current user: public

If you have questions about the server, please let us know.

Query: IDP00108 gene: fdhE; FdhE protein NT01SF4751 [Shigella flexneri 2a str. 2457T], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .
# Score Template Links and tools%idFirst MSIRIIPQDELGSSEKRTADMIPPLLFPRLKNLYNRRAERLRELAENNPLGDYLRFAALIAHAQKVVLYDHPLEMDLTARIKEASAQGKPPLDIHVLPRDKHWQKLLMALIAELKPEMSGPALAVIENLEKASTQELEDMASALFASDFSSVSSDKAPFIWAALSLYWAQMANLIPGKARAEYGEQRQYCPVCGSMPVSSMVQIGTTQGLRYLHCNLCETEWHVVRVKCSNCEQSGKLHYWSLDDEQAAIKAESCDDCGTYLKILYQEKEPKVEAVADDLASLVLDARMEQEGYARSSINPFLFPGEGELast
1 -92.400IDP00108 gene: fdhE; FdhE protein NT01SF4751 [Shigella flexneri 2a str. 2457T]  ali  100  1MSIRIIPQDELGSSEKRTADMIPPLLFPRLKNLYNRRAERLRELAENNPLGDYLRFAALIAHAQKVVLYDHPLEMDLTARIKEASAQGKPPLDIHVLPRDKHWQKLLMALIAELKPEMSGPALAVIENLEKASTQELEDMASALFASDFSSVSSDKAPFIWAALSLYWAQMANLIPGKARAEYGEQRQYCPVCGSMPVSSMVQIGTTQGLRYLHCNLCETEWHVVRVKCSNCEQSGKLHYWSLDDEQAAIKAESCDDCGTYLKILYQEKEPKVEAVADDLASLVLDARMEQEGYARSSINPFLFPGEGE 309
2 -12.800IDP92084 DNA-directed RNA polymerase III subunit, putative [Toxoplasma gondii ME49] TGME49_112250 [Toxoplasma gondii ME49]  ali follow..  13  4............................................................................................................................................................................................FCPTCHN------MLLVRQEVTMQFHCRTCPYVFNIKPASCPKCSHTEAYEIQIRSADEPMTAFYCCCNCRFRWR.............................................. 104
3 -11.700IDP93836 cytochrome c-type protein NrfB [Yersinia enterocolitica subsp. palearctica Y11] YP_006003980 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  15  80.............................................................................................................................................................................................CTNCHGKAAILHRNGIKDVSQQNSVCMSCHQP-HMLKLSCVSCHQLHPKTDPMHGLDDKGRV-RICVDCHR................................................. 177
4 -11.600IDP90108 bifunctional zinc finger-like protein/E3 ubiquitin ligase [Monkeypox virus] MPXV_ZAI1979_005_013 [Monkeypox virus]  ali follow..  23  173.............................................................................................................................................................................................CGIC-----YEVVYSKRLENDRHIFCITCINIWHRTR-NCPICRTR.......................................................................... 228
5 -11.300IDP90176 gene: CPXV023 CDS; CPXV023 protein AAM13470.1 [Cowpox virus (Brighton Red)]  ali follow..  28  173.............................................................................................................................................................................................CGIC-----YEVVYSKRLENDRYFSCN-CINIWHRTR-NCPICRTR.......................................................................... 228
6 -10.800IDP04528 gene: napH; quinol dehydrogenase membrane component [Salmonella typhimurium LT2] STM2257_1_289 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  13  114......................................................................................................VTDLANWMRRKFDLNQSATIPRHIRYVLLVVVLIGSALTGTLLWEWINPVSLLGRSLIMGFSSGALLIIALFLFDLLVVEHGWCGHICPM-GVLGSKGVVTVTAKKREKCNRCMDCFH-------VCPE--PHVLRAPVLDEQSPAQVTHRDCMTCGRCVDVCSEDVFT...................................... 276
7 -10.600IDP06453 gene: F4L; F4L [Monkeypox virus Zaire-96-I-16] NP_536480 [Monkeypox virus Zaire-96-I-16]  ali follow..  10  1.................................................................................................................MENVYISSYSSNEQISMAVVTTDIRELLSQYVD------DANLENLIEWAMEKSSKYYIKNIGNTKSNIEETKFESKNNIG-----IEYSKDSRNKLSYRNKPSIATNLEYKTLPCPNCKSRNTTMIQTRAADEPPLVRHACRDCKQHFK.............................................. 195
8 -10.200IDP91808 gene: CTCF; CTCF [Homo sapiens] AAB07788 [Homo sapiens]  ali follow..  14  278...........................................................................................................................................................................RSNLDRHMKSHTDERPHKCHLCGRTVTLLRNHLNTHTGTRPHKCPDCDMAFRHRRYKCSMCDYAEVSKLKRHIRSHTGERPFQCSLCSYASRDTYK-------------LKRHMRTHSGEKPYE.............. 408
9 -9.990IDP02074 gene: hybA; hydrogenase 2 protein HybA [Salmonella typhimurium LT2] STM3149 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  114............................................................................................................................................................................................HCPNCVSVCPVSALKKDPKTGIVHYDKDVC--------TGCRYCMVACPYNVPKYDYNNPFGALHKCELCNQ--KGVERLDKGGLPGCVEVCPAGAVIFGTREE................. 209
10 -9.970IDP91676 DNJA3_HUMAN [Homo sapiens]  ali follow..  11  85............................TSAPLAKEDYYQILGVPRNASQKEIKKAYYQLA---KKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSAGFDPGASGSQHSYWKGGPTVDPEELFRKIFGEFSSSSFGDFQTVFDQPQEYFMELTFNQAAKGVNKEFTVNIMDT-------CERCNG--------KGNEPGTKVQHCHYCGGSGMETRSTCRRCGGRGSI--------------SPCVVCRGAGQAKQKKRVMPVPAGVEDGQTVRMEIVQKSPVFRRDGADIH....... 347
11 -9.670IDP06294 competence protein ComF [Streptococcus pneumoniae TIGR4] NP_346618 [Streptococcus pneumoniae TIGR4]  ali follow..  13  3.............................................................................................................................................................................................CLLCGQTTVLTFSSLLLLRNDDSCLCSDCDSTFEIGEENCPNCMKTELSTK--------------CQDCKDFFSRYKFDGDFLLRKVFASFVVIPLS--YANRGFNQVE........... 136
12 -9.660IDP01308 iron-sulfur cluster-binding protein VC1516 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  423.............................................................................................................................................................................................CMSCVAVCPTRALHLAGDSPALRFICGLCVKACPEQVLSCLRCHKP--RGHSHFATPEALNRIAMCEDCRDMFEAMAHDPEQQLK................................... 552
13 -9.480IDP05619 hypothetical protein CD0664B [Clostridium difficile 630] CD0664B [Peptoclostridium difficile 630]  ali follow..  15  4..............................................................................................................................................................................................SRCG------------------VCCDSCTK---KEQVNCTGCPTMEKPFWG-VKTCCESKELNHCGECDTFLLNKGKDQGFDPMVNIEQCRKW------LEETVSN............. 89
14 -9.050IDP00478 gene: dnaJ; chaperone protein DnaJ YPO0469 [Yersinia pestis CO92]  ali follow..  11  12...........................................VSRDAEEREIKKAYKRLA---MKFHPDRQSEDKNAEEKFKEAKEAYEILTDAQKRAAYDQYGH-----AAFEQGGMGGGGFGGGGGGADFSDIFGDVFGDIFGGGRRQQRASRGSDLRYNMDLTLEEAVRGVTKEIRIP---TLDECDVCHG--------SGAKPGSSPVTCPTCHGAGQVQMRQCPHCHGRGQI--------------DPCNKCHGHGRVEKSKTLSKIPAGVDTGDRIRLDLVKAHPIFEREGNNLY....... 267

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.