current user: public

If you have questions about the server, please let us know.

Query: IDP00266 gene: N/A; Premembrane/Membrane protein (prM) AAX48017_114-279 [Dengue virus 4], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst FHLSTRDGEPLMIVARHERGRPLLFKTTEGINKCTLIAMDLGEMCEDTVTYECPLLVNTEPEDIDCWCNLTSAWVMYGTCTQSGERRREKRSVALTPHSGMGLETRAETWMSSEGAWKHAQRVESWILRNPGFALLAGFMAYMIGQTGIQRTVFFVLMMLVAPSYGLast
1 -101.000IDP00266 gene: N/A; Premembrane/Membrane protein (prM) AAX48017_114-279 [Dengue virus 4]  ali  100  1FHLSTRDGEPLMIVARHERGRPLLFKTTEGINKCTLIAMDLGEMCEDTVTYECPLLVNTEPEDIDCWCNLTSAWVMYGTCTQSGERRREKRSVALTPHSGMGLETRAETWMSSEGAWKHAQRVESWILRNPGFALLAGFMAYMIGQTGIQRTVFFVLMMLVAPSYG 166
2 -101.000IDP00276 gene: N/A; Premembrane/Membrane protein (prM) AAA99437_115-280 [Dengue virus 3]  ali follow..  66  1FHLTSRDGEPRMIVGKNERGKSLLFKTASGINMCTLIAMDLGEMCDDTVTYKCPHITEVEPEDIDCWCNLTSTWVTYGTCNQAGEHRRDKRSVALAPHVGMGLDTRTQTWMSAEGAWRQVEKVETWALRHPGFTILALFLAHYIGTSLTQKVVIFILLMLVTPSMT 166
3 -99.600IDP00271 gene: N/A; Premembrane/Membrane protein (prM) AF180817_115-280 [Dengue virus 1]  ali follow..  64  1FHLTTRGGEPHMIVSKQERGKSLLFKTSAGVNMCTLIAMDLGELCEDTMTYKCPRITEAEPDDVDCWCNATDTWVTYGTCSQTGEHRRDKRSVALAPHVGLGLETRAETWMSSEGAWKQIQKVETWALRHPGFTVIALFLAHAIGTSITQKGIIFILLMLVTPSMA 166
4 -39.500IDP91056 viral polyprotein [Dengue virus 2] AAA42941 [Dengue virus 2]  ali follow..  69  115FHLTTRNGEPHMIVSRQEKGKSLLFKTEDGVNMCTLMAMDLGELCEDTITYKCPFLKQNEPEDIDCWCNSTSTWVTYGTCTTTGEHRREKRSVALVPHVGMGLETRTETWMSSEGAWKHAQRIETWILRHPGFTIMAAILAYTIGTTHFQRALIFILLTAVAPSMT 280
5 -7.320IDP00970 gene: tpx; thiol peroxidase STM1682 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  28FTLVAKDLSDVSLSQYAGKRKVLNIFPSIDTGVCAASVRKFNQLATEVENTVVLCVSADLPFAQSRFCGAEGLSNVITLSTLRNNEFLKNYGVEIVDGPLKGLAARAVIVLDENDNVIFSQLVDE......................................... 152
6 -7.230IDP01345 gene: tpx; tagD protein VC0824 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  26FTLCGADLNDLSNEDFKGKKIVMSIFPSIDTPVCSKSVKVLQNALMTRNDTVLLCVSADLPFAMSRFCTEHAVANVTNASFFREPAFTERFGVNLNEGALRGLAARAVIVADEFGVITHSELVNE-ITNEPDYDRILMSL.......................... 164
7 -7.180IDP91193 Stage III sporulation protein AF BAS4092 [Bacillus anthracis str. Sterne]  ali follow..  23  1.......................................................................................................................MQFVTEWIRNIIVFLLLATMLHLILPNSNLQKYVLLLVVLILTPLFK 52
8 -6.100IDP04597 resB protein [Bacillus anthracis str. Sterne] BAS1384 [Bacillus anthracis str. Sterne]  ali follow..  19  3.............................................................KEIKCECGHVN---PIGTCEACGKPFESNENIKLLDMRYEGSARRSLTQTKTDKIWSFFSSVKVGV-----WLIVITLAASAIGTIFPQE............... 88
9 -6.010IDP04289 gene: yscY; hypothetical protein YPCD1.35c [Yersinia pestis CO92] YPCD1.35c [Yersinia pestis CO92]  ali follow..  6...........................................................TKRQQEFLLLNGWLQLQCGHAERACIL---DALLTLNPEHLAGRRCRLVALLNNNQGERAEKEAQWLISHDPLQAGNWLCLSRAQ-GDLDKARHAYQHYLELKDHNE 112
10 -5.960IDP90409 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_667 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  5.........................................................DVFKEDFALLFEAGMVAIKQGDEASAKAL---QALQVLDPEHTAHELGSGLLHLHKMELTKAEVLFRAIVEKDPENWSAKAFLSLTLMMIVLQQ............... 96

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.