current user: public

If you have questions about the server, please let us know.

Query: CPX_91702_91677 Complex of EZRI_HUMAN with M1_I34A1 [Undefined organism], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .
# Score Template Links and tools%idFirst MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEALXMSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFKLast
1 -293.000CPX_91702_91677 Complex of EZRI_HUMAN with M1_I34A1 [Undefined organism]  ali  100  1MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEALXMSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK 839
2 -125.000IDP91702 gene: EZR; ezrin [Homo sapiens] NP_003370 [Homo sapiens]  ali follow..  100  1MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL............................................................................................................................................................................................................................................................. 586
3 -84.900CPX_91712_91677 Complex of HSP7C_HUMAN with M1_I34A1 [Undefined organism]  ali follow..  100  714.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK 899
4 -54.800IDP91677 gene: M1; matrix protein 1 [Influenza A virus (A/Puerto Rico/8/34(H1N1))] FLUAVs7gp1 [Influenza A virus (A/Puerto Rico/8/1934(H1N1))]  ali follow..  49  13......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAV-TTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK 252
5 -16.900IDP91521 C2 domain-containing protein [Toxoplasma gondii ME49] TGME49_040910 [Toxoplasma gondii ME49]  ali follow..  1462..........................................................................................................................................................................................................................................................................................................................GGGATLQWDGPGTNILDRIAQEQATAGEGEQQTSEGIPTRDMQVDGTAVLEEAGEKSDKKKKKKEKKEKKEKKEKKEKKEKKEKKKKKGGETAAEPEEASAVLAPPPVPVPAAAIPSVLLPADSEDGEKEQPKEKKKEKKEKKKKKDGETDAEPEEASAVLAPPPVPVPAAAIPSILLPTDGEDGEKEKTKEKKTEKKKEKHTEKKHKKKSEALPESETTAVVTVTPGEEDETSPLVPVPSSIASSEAPEPPASTRVTPAPEPKAKPGLSMGAALLAVRARSRLQRKHLAQQLSSSSSSEVSASSASSLSPSSSSSSDFAETRAKADALRARLQAAQARLAAARETEVSSSETESSETSEASFLSSDGEWDALWQSQRAAAMERQQRLQKMVSGVKAAYRRLEEENTRLAATRRRDDKLQRQVEAERERAKEATRRAKEEKDLIARQPPPARDWSDTVVLSTPQIFVNSQAACSGRDEGGRDEWY-EVSDACSRRAESSNESRTTAGAKLRQQQLDLG....... 1988
6 -12.100CPX_91689_91672 Complex of C4BPA_HUMAN with ARP4_STRPY [Undefined organism]  ali follow..  28  874............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQALEKLNKELEEGKKLSEKEKAELQARLEAEAKALKEQLAKQAEELAGN--QTPNA-KVAPQANRMTQQKRTL---PSTSAGLKRK--EN................ 984
7 -10.400IDP91673 CD44_HUMAN [Homo sapiens]  ali follow..  9.......................................................................................................................................................................................................AWGL----PLSLAQIDLNITCRFAGVFHVEKNGRYS----ISRTEAADL--KAFNSTLPTMAQMEKALS---IGFETCRYGFSIC-SQYDTY--DDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPREDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSTTLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQLIILASLLALALRRRCGQKKKAVEDRKPASKSQEMVHLV-----NKESSETMTADETRNLQNVDMKIGV...... 742
8 -9.860IDP90350 hypothetical protein CT456 [Chlamydia trachomatis D/UW-3/CX] CT456 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  10  2........................................................................................................................................................................................................................................................................................................................................................................................................................................TNSISGYQPTVTTSTSSTTSASGASGSLGASSVSTTANATVTQTANATNSAATSSIQTTGETVVNYTNSASAPNVTVSTSSSSTQATATSNKTSQAVAGKITSPDTSESSETSSTSSSDHIPSDYDDVGSNSGDISNNYDDVGSNNGDISSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSDGAAAAALNSLRGSSYTTGPRNEGVFGPGPEGLPDMSLPSYDPTNKTSLLTFLSNPHVKSKMLENSIDTDRSSF-DQVCSIKVQNKTKEDLDAKFCTGFSKFSG-----DWDSLVEP-SAKAGIINNKFK 444
9 -9.370IDP95385 set238a-022 [Vibrio cholerae]  ali follow..  101...TLVPALERLSLRSNSRIFQQQSVPEIISILLQEMGI-EADLFLHRIAAEEGLVYSHLHEAQKHTLLFTDSSD-----PVPYNALAGGEINLPYVVDL----QFKTTAQVSHTELKDDIAYQQPNYEHFDAPGRYKDDANGKAFSQ--LLLAGVRFDLQDHLDLAMNRDWLVVQANHQGTQPQALQ-NQLKLIPAHITWRARPCAKPQVDGPMIATVVGPQGEEIYCDN-RV--KVHFPWDRYSSSN-EKSSCWVRVAQEHEVIVSFL--NGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTETNELSFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRNQHLTVEGEVRGKIALDSSHEVGASLQHKVGQRIAVEAGKEISLKSGAKIVVEAGAELTLTAGCSFVKVDAGGVHLVGPAINLNAGGSAGSGSAYGGQLAAAPRMLAQAKPVAELVQPDIAASMQSGAARVIDVASLPTIMPSSANNTANDEPVAEEKTPERI---------------KSDLLKPSDELEKLAKRQASAYRQGNHSDEVKLLQEALIKLGFDLGKAGADGDFGSKTKTAIEQFQKSYQPSHQTHPSYSIGPVDGIVGKGTLLALDEALMDGWVYESPRFPMTLVNGELAPIEFLNFYNGDEIEESDYEEAARELNCEVAAIKAVAKTETGSYGAYFNFGQGDDDVPAILFERHHFHKYTNGKYDMYEDISNPIAGGYGTISTQYSKLMKAYALDKRAALKSVSGKFQILASNYVEAEILDISSEKNQLKSFVNFIKSDKVLLSSIRSNWLSFARRYQKGYDLKMEK.. 1015
10 -9.100IDP95313 VgrG protein [Vibrio cholerae O1 biovar El Tor str. N16961] NP_232524 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  11  101...TLVPALERLSLRSNSRIFQQQSVPEIISILLQEMGIEETDLFLHRIAAEEGLVYSHLHEAQKHTLLFTDSSD-----PVPYNALAGGEINLPYVVDLQFKTTAQVSFKKPAYGFTQRTQGK-PNYEHFDAPGRYKDDANGKAFSQ--LLLAGVRFDLQDHLDHAMNRDWLVVQANHQGTQPQALQ-NQLKLIPAHITWRARPCAKPQVDGPMIATVVGPQGEEIYCDN-RV--KVHFPWDRYSSSN-EKSSCWVRVAQEHEVIVSFL--NGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTETNELSFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRNQHLTVEGEVRSKIALDSSHEVGASLQHKVGQRIAVEAGKEISLKSGAKIVVEAGAELTLKAGGSFVKVDAGGVHLVGPAINLNAGGSAGSGSAYGGQLAAAPRMLAQAKPVAELVQPDIAASMQSGAARVIDVASLPTMMPSSANNTANDEPVAEEKTPERILKSDLLKPSDELEKLAKRQASAYR-------QGNHSDEVKLLQEALIKLGFDLGKAGADGDFGSKTKTAIEQFQKSYQPSHQTHPSYSIGAVDGIVGKGTLLALDEALMDGWVYENNIYQIWPLGKTSEKYESAGRGPGVISTGNGDYGGASYGCYQMSSNLGVVQKYIQSSKFKEFFSGLNPATKEFNVV--------------WQDIASRYPQEFREEQHQKRTHYDIQIGLLFEHNRAAVIWSTSV----QFGGRTNNALNGQNMESMTDKLVQDYKLVNTE-KSSPSWWSDLKKRAVSEKKALGLEVD-IK 1017
11 -9.000CPX_91720_91682 Complex of TF65_HUMAN with O41974_MHV68 [Undefined organism]  ali follow..  10  20...................................YVEIIEQRGMRFRYKCEGRSAGSIPGERSTDTT--------------KTHPT--------KINGYTGPGTVRISLVTKDPPHRPHPHELVGK---DCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYD-LNAVRPLRLPPVLSHPIFDNRAPELKI--SCLGFLLCDKVQKEDIEVYFGWEARGSFSHRQVAIVFRT-PPYADRVSMQLRRPSDREL------EPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISSXMPTSPPTTRNTTSGKTRSGCKRRCFNKPAAMPPKRRRAPKRPAPPPPPGCQGDEESSQGTQTPNPPSPPVPPSSPTLPSSPVPPSSPVHEPPSPSPPPAPPSPDGMRRHLQVTAPRLFDPEGHPPTHFKSAVMFSSTHPYTLNKLHKCIQSKHVLSTPVSCLPLVPGTTQQCVTYYLLSFVEDKKQAKKLKREKYHSSVEGTIVKQPSTSTQASGTQTASLD-AGA-EQGA-----------------T-GS-PGSSPG------------QQGQGSQ..... 865

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35