current user: public

If you have questions about the server, please let us know.

Query: CPX_91712_91677 Complex of HSP7C_HUMAN with M1_I34A1 [Undefined organism], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .  840    .  850    .  860    .  870    .  880    .  890    .
# Score Template Links and tools%idFirst MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVDXMSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFKLast
1 -320.000CPX_91712_91677 Complex of HSP7C_HUMAN with M1_I34A1 [Undefined organism]  ali  100  1MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVDXMSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK 899
2 -179.000IDP91712 gene: HSPA8; heat shock cognate 71 kDa protein isoform 1 [Homo sapiens] NP_006588 [Homo sapiens]  ali follow..  100  1MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD............................................................................................................................................................................................................................................................. 646
3 -157.000IDP01010 gene: hscA; chaperone protein HscA STM2539 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  35  17.QRRLAAGIDLGTTNSLVATVRSGQAETLPDHEGRHLLPSVVHYQQQGHTVGYAARDNAAQDTANTISSVKRMMGRSLAD--IQTRYPHLPYRFKASVNG---LPMIDTAAGLLNPVRVSADILKALAARASESLSGELDGVVITVPAYFDDAQRQGTKDAARLAGLHVLRLLNEPTAAAIAYGLDSG--KEGVIAVYDLGGGTFDISILRLSRGVFEVLATGGDSALGGDDFDHLLADYIREQA----GIADRSDNRVQRELLDAAIAAKIALSDADTVRVNVA------GWQGEITREQFNDLISALVKRTLLACRRALKDAGVEPQDVLEVVMVGGSTRVPLVRERVGEFF-GRTPLTAIDPDKVVAIGAAIQADILVGNK--PDSEMLLLDVIPLSLGLETMGGLVEKVIPRNTTIPVARAQDFTTFKDGQTAMSIHVMQGERELVQDCRSLARFALRGIPPLPAGGAHIRVTFQVDADGLLSVTAMEKSTGVEASIQVKPS-YGLTDGEIASMIKDSMSFAEQDVKARMLAEQKVEAARVLESLTGALTAD--AALLSAAERQCIDDAAAHLSAVAQGD---DVDAIEQAIKNVDKQTQEFAARRMDQSVRRALKGHSVDE................................................................................................................................................................................................................................................................................. 615
4 -157.000IDP92592 heat shock protein 70, putative [Toxoplasma gondii ME49] TGME49_073760 [Toxoplasma gondii ME49]  ali follow..  74  1MADSPAVGIDLGTTYSCVGVWKNDAVEIIANDQGNRTTPSYVAFTDTERLVGDAAKNQVARNPENTIFDAKRLIGRKFDDPSVQSDMKHWPFKVIAGGDKPLIEVTYQGEKKTFHPEEVSAMVLGKMKEIAEAYLGKEVKEAVITVPAYFNDSQRQATKDAGTIAGLSVLRIINEPTAAAIAYGLDKKGCGEMNVLIFDMGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVDFCVQDFKRKNRGDISTNSRALRRLRTQCERTKRTLSSSTQATIEIDSLFEGIDYSVSISRARFEELCMDYFRNSLLPVEKVLKDSGIDKRSVSEVVLVGGSTRIPKIQQLITDFFNGKEPCRSINPDEAVAYGAAVQAAILKGVTSSQVQDLLLLDVAPLSLGLETAGGVMTKLIERNTTIPTKKSQTFTTYADNQPGVLIQVYEGERAMTKDNNLLGKFHLDGIPPAPRGVPQIEVTFDIDANGIMNVTAQDKSTGKSNQITITNDKGRLSASEIDRMVQEAEKYKAEDEQNKHRVEAKNGLENYCYHMRQTLDDEKLKDKISSEDRDTANKAIQEALDWLDKNQLAEKEEFEAKQKEVESVCTPIITKLYQAGAAAGGMPG..................................................................................................................................................................................................................................................................................... 624
5 -157.000IDP06131 gene: dnaK; molecular chaperone DnaK [Helicobacter pylori J99] NP_222822 [Helicobacter pylori J99]  ali follow..  47  2...GKVIGIDLGTTNSAMAVYEGNEAKIIANKEGKNTTPSIVAFTDKEILVGESAKRQAVTNPEKTIYSIKRIMGLMFNEDKAKEAEKRLPYKIVDRNGACAIEI----SGKIYTPQEISAKILMKLKEDAESYLGESVTEAVITVPAYFNDSQRKATKEAGTIAGLNVLRIINEPTSAALAYGLDKK--ESEKIMVYDLGGGTFDVTVLETGDNVVEVLATGGDAFLGGDDFDNRVIDFLAAEFKNETGIEIKNDVMALQRLKEAAENAKKELSSAMETEINLPFITGPKHLVKKLTRAKFESLTEDLVEETISKIESVIKDAGLTKNEISEVVMVGGSTRIPKVQERVKAFI-NKELNKSVNPDEVVAVGASIQGGVLKGD----VKDVLLLDVTPLSLGIETLGGVMTKVIDRGTTIPAKKSQVFSTAEDNQPAVSIMVLQGERELARDNKSLGKFDLQGIAPAPRGMPQIEVTFDIDANGILTVSAQDKNTGKSQEIKISGS-SGLSDSEIEKMVKDAELHKEEDARKKEVIEARNHADSLAHQTQKSLDE--HKTNLNENDANEIQNAINALKDCIK-NDNATKAELEDKTKALTQAAQKLGEAMANKNNAEQPKKKD.................................................................................................................................................................................................................................................................................... 611
6 -154.000IDP01396 gene: hscA; chaperone protein HscA VC0752 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  36  17.QHKLAAGIDLGTTNSLVASVRSGTASTLVDSQGRSILPSVVNYGADATRVGYPAREQAETDPHNTVISVKRLLGRSLQDINQRYPHLPYRF-KASEKGLPIVQT----AQGDKNPIQISADILKALAERATATLGGELAGVVITVPAYFDDAQRVATKDAAALAGLHVLRLLNEPTAAAIAYGLDSG--QEGVIAVYDLGGGTFDISILRLSRGVFEVLATGGDSALGGDDFDHLIADHLQAQIGLTSLTA-----EQQRALINAATQAKIDLTEYMTAELNVL------GWQGSLTREELENLIAPLLKKTLLSCRRALKDAGVEADEVLEVVMVGGSTRTPFVREQVGEFF-GRTPLTSINPDEVVAIGAAIQADILAGNK--PDAEMLLLDVIPLSLGIETMGGLVEKIIPRNTTIPVARAQEFTTFKDGQTAMSVHVVQGEREMVDDCRSLARFSLKGIPPMAAGAAHIRVTYQVDADGLLSVTALEKSTGVQAEIQVKPS-YGLSDDEVTQMLKDSMAYAKEDMLARALAEQRVEADRVIEGLVSALQADG-DELLNEQERQTLLQAIERLIELRNGD---NADAIEQGIKDTDKASQDFASRRMDKSIRSALAGHSVDE................................................................................................................................................................................................................................................................................. 615
7 -154.000IDP02393 gene: dnaK; heat shock protein DnaK [Francisella tularensis subsp. tularensis SCHU S4] FTT1269c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  49  2...GKIIGIDLGTTNSCLAIMDGKTAKVIENAEGHRTTPSVVAYTDSEILVGQAAKRQAVTNPDNTFFAIKRLIGRKYDDKAVQEDIKKVPYAVIKADNGDAWVATK--EGKKMAPPQVSAEVLRKMKKTAEDYLGEPVTEAVITVPAYFNDSQRQATKDAGKIAGLEVKRIINEPTAAALAYGVDSK-KGEQTVAVYDLGGGTFDISIIEIADNQIEVLSTNGDTFLGGEDFDLALMNYLIDEFKKEQGIDLHNDKLALQRVREAAEKAKVELSSAQQTDVNLPYITGPKHLNIKVTRAKFESLVSDLVMRSLEPCKKALEDAGLSKSDITEVLLVGGQTRMPLVQEKVKEFF-GKEPRKDVNPDEAVAVGAAIQGGVLAGD----VKDILLLDVTPLSLGIETMGGVMTKLIERNTTIPTKKSQVFSTAEDNQPAVTIHVLQGEREMASANKSLGRFDLADIPPAPRGMPQIEVTFDIDANGILNVSAKDKATGKEQNIVIKSSSG-LSEEDIEKMVQDAEANAEADKKFHDLVTARNTADNLIHSSRKAIQE--LGDKVTAAEKEKIEEACKELEAATKGD---DKQAIESKTKALEEAFAPIAQKAYAEQAQAAVAQGGAKAEEPK--KEEDVVDADFEDVEDDKK......................................................................................................................................................................................................................................................... 642
8 -154.000IDP01643 gene: hscA; chaperone protein HscA [Yersinia pestis CO92] YPO2892 [Yersinia pestis CO92]  ali follow..  33  17.QRRLAAGIDLGTTNSLVATVRSGKGQQLINEKQRDLLPSVVHYHPQGIDVGWKARNLAALDPVNTISSVKRMMGRSLAD--IVQRYPNLPYQFHASENG---LPMIQTARGLVNPVQVSAEILKTLAQRAQAALAGELDGVVITVPAYFDDAQRQGTKDAARLAGLHVLRLLNEPTAAAIAYGLDSG--QEGVIAVYDLGGGTFDISILRLSRGVFEVLATGGDSALGGDDFDHLLADWLRE----QAGVATRDDHGIQRQLLDTAIAAKIALSEAETAVVSVA------GWQGEVTREQLESLIAPQVKRTLMACRRALKDAGVTADEILEVVMVGGSTRVPLVREQVGQFF-GRTPLTSIDPDKVVAIGAAIQADILVGNK--PDSDMLLLDVIPLSLGLETMGGLVEKVIPRNTTIPAARAQEFTTFKDGQSAMMIHVLQGERELVKDCRSLARFTLRGLPPLPAGGAHIRVTFQVDADGLLSVTAMEKSTGVEASIQVKPS-YGLSDDEIANMIKDSMANAQSDITARKLAEQRVDAARVLESLQGALAED--AALLSEQESAAIAQAVALLQQQMQGS---DPQAIEAAIKALDAQTQDFAARRMDASIRRALAGHSVDE................................................................................................................................................................................................................................................................................. 649
9 -153.000IDP02646 gene: dnaK; chaperone protein dnak [Coxiella burnetii RSA 493] CBU_1290 [Coxiella burnetii RSA 493]  ali follow..  48  2...AEIIGIDLGTTNSCVAVMEGGKVRVIENAEGSRTTPSIVAYTDGEVLVGASAKRQAVTNADRTLYAIKRLIGRRFDDNVVQKDIKMVPYKIIKANGDAWVEVKDEGKSQKLAPPQISAQVLIKMKKTAEDYLGHEVKDAVITVPAYFNDSQRQATKDAGKIAGLNVKRIINEPTAAALAYGMDKK-KGDRKIAVYDLGGGTFDISIIEIAEHQFEVLATNGDTFLGGEDFDLRLIDYLAGEFKKDEGVDLHNDPLALQRLKEAAEKAKIELSSSQQTDVNLPYITGPKHLNIRLTRAKLESLVEDLVERTIEPCKVAIKDAGLKVSEIDDVILVGGQTRMPKVQEAVKNFF-GKEARKDVNPDEAVAIGAAIQGAVLSGE----VKDVLLLDVTPLSLGIETLGGVMTKLIEKNTTIPTKANQVFSTADDNQTAVTVHVLQGEREMASANKSLGRFDLSDIPPAPRGVPQIEVTFDIDANGILHVSAKDKATGKEQSIVIKASS-GLSDEEVEKMVKDAEAHRDSDRKFHELVDARNQADAMIHAAEKSVKD--LGSEVSADEKSAIEKAVNELKEAMKGN---DKDAIEAKTKALTEHSSKLAERVYAKKGGAAGAPPGGEAEGEPQAQAGGKKDAEFEEVKDEKKKDEDK.................................................................................................................................................................................................................................................... 656
10 -144.000IDP02384 gene: hscC; chaperone protein hscC [Bacillus anthracis str. `Ames Ancestor`] GBAA3202 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  35  2....AIIGIDLGTTNSLVATWSEDGATLIPNVLGEFLTPSVVSVDETEILVGRIAKERLITHPQLTAATFKRFIGTEKK---------------------------YELGTYTFSSEELSSFVIKSLKQDAEAYLNEEVTGAVISVPAYFNDTQRKSTKRAAEIAGLTVERLISEPTAAAIAYGLYQE-ESETKFLVFDLGGGTFDVSILELFEGIMDVKSIAGDNYLGGEDFTRSLMTFFLESHQLDPDSL---DSKTLSLIYTQAERCKLTLCNESAATMNVV--IQNQTYETSINRGEFEKIVTPLLLRLRYPIERALRDASLNPNDLDAVILIGGATRMPLVKSVISKMF-GRMPYANINPDETVALGAAIQVALKERNK--ALEEVILTDVCPYSLGTKSESGYFFPIIERNTPIPVSKVERLYTVKDKQQFITIDVYQGENRRVVNNLKLGELKIK-IPPAPAGNESVDIRYTYDINGILEVEVISTSTGEKKRTIIQQNAGNLTDAEIEKRLLELRDIKIHPRDREENRLLLAKCERLY-------------EELLGDERKKISILLQQFESVLTTQNDKKIKEASSILKEHIESMERWANR.................................................................................................................................................................................................................................................................................................. 566
11 -101.000IDP06017 hypothetical protein TGME49_002020 [Toxoplasma gondii ME49] EEB00348 [Toxoplasma gondii ME49]  ali follow..  13  7.GSDMLLGFELGSQMSVVASGTRDGADRAVNKGGRRFIPSSIAYAGKVRLFGEEAEARVNAEPNDTIMELPLWIPVHTVEQAKALETRLAFCPSVQSDGELLFHVDFNNQQLKIPLPVAVGAFVGRLHTAGLHLSGACSTEGVLVVPSSITEKDLMILTAAQGVEKGPSI-MLSRISALINWWCCEKKEKGVVHVALVDVGFSEISVAVIELRTASVKVLGSATAGDIGVLDAVNELAKHLRHHIKERFHEEIRTKTARYWRMSKACMKAIRALCDVNQAAIDLKFILKNSDVRYDITRKHFDKLCAPLQAKLRAFLEETFSKAGVAGTNVVAADVLNSLARSAWIHSTIAEAVHKAGKAAKVRWVEDGGAGAALGAVYWAAD--KKYVDNLVDRNPPYRTDKTDIQKVEQGELERRYLLAHFESYAFEIQQAAM-TVKEGLVRNAEQLKKEIKDAETALGALHQA-----PLEEVKHAYENFRSYLMNSEPRLFEAIENERATRIGQAKGIDPRRTMDIVVSQLGQESNAKLPNAVLLKRAKR---------DTEEASQLLTDGQTDLAVYLANQSLGYLSNDAKTASDADKTAAIELQLHNYLQLAKAQTTEAVEDRAIDYRSTLLTQALDNCNKALAIDSKAAYMSMNDFSRAKADVDAGL-------AIVPGSETGKALSAEITERQHSHTA........................................................................................................................................................................................................... 763
12 -84.900CPX_91702_91677 Complex of EZRI_HUMAN with M1_I34A1 [Undefined organism]  ali follow..  100  654.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK 839
13 -66.700IDP91677 gene: M1; matrix protein 1 [Influenza A virus (A/Puerto Rico/8/34(H1N1))] FLUAVs7gp1 [Influenza A virus (A/Puerto Rico/8/1934(H1N1))]  ali follow..  78  51........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAV-KLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK 252
14 -56.700IDP04193 gene: mreB; rod shape-determining protein MreB [Clostridium perfringens ATCC 13124] CPF_2398 [Clostridium perfringens ATCC 13124]  ali follow..  21  9...TKDMGIDLGTANTLVFV--KGKGIVLRE-------PSVVAITKKSLAVGTEAKQMIGRTPGNIVAIRPLKDG-------------------------------------VIADFDVTQTMLKRFIEKITNKSAFTSPRIIVCFPSGVTEVERRAIEEATKQAGARDVILMEEPMAAAIGAGLPVD--EPTGSMIVDIGGGTTEVAIISLGG-----IVTSKSLRVAGDELDQSIINYIKREFNLMIGERTAEQIKMEIGSAYKVDENEEEQTMDIKGRDLISGLPKVVVVDAGQIRNALKEPVSSIIESIKTTLEKTPPELAADIMD-KGIMLAGGGAFLKGLDELIYKET-GMPVHIAESPLDCVALGTGKALDKFDLIVKQQ................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 340
15 -56.000IDP01152 gene: mbl; mbl protein BA_5520 [Bacillus anthracis str. Ames]  ali follow..  19  3...ARDIGIDLGTANVLIHVKGKG---IVLNE------PSVVAIDRNTGAVGEEARSMVGRTPGNIVAIRPLKDG-------------------------------------VIADFEITEAMLKYFINKLDVKSFFSKPRILICCPTNITSVEQKAIREAAERSGGKTVFLEEEPKVAAVGAGMEIF--QPSGNMVVDIGGGTTDIAVLSMGD-----IVTSSSIKMAGDKFDMEILNYIKRKYKLLIGERTSEDIKIKVGTVFPGARSE-------ELEIRGRDMVTGLPRTITVCSEEITEALKENAAVIVQAAKGVLERTPPELSADRGVILTGGGALLHGIDMLLAEEL-KVPVLIAENPMHCVAVGTGIMLENIDKLPRRALK.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 333
16 -54.900IDP05022 gene: mreB2; rod shape-determining protein MreB [Clostridium difficile 630] CD1145 [Peptoclostridium difficile 630]  ali follow..  21  19...TKDMGIDLGTANTLVYIKGQGIV----------REPSVVAIRDDSKAVGEEAKKMIGRTPGNIVAIRPMKDG-------------------------------------VIADFDITQSMISYFIQKAADKKGVVSPRIAICVPFGVTEVEKRAIEEAARQAGAKDAFLIEEPMAAAIGAGLKVE--EPEGNMVVDIGGGTSEIAVISLGG-----IVTAKSIRIGGDEFDESIVAYVKKEYNLMIGERTAENVKINIGSTFKDDEEI-------NMQIRGRDLISGLPKTIEICSTEVREALKEPVSSIVDAIKSTLERTPPELASENGIMLTGGGALLRGLDKLITQET-GMSVQIAETPLDCVALGTGKSVEDQEI-----FEKVLMMNT....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 351
17 -53.800IDP05051 gene: mreB1; rod shape-determining protein Mbl [Clostridium difficile 630] CD0127 [Peptoclostridium difficile 630]  ali follow..  23  3...GADIGIDLGTANVLVYV--SGKGIVLEE-------PSVVAITDSVLAVGEEAKKMIGRTPGNIVAIRPLRDGVISDYDVTEKMLKSFIDKIVD----------------------------------KKGFGRFFMPRIMVCVPTGVTEVEKRAVEDATRQAGAREVYIIEEPIAAAIGAGVDIS--QPNGNMIIDIGGGTVDIAVISLGGAV-----VSESIKVGGDRFDDAIVKYMKKQHNLLIGERTAEK---IKFEIGSAFKREEEKYMKITGRNLITGLPSSITINSTEMLEALRECVEQIVVATHAVLEKTPPELAADIGDVG-IIMTGGGSLLYGLDKIIEQRT-GITVTIADEPLSCVAKGTGIALGSIDLLET.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 332
18 -52.400IDP01231 gene: mreB; rod shape-determining protein MreB BA_4684 [Bacillus anthracis str. Ames]  ali follow..  21  8...TRDLGIDLGTANTLVYVKGKGVV----------REPSVVALQTDTKAVGSDAKQMIGRTPGNVVALRPMKDG-------------------------------------VIADYETTATMMKYYIQQAQKSNGSRKPYVMVCVPSGITAVERRAVIDATRQAGARDAYPIEEPFAAAIGANLPVW--EPTGSMVVDIGGGTTEVAIISLGG-----IVTSQSVRVAGDDMDDSIIQYIKKSYNLMIGERTAEALKLEIGSAGEPEGIE-------PMEIRGRDLVSGLPKTVLIQPEEIADALKDTVDAIVESVKNTLEKTPPELAADRGIVLTGGGALLRNLDKVISEET-NMPVLVAEDPLDCVAIGTGKALDNIDL..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 333
19 -17.200IDP02098 gene: ftsA; cell division protein FtsA [Francisella tularensis subsp. tularensis SCHU S4] FTT0187 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  15  3FGNINFCAVDLGSHKITVAIGQNNSIKIL----GVSQKQS------------KGIKQGSVINLEIAMETLNAALDEAKSIAGVDVK------EVTLGVSAPSISGFNSYGLAAVENGEVSIEDLAMAIKTAKAVPMSADTEMLHVLQRDYIVDGQAGVTECVSNCGYSISNLVVEHLAASSA--TLTDNEKEMGVCLVNIGADSTSFSV--FADGGICYTSS-----TGGASISSDIS------------KVFRLPIEAAESLKLQYGYAASKYLKNPDEKIDIPNSLGNAK--KRISLQDLSLVIEARVEEIFESLYRELDQHRLLEVISSGIVFTGGGAKLKGLARLAEDMFKSGANEVVHNPSYATVVGLLKYAA......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 379
20 -16.700IDP00714 gene: ftsA; cell division protein FtsA SACOL1198 [Staphylococcus aureus subsp. aureus COL]  ali follow..  14  1MEEHYYVSIDIGSSSTIVGEKFHNGINVI----GTGQTYT------------SGIKNGLIDDFDIARQAIKDTIKKASIASGVDIKE------FLKLPIIGTEVYDESNEIDFYEDTEINGSHIEKVLEGIREKNDVQETEVINVFPIRFIVDKENEVSDCVEACGVDVLDVYSDAYNYG---SILTATEKELGACVIDIGEDVTQVAF--YERGELVDADS-----MAGRDITDDI-------------------AQGLNTSYETAEKVKHQYGHAFYDSASDQDIFTDSDETVQYTQKDLSDFIEARVEEIFFEVFDVLQDLGLTK---GGFIVTGGSANLLGVKELLSDMVSHTPSQMGIKPEFSSAISTISSSI......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 370
21 -16.300IDP02788 gene: ftsA; cell division protein FtsA [Coxiella burnetii RSA 493] CBU_0140 [Coxiella burnetii RSA 493]  ali follow..  18  6.DKNLIVALDIGTSKIAALVGEDNQIEVI----GFGTHPS------------RGLKRGVVVNIESTVQSIQRAIEEAELMAGCDIH------SAYTGIAGSHIRSLNSHGIVAIRDREVNQSDVDRVIDAAKAVAIPADQKILHILPQEFIIDNQEGVRECVRRCGLQVGDIVLEQLASSHA--VLTDDEKELGVCMVDIGGGTTDIAI--FTEGAIRHTHV-----IAGDHVTNDV-------------------AVALRTPTQYAEQIKIKYASVLPEEVNIQVPSVAKRPPKQVQKRALAQVVAARYEELFELVLAELRRSGFEDLIAAGIVLTGGASHIAGCIELAERIFQNGLADVRDNPIYATAVGLLIHGH......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 380

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 8 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.