current user: public

If you have questions about the server, please let us know.

Query: IDP00530 gene: ccmC; putative heme exporter protein C YPO2736 [Yersinia pestis CO92], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MWKWFHQFAKPERLYPLCGRLIPWFGGGAIICLAVGWVWGLGFAPSDYQQGDSFRIMYLHVPAAIWSMGIYMSMAIAAFVGLVWQIKMADNLVAAMAPVGAVLTFIALVTGSAWGKPMWGTWWIWDARLTSELVLLFLYLGVIALYNAFDDRKLAGRAAGILVLVGVVNLPIIHFSVVWWNTLHQGSTNMQQSIDPSMRSPLRWAILGFLLCFITLTLMRLRNLILQQERHRPWVTALLRKEPRVLast
1 -101.000IDP00530 gene: ccmC; putative heme exporter protein C YPO2736 [Yersinia pestis CO92]  ali  100  1MWKWFHQFAKPERLYPLCGRLIPWFGGGAIICLAVGWVWGLGFAPSDYQQGDSFRIMYLHVPAAIWSMGIYMSMAIAAFVGLVWQIKMADNLVAAMAPVGAVLTFIALVTGSAWGKPMWGTWWIWDARLTSELVLLFLYLGVIALYNAFDDRKLAGRAAGILVLVGVVNLPIIHFSVVWWNTLHQGSTNMQQSIDPSMRSPLRWAILGFLLCFITLTLMRLRNLILQQERHRPWVTALLRKEPRV 245
2 -10.600IDP06321 ABC transporter permease [Streptococcus pneumoniae TIGR4] NP_345398 [Streptococcus pneumoniae TIGR4]  ali follow..  12  1MFRLTNKLA--SNLIKNRKLYYPFALAVLLAVTITYLFYSLTFNPKIAEIRGGTTI--LGFGMFVVTLASAIIVLYANSFVMKNRSKELGIYGMLGLEFGILTVGAGIGIGALFDKVELVATFQMNVVIAVLVVFGLIFLNALQLSREKASGEKRGRFLPLQTILGSISLGIGYYLA---------TVTDPLTALTTFFLAVLLVIFGTYLLFNAGITVFLQILKKNKK................ 261
3 -10.600IDP95369 set238a-013 [Vibrio cholerae]  ali follow..  14  803...........KDALKTFAKSIALVATVGMIASALETWESWGKFNDSSKTDLERFGYLLKAGATGAQGIIFYIQFFTLLGSGIGGPSIAAISAGWMLAGFAVIGIVYLIGVILWSKSTWGK--HWPVGKELTELEHLLHRPSLRLSQVTQRKAAQWMDSGSLQWQLELTLP.......................................................................... 975
4 -9.980IDP95307 hypothetical protein VCA0020 [Vibrio cholerae O1 biovar El Tor str. N16961] NP_232421 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  800........LGTKDALKTFAKSIALVATVGMIASALETWESWGKFNDSSKTDLERFGYLLKAGATGAQGIIFYIQFFTLLGSGIGGPSIAAISAGWMLAGFAVIGIVYLIGVILWSKSTWGK--HWPVGKELTELEHLLHRPSLRLSQVTQRKAAQWMDSGSLQWQLELTLP.......................................................................... 975
5 -9.780IDP95379 set238a-016 [Vibrio cholerae]  ali follow..  13  800........LGTKDALKTFAKSIALVATVGMIASGLEAWESWGKFNDSSKTDLERFGYLLKAGTMVTQLIVFAGQLIARKLSLMGIVSIGAINAGWMVASFAVIGIVYLIGVILWSKSTWGK--HWAVGQELTELERLLHRPSLRLSQVTQRKAAQWMDSGSLQWQLELTLP.......................................................................... 975
6 -8.350IDP95378 set238a-015 [Vibrio cholerae]  ali follow..  15  803...........QDALKTFAKSIALVATVGMIASGLEAWESWGKFNDSSKTDLERFGYLLKAGATGAQALIFAIQLGVYGVRFIGFGTIAAISAGWMAAGFAVIGIVYLIGVILWLKSTWGK--HWPVGQELTELERLLHRPSLRLSQVTQRKAAQWMDSGSLQWQLELTLP.......................................................................... 976
7 -7.400IDP05484 hypothetical protein BA_3055 [Bacillus anthracis str. Ames] BA_3055 [Bacillus anthracis str. Ames]  ali follow..  14  3.........................................................................................SLLQKTLAVTGLTASLLGMVSSVSFASISWDNDATWTGSGAKAKATAYTHFYKMTVRASFDDRTSKELALYDAKTSDCINVSVA........................................................................ 92
8 -7.020IDP04526 putative inner membrane protein [Salmonella typhimurium LT2] STM1637_1_516 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  23..........................HVCLIVIFSVLIRLLFLTDRYLWCDEASSVLIVHPPLYYLLLHDWMILWGDSIAAV-----RSLSLLFGILTVVLVIALTALLAGWFAALMPMAVHYSQETRMYALMGMLTLAAALALMMWI--KTPTHNRYLVAYALLMTFSFYTHYFTL.................................................................... 189
9 -6.180IDP90853 putative glycerol-3-phosphate acyltransferase PlsY [Yersinia pestis CO92] YPO0647 [Yersinia pestis CO92]  ali follow..  13  45...................................................NVLRIGGRTAAVAVLLFDILKGMLPVWIAYLLHIPPLYLGLTAIAACLGHIYPVFFHFKGGKGVATAFGAIAPIGWDLTGLMTGTWLLTVLL------------SGYSSLGAIVSALIAPFYVWWFK-------------------------FTFPVAMLSCLILMRHHDNIQRLWRGKEGKIWDKLRKKKQKT 203
10 -6.100IDP91363 secreted hydrolase [Vibrio vulnificus CMCP6] VV1_2834 [Vibrio vulnificus CMCP6]  ali follow..  52  81............................................................................................................VTGNAWLQKEWGSNWDW........................................................................................................................ 105

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.