follow..  16  86.IRMRDVVLFEKKVYLSECGNGKNYRGTMSKTCQK---WSSTSPHRPRFCRNPDNDPQGPWCYTTDPEKRYDY-LECEEECMHC-KISKTMSGLECQA---WDSQ-------------SPHAHGYIPSKFPNKNLKKNYCRN----DRELRPWCFTTDPNKRWE----LCDIPRCTTPPPSSGPTYQCLKGTNVAVTVSGHTCQHNFPCKNLDENYCRNPDGKRAPWQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQ---DCGDGQSYRGTSSTTCQ---SWSSMTPWCFTTDCNLKKCSGTEASVVAPPPVVLLPDVETPSEE-DCGNGKGYRGKRATTVTGTPCQDWAAQDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWG-------------ETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGQSTELCA--GHLAGGTDSCQ---------------------------------------------GDSGLVCFEKDKYILQGVTSWGLGCARPPGVYVRVSRFVTWIEGVMRNNXRKLKTGTASVAVALTVVGAGLASQTEVKAENHPGYTAAQNGVLSELPGQAQAFSRAFLHER-EELRLENEGLKTDLKKKEQELEAELERLKNERYEHDKKEAERKALEDKLADKQEHLNGALRYINEK-EAEGLRRDLDASREAKKQVEKDLANLTAELDKVKEEKQVS-DASRQGLRR--DLDA---SREAKKKVEADLAALTAEHQKLKEEKQISDASRQGLSRDLEASREAKKKVEADLAEA-NKELEEGKKLSEKEKAELQARLEAEAKALKEQLAKQAEELAKLRGNKAVPGKGQAPQNQNKAPMKETKRQLPSTGETT.......................... 1209
15 -12.600IDP91056 viral polyprotein [Dengue virus 2] AAA42941 [Dengue virus 2]  ali follow..  160...........EDTITYKC-PFLKQNEPEDIDCWCNST---STWVTYGTCTTTGEHRREKRSVALVPHVGTAVAPSMTMRCI-----ISNRDFVEGVSGGSWVEHGSCVTTMAKNKPTLDETEAKQPATLR-NTTTDSRCPTQGEPEQDKRFVCKHSMVDRGWGGGIVTCAMFTCKKNKVVQPENLEYTIVITPHSGEEHAVGNDTGKHGKEIKITPQSSITEATGYGTVTMECSPRT----DFNEMVLLQMENKAWLV-LDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMKLQLKGMSYSMCTGKFKVVKEIA---------ETQHGTIVIRVQYEGDGS-----------PC----KIPFEIMDLEKRH----------------VLGRLITVNPIVTEKDSIEAEPPFGYIIIGVEPGQLKLNWFKKGSSIGQMIETTMRGAKRMAILGDTAWDFGSLGGVFTSIGHQVFGAIYGAAFSGVSW----------------KILIGVIITWIGMNSRSTSLSVSLVLVGVVTLYLGVMVQADSGCVVS--WKNKELKC------------SGIFITDNVHTWTEQYKFQPESPSKLASAIQKAHEEGI--CTRLENLMWKQITPSENEVKLTIMTGDIKGIMQAGKRSLQPQPTETWGKAK-PNTNRAWNSLEVEDYGFGVFTTNIWLKLREKQDVFCDSSAAIKDNRAVESALNDTWKEKASFIEVKSCHWPKSVLESEMIIPKNFAGPVSQHNYRPGYHT--------QTAGPWHLGKLEMDFDFCE-------------------GTTVVVDCGNRGPSLRTTTASGKLITEW-----CCRSCTLPPLR-----------------------RGEDGCWYGMEIRPLKEKEENLV--NSLVTAGHGQIDN--FSLGVLGMALFLEEMLRTR.... 1153
16 -12.500IDP06520 gene: ebpCfm; pilus subunit protein EbpCfm (Fms9) [Enterococcus faecium DO] AFK59016 [Enterococcus faecium DO]  ali follow..  11  331..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................GKDVAIGEKIQYEISTTFKLIDTHDAALTFD---NDSSGTYAYALYDGNKEIDPVNYSVTEQTDGFTVSVDPNYIPSLTPGGTLKFVYYMHLNEKADPTKGFSNQANVDNGHTNDQTPPSVDVVTGGKRFV-TSDQTLAGAEFVVRDQDSDTAKYLSIDPSTKAVSWVSAKESATVFTTTSNGLIDVTGLKYLEETKAPEKTIDEQSYVTAGQLIKHKGTLPSTGGKGIYVYIGAGVVLLLIAGLYFARRKHSQ 624
17 -12.400IDP05699 hypothetical protein lmo2396 [Listeria monocytogenes EGD-e] lmo2396 [Listeria monocytogenes EGD-e]  ali follow..  529................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TVKYVDGDGNELATSDTLNGKIDAPYQTTAKSLSGWTVKTTPNNATGVFTNSKTVKYVDADGNELATSDTLNGKIDAPYQTTAKSLSGWTVKTTPNNATGTVTYVYEKADGAPVTVKYVDADGNELATSDTLNGKIDAPYQTTAESLSGWTVKTTPNNATGVFTNSKQTVPVTVKYVDGDGNELATSDTLNGKIDAPYQTTAKSLSGWTVKTTPNNATGVFTNSKQTVTY--TVKYVDADGNELATPDTLNGKLDTSYAVTAKNLSGWKLTATPSNANGVFTTDAQTVTFV-YAK-TKPDTNKTPIKINENKPTASKVTTIKRQTKLPKTGDTQQDSILFGLVGTFVLLGIYSISKKNS. 940
18 -12.300CPX_91687_91739 Complex of PLMN_HUMAN with Q6V4K9_STRPY [Undefined organism]  ali follow..  11  85IIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNG----------ITCQK----SSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYD---YCDILECEEECMHCSGE-------------NYDGKISKTMSGLE---CQ------AWDSQSPWCFTTDCDIPRCTTPPPSSGPTYQCLKGTGENYTCQHNFPCKNLDENYCRNPDGKRAPWQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQ---DCGDGQSYRGTSSTTCQ---SWSSMTPHCNLKKCSGTEASVVAPPPVVLLPDVETPSE-------DCGNGKGYRGKRATTVTGTPCQDWAAQEPCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWG-------------ETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGQSTELCA--GHLAGGTDSCQ---------------------------------------------GDSGLVCFEKDKYILQGVTSWGLGCARPNKP-----------------------GVYVRVSRFVTWIEGVMRNNXRKLKTGTASVAVALTVVGAGLASQTEVKQPVDHHRYTEAVLQGRTVSARALLHEINKDDVKKLNDEVALERLKNERHVHDEEVELERLKNERHDHDKKEAERK-ALEDK---LADKQEHLDGALRYINEKEAER-------KEKEAEQKKLKEEKQIS--DASRQGLRRDLDASREAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEAKALKEKLAKQAEELAKLRAEKASDSQTPDAKPGNKAVP-GKGQAPQAGT---KPNQNKAPMKETKRQLPSTG............................. 1121
19 -12.100IDP91701 gene: SLIT3; slit homolog 3 protein precursor [Homo sapiens] NP_003053 [Homo sapiens]  ali follow..  11  846................................................................................LTSLSHLALGTNPLHCDCSLRWLSEKEPGIARCSSPEPMADR------------LLLTTPTHRFQCKGPVDINIVAK---------CNACLSSPCKNNGTCTQDPV----------ELYRCACPYSYK------KDCTVP----------INTCIQNPCQ-----HGGTCHLSDSH----DGFSCSCPLGF-----EGQRCEIN------PDDCEDNDCENNATCVDGI----------------NNYVCICPPNYTGELCDEVIDHCVPELN-----LCQHAKCIP-----------------------LDKGFSCECVPGYS--KLCETD------NDDCVAHKCR----HGAQCVDTINGY------TCTCPQGFS--GP---FCEHPP-LLQTSPCD---QYECQNGAQCIVVQQEP------TCRCPPGFAFVGKDSYVELASAKVRPQANISLQVATDKDNGILLYKGDNDPLALELYQGHVRLVYDSLSSPPTTVYSVETSVELVTLNQTLNLVVDKGTPKSLGKLQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGK----------VATGTSYMCKCAEGYGGD---LCDNK---NDSANACSAFKCHHGQCHISDQ---------GEPYCLCQPGFS---QQENPCLGQVVREVIRRQKGYASCATAS-----------------KVPIMECRGGCG--RKYVFQCTDGSSFVEEVERHLECGCLACS...................................................................................... 1523
20 -12.100CPX_91702_91677 Complex of EZRI_HUMAN with M1_I34A1 [Undefined organism]  ali follow..  28  733.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMA---GSQAAEAEVASQARQ----MVQAMRTIPSS-----------------SAG---LKND-EN 823
21 -11.900IDP06015 scavenger receptor protein TgSR1, putative [Toxoplasma gondii ME49] EEB01669 [Toxoplasma gondii ME49]  ali follow..  134....RITIWKDFRYWVFGCNGQLDFQ-SPEASYLLAG--NKKYGISVQTGADPHAGTIGSIEVKFVGISRSTNPQTILQAPEVGSNKRVGDLQAIVLANTAEDDPWYCDYKVKRWIGKPYEQFVLVPLKPSDVDMPDVDCYTRAADIEVVKVRCPQNCQASEFASISSICAAAVNDGVLSPSGGEVKAEFSYCVYQSDSIDAIEKDVRLVGKLSSTGRLEVRRNGSWEAAIKACQLMGYKHGVYLEDGCSSVEGVDMCADKGYPVALAD----VDDPCFQCSGP---EASIDECTALKCTNTPEPPVGTLRIVDTTGAPSLTGIGRLEFYACGEGWTK---ESEQVACRQ-GQQQEKIATVNVAC------KGGRYSVPTGSPVKYSQYGAGDESELLCPHLVSDDIYCVHE---EDIVVGCEGKGDPSGIGLFTIEEKPDLGVLPIKSVALTCSDAGGPGTIFIASCPDG-YTDDSPICKA-----AIHAGALEASGGDIVVQIGHPQKSYES----TDQYNVHSDPSGPHPRSFVTSKVALELRARAGQQTQKKRSEATSIPVVPQPRFSEVESSSQ-----SQLLEDKFHWEKWTLK---------RPGSFVDASYLPGANLVPGFRDFTLTA---KVTVTGKKGQWR-SDGDCEGFILAIDNEQACHPRLIRSGFKPALGEPFDVAVERAVGIFVNGRKRTTFNLKPKIMIGRASATESDYFMGEITSVHLFDYV---LSPAQIAQLRKEVGPAPEPGR-TEDGRVCISPCSPQEPFLTGDGRPPTN----APLQLRCED-ILVSCPADCAHSTGPLHGCKIYSADSSICKA--ALHMGAIQRH------GGEAVVTLHDGMSAPHYRALTCADNGSFVLKLGIGERELVICPPH----SAVSNRAVYGAGFYSPISSV--RAAIHAGALTDEGGEVEIEAGPPHE---VGSEGFGITSQKSGSYLRSFAFVTKLSQQE. 1265
22 -11.700IDP95468 structural polyprotein [Chikungunya virus] ABD95938 [Chikungunya virus]  ali follow..  246.........................................................NKDIVTKITPEGAEEWSLAIPVMC------LLANTTFPCSQ----PCTPCCYEKEPEETLRMLEDNVMRPGYYQL--QASLTCSPHYKATRPYLAHC-------------PDCEGHSCHSPVALERIRNEATDGTLKIQVSLQIGIKTD-DSHDWTKLRYMDNHMPADAERAGLFVRTSAPCTITG--------------TMGHFILARCPKGFTDSRKISHSCTGREKFHSRPQHGKELPCSTPPDTPDRTLMSQQSGNVKIT-VNGQTVRYKCNCGGSNEGLTTTDKVINN---------CKVDQCHAAVTNHKKWQYNSPLVPRNAELGDRKGKIHI----------------PFPLANVTCRVPKARNPTVTYGKNQVIMLLYPDHPTLLSYRNMGEEVMHKKEVVLTVPTWGNNEPYKYWPQLSTNGTAHGHPHEIILYYYELCARRRCITPYELTPGATVPCIRTAKWNEQQPL-----------------LQALIPLAALIVLCNCLRLLPCCCKTLAFLAVMSVGAHTVSAYEHVTVIPNTVGVPYKTLVNRPGYSPTLSLDYITCEYKTVIPSPYVKC------------CGTAECKDKNLPDYSCKVFTGVYPF-------MWGGAYCFCDAENTQLSEAHVEKSESCKTEFASAYRAHTASASAKLRVLYQGNNITVTAYAIVGPMSSAWTKGDVYNMDYPPFGAGRPGQFGDIQSRTPESKDVYANTQLVLQAPSGFKYRGASLQHTAPFGCQIATNPVCAVGNMPISIDIPEAAFT-DAPSLTDMSCEVPACTHSSDFGGVAIIKYAASKKGKCAVHSMTNAVTIREAEIEVEGNSQLQISFSTALASRVQVCSTQVHCAAECHPPKDHSATAMSWVQKITGGVG------VVAVAALILIVVLCVSFSR.... 1247
23 -11.500IDP06525 gene: fms17; LPXTG family cell surface protein Fms17 [Enterococcus faecium DO] AFK58157 [Enterococcus faecium DO]  ali follow..  11  292........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KEGLVTTGQRFLPSGT-EELKGVEGYEMDEASKRIEVIIPEFWVDAKGQPQYVVVNGQEMAELESGKVPVSAYESATPRVYNETVKETTDKPKEPS-GPSNPGQSGKWSVFPQTNEARTLISLLGILLLLGAVLLIKKERGEKN 436
24 -11.100IDP05555 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo1413 [Listeria monocytogenes EGD-e]  ali follow..  140.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................QVNYVDETNQTLATSDTLSGKLGETYTTSPKAIDGYQVKETPTNATGTYTTNTETEGANVSVEYINEATNESIAPTETLSGKIGTTFQAEVKEIDGYELSQVPSNQSGTYTDQTQSVDVTVTYKDTKGNQLADPVILKGDIGSTFETEAKSFKGYKLTKTPSNHSSVFTSD------SQEVEYV----YS-------------------------KDDAVITPPVTPVNPDKPIINPVKPVNPATSTVPNKNISKKNTTKTVNQTGKTSTALQLPKTGDSENNLPLIIGVSLLISGVYIFTTRRKRV 438
25 -10.800IDP91681 LAMC3_HUMAN [Homo sapiens]  ali follow..  273.CNGHASECGPDVAGQLACRCQHNTTGTDCERCLPDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDH---TAGPHCERCQEN-HWDPRMPCQPCDCQSAGSLHL-----------DDTGTCACKPTVT--GWKCDRCLP----GFHSLSEGGCRPCTCNPAGSLDT-------------DPRSGRCPCKENVEGNLCDRCRPG----NLQPHNPAGCSSCFC-----------YGHSKVCASTAQFQVHHILSDFHQGAEGWWARSVGGSEHPPQWSPNGVLLSPEDEEELTAPEKFLGDQRFSYGQPLILTFRVPPGDSPLPANLTSLRLRVSPGPSPAGPVFLTEVRLTSARPGLSPPASWVEICSCPTGYTGQFCE-SCAPGYKVPCTCNQHGTCDPNTGIC------------------------------VCSHH--TEGPSCERCLPGFYAGQADDCQPCPCPGQSACTTIPES------REVVCTHCPPGQR--GRRCEVC-DDGFFGDPPQPCHQCQC-------SGNVDPNAVGNCDPLSGHC-------------------LRCLHN----TTGDHCE-----------------------HCQEGF-----------GSALAPRPADKCMPCSCHPQGSVSEQMPCDPVTGQCSCLPHVT--ARDCSRCYPGFFDLQPGRGCRSCKCHPLGSQEDQ-------------HPKTGQCTCRPGVTGQACDRC-QLGFFGFSIKGCRACRCSP-----LGAASAQCHENGT----VCRPG--FEGYKCDRCHDNFFLTADGTHCQQCPSCYALVKEEAAKLKARLTLTEGWLQGSDCGS-DILLGEAPRGDVYQGHHLLPGAREAFLEQMMSLEGAVKAAREQLQRLNKGARCAQAGSQKTCTQLADLEAVLESSEEEILHAAAILASLEIPQEGPSQPTKWSHLATEARALARSHRDT 1169
26 -10.400IDP06539 gene: fms13; LPXTG family cell surface protein Fms13 [Enterococcus faecium DO] AFK58158 [Enterococcus faecium DO]  ali follow..  10  350............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TITYNLKVSTELEADDFHNNTAVIEIGRNDEFDYEEGVEPPEKVTTGGRKFEKYDASSSELLK---DARFELWNEDRSEYAIFYKGESPLAVYESGADRIEWATSGQATEFVADGNGYFEVQGLDYMKETMAPEGIVGVENPGPERVPNMKRGSLPATGGNGLLAFLLIGISLMIGAYSWYRKSKMKS 563
27 -10.400IDP05502 putative collagen-binding surface protein [Clostridium difficile 630] CD0386 [Peptoclostridium difficile 630]  ali follow..  12  835.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TDKDGNKELEAGKEVTIIDTITLE-GTQYKLVG--WQMLKEENAELLINGKRVESDYTFTADSETMKVEVAFTFDATVTFEELYD-LSNPDEPKKVTEHKDIEDEGQTSRPSDSPKTGDNTN-LYGLLALLLTSGAGLAGIRKMKKS 1014
28 -10.200IDP05117 putative collagen-binding protein [Clostridium difficile 630] CD2831 [Peptoclostridium difficile 630]  ali follow..  738.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................EAKKVDALDKNVLSGAKFNLEDAFGN----------IVVKDLVSDEDGIIQSSVKNPGT-VEIMAPRGYEKLKDKIKVEIGNKDIGRIVDIGNIENIRQENPPVNPPAPPNTDEPIVNPPVPPSTDK------KPSSSSDTEDTIVINPPVPPSEDIINPPIPEVLNPPVPPSEEMIETPVKQIIPIPEVVKPSVSEEKNNKVKDDTLVNPPVPPKTGDSTTIIGEILLVIGAIVGLIVLRRNKNTN 972
29 -9.980IDP05538 putative collagen-binding surface protein [Clostridium difficile 630] CD3392 [Peptoclostridium difficile 630]  ali follow..  12  835.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TDKDGNKELEAGKDVTIIDTVTLE-GTQYKLVG--WQMLKEENAELLVNGKRVESDYTFIADSENMKVEVAFTFDATVTFEELYDLS-NTDEPKKVTEHKDIEDEGQTSRPSDSPKTGDSTN-LMAFIVMLLVSGGGLAGTRKMKKS 1014
30 -9.790IDP91808 gene: CTCF; CTCF [Homo sapiens] AAB07788 [Homo sapiens]  ali follow..  266...................................................................................................................................................................................................................................................................................................................................................................................................................................................................FQCELSYTCPRRSNLDRHMKSHTDERPKCH----------------------------LCGRAFR-TGTRPHKCP----------DCDMAFVTSGELVRH---------------------------RRYKHTHEKPFKCSM----------CDYASVEVSKLKRHIRSHTGER--FQCSLCSYASRDTYKLKRHMRTHSGEKPECYI-----------------------CHARFTQSGTMKMHILQKHTENVAKFHCPH--CD--TVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQKSHKNEKRKCDQ--CDYACRQERHMIMHKRTHTGEK---HCDKTFRQKQLMHFKRYHDPNFVPAAFVCSK--CGK--TFTRRNTMARHADNCAGPD-GVEGENGETKKSKRGRENAEPDLDDNEDEEEPAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTN--QPKQNQPTAIIQVEDQNTGAIENIIV-PDAEP--AEGEEEEAQPAATDAPNGDLTPE... 719
31 -9.740IDP92598 sortilin, putative [Toxoplasma gondii ME49] TGME49_090160 [Toxoplasma gondii ME49]  ali follow..  450.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................RTVISFDKGGVWSYLKAP-QKIDCPPDRCWLHLNGITRFSDFAPFYSVENAVGIIMGTGN-RPEKDEANTYLSRDGSWIEAHKGAFIYEMGDHGGLMADDTKKTNQVVFSWNEG---------------SWYDIEPNASSVEFLLYGKREQDSAGVLFHLDFNALNQQQCKGIWAADSVSSDTWSPSDGRAGGERC--------------------LGKHITYT---------KQTSECFNGRDFDRPKKVCP---C-------------------TMEDYECEFGF-TRAIGSTQCVATDAAAAAAATATGL--------AQFADESDAAAAAACTSSSFFYTSAYRKVPGDV--CEGGWMPEKVAVPCPAHSPVSRGGKTVLLLLLFIVVVMVVINESRRGEELGERSKYEPELGFIEAEQDENEEDAP--AAGGQRTSGFELDDSRPLFPSHPRSTSTENEP 945
32 -9.720IDP06545 gene: fms18; LPXTG family cell surface protein Fms18 [Enterococcus faecium DO] AFK59452 [Enterococcus faecium DO]  ali follow..  84.................................................CIEPGVPIYNEFTPGYEKNPLPDMSEKAKLVSVLWKEAGTDVDTHIVAQKMIWQEVNGYTLHSIKRS----DGSAVNIAAIESGQSTTVTDTNGLNLSEFDEVVENIANIDYRVNGNQ------------VITPNANSKESGELTLKKSANTGTPVAYKMAGQQTLMAGAIDKPN------------------------TYTIKIDVETEGSLKKVDKETGNVVPGTVFHLDFGKTLPAKDVTT------------KEGIATL-DEIPHGAKVTITEK---SVPAPYTI--DTTPITATIKSGETISVTSKNTREKGQIILNKMGVETGTDLWNDKYSLAGNTFAIRKDSPTGEIVQEMTTDE---------------------KGHAETPKEIANALELGTYYVTEGFVNTFKPVKVELNYVNQTVALVTSNVKGQNQEITGETTLTKEDKDTGNETQ---GAEYTLFTAKDGQAVKWSEAFKPELVKGTKASDETVTLTKNQVAVKHLAINE---YYWQE---TKAPEGYTLDETKYPVSIKKVDDNEKNAVITRDVTAKEQVIRFGFDFFKFAGSAAGTAETGFNDLTFKVSPLEGTSEITGAEDEAITAYNEQLGFDGYGKFENLEEVEAPEGFQKITPLEIRSTFKENKADYTKSEYIFTITEKGQKQPIKTVTVPYEKLT---------NKAFSVSLNRLMLYDLPEEEDSLTSLGTWKDGGKELTDLDSTELVDKLSYNLHEEDWYVVAQAIDVEATKAAQEKDEKAKPVVIAETTATLANKE-NKKPYEAGDDPVAKDASLNNQAQTVNCTVERHVSIQTKAHLEDGSQTFTHGDVVDMFDDVSITHDVLDGSKETSFTFKEINY-EKTQTPEQPEIPTVPSDSQESSPTVKTFPQTGEKNSNVLLFIGFTLIFATAGYYFWNRRN. 1075
33 -9.480IDP05663 hypothetical protein lmo0333 [Listeria monocytogenes EGD-e] lmo0333 [Listeria monocytogenes EGD-e]  ali follow..  1309.............................................................................................................................................................................................................................................................................................................................................................................................................................................................FQTATNFKTAMSYTVTLNAVNEDGISAEPVAVTVTINKEPAAALKA------------DAEVSYAKNEAVTESDFFKDVHLEGTEAPSTAKATSNFDSVVDRSKTGDYTVTINATNEDGAVSTPIEVIVHIEAESAPVITANAEVKYNKHEQTDERRFLYDSEAKIDEANVEIKTDFAEKVDINKVGTYTVTLTAT---NEDGQAANPVEVSVIVSDAAAEKV---------NVKYVDENGSEISAAETLTGNLDETFSIDAKSICDATLSGVFSTVEQTVVFHYKAIKPGVVTIKYEDTNGKAVDEDKQITGEVGDDFEAEAQTVSGYSC---RAIASGKITEEP----QTITFTYSTATPSKKSGEI------------------------------------------TVQYVDESGKKLADSKKVTGNIDDSYSVEAKAIEGYSVVGDDSAKGVFTEKSQTV--TFKYKKNTQVSKDDPKVKGKTNQPSSTDTKLKVDNNSLPATGDTENMLAVLIGFNMLIVASIFLFRKPKTN 1777
34 -9.470IDP91691 gene: EFEMP1; EGF-containing fibulin-like extracellular matrix protein 1 precursor [Homo sapiens] NP_001034438 [Homo sapiens]  ali follow..  10  20.........TEETITYTQCTDGYEWDPVRQ-QCKD-----------IDEC------------------------DIVPDACKGGMKCVNHYGGYLCLPKTAQIIVNNEQPQQETQPAEGTSGATTGVVAASSMATSGVLPGGGFVA-SAAAVAGPEMQTGRNNFVIRRNPADPQR-----------------IPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLAC--------------------------QCPPGYQKRGEQCVDIDECTIPPYCHQRCVNTP---------------------------GSFYCQCSPGFQLAANNYT---CVDINECDASNQCAQQCYNIL------------------------GSFICQCNQGYELSSNCEDIDECRTSSYLCQYQCVNEP-----------------GKFSCMCPQGYQVVRSRTCQCETTNECREDEMCW----------------------NYHGGFRCYPRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSLRLTIIVGPFS...................................................................................................................................................................................................................................................................................................................................................... 492
35 -9.310IDP91543 cAMP-specific 3`,5`-cyclic phosphodiesterase, putative [Toxoplasma gondii ME49] TGME49_057080 [Toxoplasma gondii ME49]  ali follow..  9........................................................................................................................................................................................................................................ECQR---SPPSAPSSTLLPGSAP-----EAKMLSC--DLERAGSDVTVAPGPAGSDSVTSPYAD-------PFRDRFAVGRGSVRRSDSTADDTAMPEICVDKHRPSPTAASTLPRNAEDLHHGYHDVEAAGEPYGEMNN----ASEDRSSNSQFRLRCGRQ-AWETRPNSAAFVTALRALPWASALVHAPPVEHAPIQPSPGGGVPDAGANRCLHIDDTGATDNDSIRSLATIALSPSSSGSRSP-------HPDSIEGADFRLREVGTGGDS-----SPASSLESMSSPSCVCHSTGSDTFVSARS---ETPRFLALVAVHGKPRPTNSNCRLPPAQASESCAGSGWREENRKSSAIRGSGRLSEVTANQRKTRSGQNSGQRNQGARKSLILSENLEGGLPARVPNRV-----DESDLELAVASPVSSVFHQSDSRGKRCCSKENEDS-QTCFRCIGSSHVRQHRNGESAGDAGHAEN---QEAEWRDSRTVTTPSKDAQLSGVNALHTVPRMHRKKGAKELPEPSSPLETCRDREAEKVAFCLSGADQGRQLGGD--PPGPIRRYV---------SRFLEMWGGDDWGSTYYDSFSGSRGDIDAVAHCRHTRSRSPAGCGRHRSSSADGCLVVAAHEAGASPRRGVFEGRHTHSQTFSLVKPASFQWATTQPLEQLLAERNREDLAESAGGHTGDAALALPTQRGRASVWSSRGSSPRTEEEANRLFVVGMVLLLVEILQISWRLVQRS 803
36 -9.280IDP91950 beta-N-acetylhexosaminidase [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100006639 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  15 1160...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................QKEEIPFTTVTRENPLLLKGKTQVITKGVNGHRSNFYSVSTSADGKEVKTLVNSVVAQEAVTQIVEVGTTHVGDENGQAAIAEEKPKLEIPSQPAPSTAPAEESKAPAPVVIEKKLPETGHDSAGLVVAGLMATLAAYGLT--KRKED. 1312
37 -9.270IDP05656 hypothetical protein lmo0171 [Listeria monocytogenes EGD-e] lmo0171 [Listeria monocytogenes EGD-e]  ali follow..  14  717...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................EGYTLKENPA----SSGVFEETRQTIQYIYVKDIINPEF-PVYSENNVTPELPSNNNNSVNGSRQTPSKSVKKQSKAYSKINQMPMNLPETGDSTNLLFIFMGVLLLAGLTLSKAKRKNQ. 832
38 -9.000IDP05657 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo0175 [Listeria monocytogenes EGD-e]  ali follow..  270............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TVNHLDSNGNKIAESDTLTGVVNSNYQSESKKITGYTLETTPTNATGTFTDTP------QTVDYI------------------------------------KKDTVTPTPITVNPVEPVKPVNPVVNKPVTVKPANDNTNPSTSNSVEKTTYSSLPTTGDTDQSKSSTIFGALLLLISAPLLLFKKK. 415

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 8 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.