current user: public

If you have questions about the server, please let us know.

Query: IDP00478 gene: dnaJ; chaperone protein DnaJ YPO0469 [Yersinia pestis CO92], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .
# Score Template Links and tools%idFirst MAKRDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSEDKNAEEKFKEAKEAYEILTDAQKRAAYDQYGHAAFEQGGMGGGGFGGGGGGADFSDIFGDVFGDIFGGGRRQQRASRGSDLRYNMDLTLEEAVRGVTKEIRIPTLDECDVCHGSGAKPGSSPVTCPTCHGAGQVQMRQGFFTVQQACPHCHGRGQIIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLSGEGEAGEHGAPSGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDGRVKLKIPAETQTGKMFRMRGKGVKSVRGGSQGDLLCRVVVETPVSLSEKQKQLLRELEESFVGAAGEKNSPRAKSFLDGVKKFFDDLTRLast
1 -131.000IDP00478 gene: dnaJ; chaperone protein DnaJ YPO0469 [Yersinia pestis CO92]  ali  100  1MAKRDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSEDKNAEEKFKEAKEAYEILTDAQKRAAYDQYGHAAFEQGGMGGGGFGGGGGGADFSDIFGDVFGDIFGGGRRQQRASRGSDLRYNMDLTLEEAVRGVTKEIRIPTLDECDVCHGSGAKPGSSPVTCPTCHGAGQVQMRQGFFTVQQACPHCHGRGQIIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLSGEGEAGEHGAPSGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDGRVKLKIPAETQTGKMFRMRGKGVKSVRGGSQGDLLCRVVVETPVSLSEKQKQLLRELEESFVGAAGEKNSPRAKSFLDGVKKFFDDLTR 379
2 -129.000IDP01404 dnaJ protein VC0856 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  75  1MSKRDFYEVLGVGRDASERDIKKAYKRLAMKYHPDRNSGDAGAAEKFKEVKEAYEILTDAQKKAAYDQYGHAAFEQGAGGFGGGGFGGGGADFGDIFGDVFGDIFGGRGGGPRAQRGSDLRYNMELSLEEAVRGCSKEIEVPTLVHCDACDGSGAKKGTSAQTCGTCHGHGQVQMRQGFFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQKTKTLNVKIPAGVDTGDRIRLSGEGEAGEMGAPAGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDGRVSLKVPAETQTGRMFRMRGKGVKGVRSAALGDLIVKLVVETPVNLSARQKELLKEFEESCGGEAATKHKPKAEGFFNGVKKFFDDLTS 381
3 -124.000IDP01653 gene: dnaJ; chaperone protein dnaJ [Bacillus anthracis str. `Ames Ancestor`] GBAA4538 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  52  1MSKRDYYEVLGLSKGASKDEIKKAYRRLAKKYHPDVSK-EENAIEKFKEVQEAYEVLSDDQKRAQYDQFGHAGANQGFGGFGGGGDFGGGFGFEDIFSSFFGGGGGRRRDPNAPRQGADLQYQVTLEFEEAIFGKELNVEIPVEDPCDTCKGSGAKPGTSKETCKHCSGSGQVSVEQGRIVNRQACSHCSGTGQMIKEKCTTCHGSGKVRKRKKINVKIPAGIDNGQQIRVSGKGEAGVNGGPAGDLYVVVHVRSHEFFEREGDHIICEMPLTFAQMALGAEVEVPTVHGKVKLKIPAGTQTGTEFRLKGKGAPNVRGYGQGDQYVVVRVVVPTKLTSHQKDLLREFAGQEEQ---------DDSLFGKLKRAFKG... 370
4 -119.000IDP02168 gene: dnaJ; chaperone protein dnaJ [Coxiella burnetii RSA 493] CBU_1289 [Coxiella burnetii RSA 493]  ali follow..  61  1MAKRDYYEVLGVNLNATEAEVKKAFRRLAMKYHPDRNPGDKDAEVKFKEAREAYEVLCDSRKRASYDQFGHAGVEQTFGGAGA--GGFGFGDLGDIFGDIFGDIFGGRGGQAREQRGADLAYELVLSLEEAVHGLSRTIKVPTWINCKTCNGSGA-KGSSPATCPRCNGSGQMRMQHGFLQVQQTCSVCRGRGQVIKDPCTDCHGQGRQQQTKTLSVKIPPGIDTGDRIRLAGEGEAGLFGAPPGDLYVQVRVKPHPLFHREGNDLHSEVPIDFTTAALGGEMEIPTLDGSVRLTIPPETQGGKQFRLRGKGVKALRSGAVGDLICHIVVETPVKLSPEQKDYLKQFAELLKKDEKNH-SPRTRNWFDSVKDFFTS... 373
5 -102.000IDP91676 DNJA3_HUMAN [Homo sapiens]  ali follow..  33  89LAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSAGFDPGASGSQHSYKGGPTVDPEELFRKIFGEFSSSSFGDFQTVFDQPQEYFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGGRGSIIISPCVVCRGAGQAKQKKRVMIPVPAGVEDGQTVRMPVGK---------REIFITFRVQKSPVFRRDGADIHSDLFISIAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQQSLILSYAEDETDVEGTEAGEDEEGFLSKLKKMFTS... 480
6 -92.200IDP01609 gene: dnaJ1; heat shock protein, hsp40 [Francisella tularensis subsp. tularensis SCHU S4] FTT1512c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  33  2...ADYYSLLGVSRDASEADIKKAYRRLAKKYHPDVNK-EKGAEDKFKEIQTAYDVLGDKEKKKLYDTYGENWDKVQQGGQSGRSQSFNFEDLGDIFGDLFGGGAGARGGQPRARKGEDINISLRLNVEDAIKGGSRTVSYN---------------------YQKVGANGMPT-----------------------------------MQHQSVDVKIPPAMGNGKKLRVKGKGGAGIANAPAGDLYIKIEVVDHKNYKVDGNDIYEHINIAPWEAALGTSLEIDTPYGKKKMKVPEGSQSGRKMRIKGKGLG------DGDFYIVYDVKLPLADTDEKKEFYKQMQEKMNFNPRA...................... 308
7 -21.800IDP06072 hypothetical protein jhp0418 [Helicobacter pylori J99] NP_223136 [Helicobacter pylori J99]  ali follow..  10  189MSLEEAKNLFEIQTHTTMQDLEKKALDLSAPYYHKMNDNKEQDFISLKKIALASQLLENDLKDS........................................................................................................................................................................................................................................................................................................................... 255
8 -15.700IDP01304 gene: hscB; co-chaperone HscB VC0751 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  24  2....NYFELFGLPIELDGSLLSSQFRALQKRFHPDNFATASERDRLMAVINDAYQTLKDPLRRAEY......................................................................................................................................................................................................................................................................................................................... 70
9 -12.000IDP93836 cytochrome c-type protein NrfB [Yersinia enterocolitica subsp. palearctica Y11] YP_006003980 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  16  63.................................................................................................................................HGKHAGAINPNTQLAVTCTNCHGKAASVSQQNSVCMSCHQPEKLREAHDVHMLKLSCVSCHQDDKGRVRICVDCHRR----QQELIPKDAP............................................................................................................................................................... 188
10 -9.040IDP00108 gene: fdhE; FdhE protein NT01SF4751 [Shigella flexneri 2a str. 2457T]  ali follow..  11  44...........LAENNPLGDYLRFAALIAKVVLYDHPLEMDLTARIKEASAQGKPPLDIHVLPRDKHWQKLAELKPEMSGPALAVIENLEKASTQELEDMASALFASDFSSVSSDKAPFIWAALSLYWAQMANLIPGKARAEQRQYCPVCGSIGTTQGLRYLHCNLCETEWHVVRVK--------CSNCEQSGKL--ESCDDCGTYLKILYQEKEP-KVEAVADDLASLVL--------------DA-----RMEQEGYARSSINPF................................................................................................................ 302

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.