current user: public

If you have questions about the server, please let us know.

Query: CPX_91720_91682 Complex of TF65_HUMAN with O41974_MHV68 [Undefined organism], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .  840    .  850    .  860    .
# Score Template Links and tools%idFirst MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISSXMPTSPPTTRNTTSGKTRSGCKRRCFNKPAAMPPKRRRAPKRPAPPPPPGCQGDEESSQGTQTPNPPSPPVPPSSPTLPSSPVPPSSPVHEPPSPSPPPAPPSPDVDVEGLDVGETDDPGPPPPKRYSRYQKPHNPSDPLPKKYQGMRRHLQVTAPRLFDPEGHPPTHFKSAVMFSSTHPYTLNKLHKCIQSKHVLSTPVSCLPLVPGTTQQCVTYYLLSFVEDKKQAKKLKRVVLAYCEKYHSSVEGTIVKAKPYFPLPEPPTEPPTDPEQPSTSTQASGTQHGPTASLDAGAEQGATGSPGSSPGQQGQGSQTLast
1 -259.000CPX_91720_91682 Complex of TF65_HUMAN with O41974_MHV68 [Undefined organism]  ali  100  1MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISSXMPTSPPTTRNTTSGKTRSGCKRRCFNKPAAMPPKRRRAPKRPAPPPPPGCQGDEESSQGTQTPNPPSPPVPPSSPTLPSSPVPPSSPVHEPPSPSPPPAPPSPDVDVEGLDVGETDDPGPPPPKRYSRYQKPHNPSDPLPKKYQGMRRHLQVTAPRLFDPEGHPPTHFKSAVMFSSTHPYTLNKLHKCIQSKHVLSTPVSCLPLVPGTTQQCVTYYLLSFVEDKKQAKKLKRVVLAYCEKYHSSVEGTIVKAKPYFPLPEPPTEPPTDPEQPSTSTQASGTQHGPTASLDAGAEQGATGSPGSSPGQQGQGSQT 866
2 -107.000IDP91720 gene: RELA; transcription factor p65 isoform 1 [Homo sapiens] NP_068810 [Homo sapiens]  ali follow..  100  1MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS........................................................................................................................................................................................................................................................................................................................... 551
3 -20.500IDP91521 C2 domain-containing protein [Toxoplasma gondii ME49] TGME49_040910 [Toxoplasma gondii ME49]  ali follow..  1348............................................................................................................................................................................................................................................................AVPRVKKRSYDQVEGTEVAAIAIERDFFTEAEA---LGLSPGRVRAFQARYAEKRIVFAVGPPMDDATEADAVSSVALMEKLRDILPSMAHEEGRFQEVTGGGATLQWDGPGTNILDRIAQEQATAGEGEQQTSEGIPTRDMQVDGTAVLEEAGEKSDKKKKKKEKKEKKEKKEKKEKKEKKEKKKKKGGETAAEPEEASAVLAPPPVPVPAAAIPSVLLPADSEDGEKEQPKEKKKEKKEKKKKKDGETDAEPEEASAVLAPPPVPVPAAAIPSILLPTDGEDGEKEKTKEKKTEKKKEKHTEKKHKKKSEALPESETTAVVTVTPGEEDETSPLVPVPSSIASSEAPEPPASTRVTPAPEPKAKPGLSMGAALLAVRARSRLQRKHLAQQLSSSSSSEVSASSASSLSPSSSSSSDFAETRAKADALRARLQAAQARLAAARETEVSSSETESSETSEASFLSSDGEWDALWQSQRAAAMERQQRLQKMVSGVKAAYR--RLEEENTRLAATRRRDDKLQRQVEAERERAVELLKEATRRAKEEKDLIARQP--PPARDWSDPQIFVNSQAACAPFADSGRDEGGRAESSNESRTTAGAKLRQQQLDLAGRT 1990
4 -18.400IDP91682 gene: ORF73; nuclear antigen LANA [Murid herpesvirus 4] MuHV4gp74 [Murid herpesvirus 4]  ali follow..  69  4..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SPPTTRNTTSGKTRSGCKRRCFNKPAAMPPKRRRAPKRPAPPPPPGCQGDEESSQGTQTPNPPSPPVPPSSPTLPSSPVPPSSPVHEPPSPSPPPAPPSPDVDVEGLDVGETDDPGPPPPKRY-SRYQKPHNPSDPLPKKYQGMRRHLQVTAPRLFDPEGHPPTHFKSAVMFSSTHPYTLNKLHKCIQSKHVLSTPVSCLPLVPGTTQQCVTYYLLSFVEDKKQAKKLKRVVLAYCEKYHSSVEGTIVKAKPYFPLPEPPTEPPTDPEQPSTSTQASGTQHGPTASLDAGAEQGATGSPGSSPGQQGQGSQT 314
5 -10.700IDP91949 pneumococcal histidine triad protein E [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007099 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  774............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TRTAGNKIPVTFMANAYLDNQSTYIVEVPILEKENQTDKPSILPQFKRNKAQENSKLDEKVEEPKTSEKVEKEKLSETGNSTSNSTLEEVPTVDPVQEKVAKFAESYGMKLENVLFNMDGTIELYLPSGEVIK-----------------KNMADFTGEAPQGNGENKPSENGKVSTGTVENQPTENKPADSLPEAPNEKPVKPENSTDNGMLNPEGNVGSDPMLDPALEEAPAVDPVQEKLEKFT 1002
6 -9.580IDP90350 hypothetical protein CT456 [Chlamydia trachomatis D/UW-3/CX] CT456 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  2.................................................................................................................................................................................................................................................................................................................................................................................TNSISGYQPTVTTSTSSTTSASGASGSLGASSVSTTANATVTQTANATNSAATSSIQTTGETVVNYTNSASAPNVTVSTSSSSTQATATSNKTSQAVAGKITSPDTSESSETSSTSSSDHIPSDYDDVGSNSGDISNNYDDVGSNNGDISSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSDGAAAAALNSLRGSSYTTGPRNEGVFGPGPEGLPDMSSYDPTNKTSLLTFLSNPHVKSKMLEN-HFVFIDTDRSSFILVPNGNWDQVCSIKVQNGKTK--DLDIKDLENMCAKFCTGFFSGDWDSLVEPMVS----AKAGVA-NTVIINNKAYGPWNSQEASSGYTPSAWRRGHRVFGGIFE-----KANDFNKINWGTQAGPSSEDDGIS. 503
7 -9.000CPX_91702_91677 Complex of EZRI_HUMAN with M1_I34A1 [Undefined organism]  ali follow..  10  36...................TIGLREV---WYFGLHYVDNKGFPTWLKLDKKVSAQKFYPE-DITQKLFFLQVKEGILSDEIYCPPETAVLLGSQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLELKIAQ-------------DLEMYGINYFEIKNKKGT---DLWL--------DALG----LNIYEKDDKLTPKIGF---PWSEIRNIS----FNDKKFVIKPDKKAP-------DFVFYAPRLRINKR-GNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEALXMSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERG----------------------------------------LQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRS------HRQMVTTTNPLIR-------------------HENRMVLASTTA---KAMEQAGSEQAATGTPSSSAGQKRMGVQ. 834
8 -8.940IDP92013 adenosine monophosphate deaminase, putative [Toxoplasma gondii ME49] TGME49_034280 [Toxoplasma gondii ME49]  ali follow..  13  699.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TVSPPDSAEGTEKDGEKKARLGLRSPKTGSDSESPGTDAAMKKLLEVAEESAVMDLGEIPGGVSSPMPRSESFEVLDGPSREALQ-TLDAYTHLEAREENVDMGVLKVALTSQRSPALTLRRASM--RSGAGLLQLLTSPQQLSHASSVIVGEY-------ANSTEGDEERRGDSEGDDAKRSET 910
9 -8.940IDP92581 splicing factor 3a protein, putative [Toxoplasma gondii ME49] TGME49_021940 [Toxoplasma gondii ME49]  ali follow..  17 1208.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ASPRFVCASSMCTVELNPNVNPLLARITVRAAHPRVSLYLSRLLSSSSLVQASPEFALQSGSSPNPAPPLSRGAG---GTRASVNLSTAQVAGGPPGSPTGLTPQNRMT 1347
10 -7.720IDP91542 3`,5`-cyclic phosphodiesterase, putative [Toxoplasma gondii ME49] TGME49_080410 [Toxoplasma gondii ME49]  ali follow..  29  2.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................AAESSPSG--IESAGLAARDESPTRSSTDPDQPSESPRASASSSGVASKAGEGLHEATPPQDGALPAASGHGAET 102

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 8 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.