current user: public

If you have questions about the server, please let us know.

Query: IDP00447 gene: yopJ; targeted effector protein YPCD1.71c [Yersinia pestis CO92], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MIGPISQINISGGLSEKETSSLISNEELKNIITQLETDISDGSWFHKNYSRMDVEVMPALVIQANNKYPEMNLNLVTSPLDLSIEIKNVIENGVRSSRFIINMGEGGIHFSVIDYKHINGKTSLILFEPANFNSMGPAMLAIRTKTAIERYQLPDCHFSMVEMDIQRSSSECGIFSFALAKKLYIERDSLLKIHEDNIKGILSDGKNPLPHDKLDPYLPVTFYKHTQGKKRLNEYLNTNPQGVGTVVNKKNETIVNRFDNNKSIVDGKELSVSVHKKRIAEYKTLLKVLast
1 -113.000IDP00447 gene: yopJ; targeted effector protein YPCD1.71c [Yersinia pestis CO92]  ali  100  1MIGPISQINISGGLSEKETSSLISNEELKNIITQLETDISDGSWFHKNYSRMDVEVMPALVIQANNKYPEMNLNLVTSPLDLSIEIKNVIENGVRSSRFIINMGEGGIHFSVIDYKHINGKTSLILFEPANFNSMGPAMLAIRTKTAIERYQLPDCHFSMVEMDIQRSSSECGIFSFALAKKLYIERDSLLKIHEDNIKGILSDGKNPLPHDKLDPYLPVTFYKHTQGKKRLNEYLNTNPQGVGTVVNKKNETIVNRFDNNKSIVDGKELSVSVHKKRIAEYKTLLKV 288
2 -89.400IDP91474 putative targeted effector protein YopP [Vibrio parahaemolyticus RIMD 2210633] VPA1346 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  32  3.......VNLEQNHYYEQRGGSDLREQLSSYIDLMDDAIRQGKQPKDTAAANDIALMDDFIAIANQKKEGLNAHFFRSPLDMVNYVKSLIPSEDTTARFVVNMGSGGIHCIAVDCAIKNGKCSLIGIDPVTMNSLGASMLAIRLQSVCKRE--PETSLVIMETDMQRSQGECLMFSLFLVKKMHKECDEFQSLHDKNINRELPTQGLLVSVKDADSLLPPSLMKHTQSPNRLQKYLETRPEAMNCVVNKKGDTLKTRQQRHITTIETVSYSNSIEQKRIKEAKGLLN. 287
3 -19.100IDP90101 gene: sseL; deubiquitinase [Salmonella typhimurium LT2] STM2287 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  93YMAGSATTDLSKKIGIAHKIMGDQFAQTDQEQVGVENLWCGARMLSSDELAAATQGLVQESPLLSVNYPIGLIHPTTKENILSTQLLEKIAQSGLSHNEVFLVN-TGDHWLLCLFYKLAEKIKCLIFNTYYDLNENTKQEIIEAAKIAGISESDEV-NFIEMNLQNNVPNGCGLFCYHTIQLLSNAGQ.................................................................................................... 278
4 -17.600IDP06461 gene: I7L; I7L [Monkeypox virus Zaire-96-I-16] NP_536495 [Monkeypox virus Zaire-96-I-16]  ali follow..  230.................................................................................................RFVMFGFCYLSHWKCVIYDKKQC--LVSFYDSGGNIPTEFHHYNNFYFYSFSDGFNTNHRGCINVEVNQLLESECGMFISLFMILCTRTPPKSFKSLKKVYTFFK--------------------FLADKKMTLFKSILFNLQDLSLYITETDNAGLKEYKRMEKWTKKSNVICDKLTTKLNRIVDD.... 421
5 -4.960IDP01783 gene: arsC1; arsenate reductase [Francisella tularensis subsp. tularensis SCHU S4] FTT0824 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  10  9..........................................................................................................................................................................NCT--SVRNTLKFFEEKDKKVEYVN--------------------------LRQEKPTWQEMQKIKQIGHFETIDLFNSNGKLFAEMGLKDRFDSLSEEEAFKLLVTDALLFKRPL.. 96
6 -4.810IDP00841 arsenate reductase, putative SACOL0876 [Staphylococcus aureus subsp. aureus COL]  ali follow..  12  9..........................................................................................................................................................................NCT--TCKKAAKFLDEYGVSYEPID--------------------------IVQHTPTINEFKTIIANTGVEINKLFNTHGAKYRELDLKNKLQTLSDDEKLELLSSDGMLVKRPL.. 96
7 -4.770IDP05008 putative arsenate reductase [Clostridium difficile 630] CD1777 [Peptoclostridium difficile 630]  ali follow..  31............................................................................................................................................................................................................................DMVQNPPSKEELKSIYKTSGYDIKKFFNTSGMKYRELGLKDIVKTESDDKLLEILVSDGMLIKRPL.. 96
8 -4.440IDP06485 gene: A23R; A23R [Monkeypox virus Zaire-96-I-16] NP_536560 [Monkeypox virus Zaire-96-I-16]  ali follow..  10  3............................................................................TSTSSSQSLIPLPMSKKDYSSEIICAFDIGAKNPARTVLEVKDNSVRVLDISKLDWSSDWERRIAQDLSQ--------EYTTVLLERQPRRSPYVKFIYFIKGFLYHTSAAKVICVSPVMSGNSYRDRKK--------------------RSVEAFLDWMDTFGLRDSVPDRRKLDDVADSF-RYVLDKWNTNYTPYNRCKYRNYIKKM... 187
9 -4.430IDP02487 gene: metE; 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [Bacillus anthracis str. `Ames Ancestor`] GBAA4218 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  156ILGPYTFLKLAKGYTQEQ-----FATILKQLVAPYVQLLSELHAAGAQIIQVDEPIFASLTKEEVQQAKEIYEAIRKEVPNATLLLQTYFDSVEENYEEIITFPVSS-----IGLDFVHGKEGNLCIDGRNIWRADLDEVLTLFTTLQKQVQTKDLIV----------QPSCS---LLHTPIDKTEETHLSTELFDALAFANQKLEELVLIHSALTQGTESISNELETYRNVHHTIRSSAARNREDVKAARTALKEEDFSRPLPFEKRYELQQVALKQTTEVRQTRK. 449
10 -4.310IDP95356 hypothetical protein NWMN_0759 [Staphylococcus aureus subsp. aureus str. Newman] YP_001331793 [Staphylococcus aureus subsp. aureus str. Newman]  ali follow..  13  108..................................................................................................................................................................................................................................EAQSLVENYKDTQSADARMKAKQKVNTLSKPHQNYFNKQIDKVYN................. 152

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.