current user: public

If you have questions about the server, please let us know.

Query: IDP00784 pathogenicity island protein SACOL0896 [Staphylococcus aureus subsp. aureus COL], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MNEIKLKYDTQVSVVHYESLDSRSFKSFSMPKWSKLVNKLSVPIEANYKYARGVAVYGDIKDNTNDHGEIIKKHRNDKNVIYRNVIVLDYDEINDVKQLHDAISSVLSSVAWYWHTSFSHTTEQARIRLYIPLNERISADDYRKYTKVLANKIGHKVDEGSYQPSRCFALPVIQKGHIFIKRVNDCPIMDVDMLEQWSKEYKQSNGSPNIKGYTRRDSAYWRDIAFGVSEGERNSTLASITGYLLRRYVDPNLVYGLVSAWASVCKPPINQSEVNNTFKSILKKDSKNSLast
1 -107.000IDP00784 pathogenicity island protein SACOL0896 [Staphylococcus aureus subsp. aureus COL]  ali  100  1MNEIKLKYDTQVSVVHYESLDSRSFKSFSMPKWSKLVNKLSVPIEANYKYARGVAVYGDIKDNTNDHGEIIKKHRNDKNVIYRNVIVLDYDEINDVKQLHDAISSVLSSVAWYWHTSFSHTTEQARIRLYIPLNERISADDYRKYTKVLANKIGHKVDEGSYQPSRCFALPVIQKGHIFIKRVNDCPIMDVDMLEQWSKEYKQSNGSPNIKGYTRRDSAYWRDIAFGVSEGERNSTLASITGYLLRRYVDPNLVYGLVSAWASVCKPPINQSEVNNTFKSILKKDSKNS 289
2 -6.630IDP00517 hypothetical protein YPMT1.71 YPMT1.71 [Yersinia pestis CO92]  ali follow..  12  264............................................................................................................................................................................................................QQLEQKGIEKGRMEGRTEGIQLGEQRGIEKGKL-EVARSLLKMGMPIESVQEAT----------LSEDDLAQI............ 326
3 -5.790IDP06124 hypothetical protein jhp0592 [Helicobacter pylori J99] NP_223310 [Helicobacter pylori J99]  ali follow..  54.............................................................................................................................................................................................................KNLQSVPALEKLKNRFNERFKICPKDKETLWLETIQNLVASEFFELEDAINFGQELENAN--PNYRQKIANATGLALKNKKEKG 135
4 -4.970IDP93835 phage/plasmid maintenance toxin/antidote system toxin [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001006281 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  12  65.....................................................................................................................................................................................................................................DGNKRTAFQSMALFLGINGVDLCASNQLEELTVEAAQGKIGVEQITEQLRELTE...... 118
5 -4.230IDP05497 phosphoserine phosphatase [Clostridium difficile 630] CD0241 [Peptoclostridium difficile 630]  ali follow..  6................................................................................MENYKFVFDLDSTLTKQEILPEISKCINKYELMQNLTNETMLGNLSFEESFKKRVDLLKCIPISKVKSIVAKINLNEKIVKFIKENPDRCTVVTNNLDIWICDLMKELSLENKYYSSIASNGDFIDKIKVIIKKEDIIKKMKGPIVAVGDGSNDIKMIENADIGIGFGGVRPIAPGILKVCDYAFY---EEERLCQLLKQLL....... 205
6 -4.160IDP92766 hypothetical protein [Vibrio cholerae O1 biovar El Tor] AGG36634 [Vibrio cholerae O1 biovar El Tor]  ali follow..  24...................................................................................................................................................................................................................................MKQHYRSNKKTAAIVAMLGLNLTGSQVVEMMQEIEGEKVSLSSVHKARERYRPIVKMLQEET 85
7 -4.070IDP04367 PTS system, fructose-specific IIABC component [Bacillus anthracis str. Sterne] BAS3563 [Bacillus anthracis str. Sterne]  ali follow..  12  1MKITELLKRDTVIMNLTASNKEAV--------IDELVEKLNGANRLNSKAEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPAICINYESLDGQP------------AHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDE------------------------------------EELLRLFDEKENEKENEKEEEVEVAQPEGNEPYVLAVTACPTGIAHTYMA--ADSLKAKAAELGIAIKVETNGSTGIKNGLTKEDIERATAIIVAADKQ.. 236
8 -4.050IDP00659 gene: pepT; peptidase T SACOL0806 [Staphylococcus aureus subsp. aureus COL]  ali follow..  125...........................................................................GHTLMVTDGTSLLGADDKAGIVEIMEAICYLQE----------HPEIKHGTIRIGFTPDEEIGRGPHKFDVDRFNADFAYTMDGSQYGELQYESFNAAE----------------------VITCHGVNVHPGSAKNAMVNAIRLGEQFDSLLPDSEVPERTEGYEG-FYHLMNFEGTVEKATLQYIIRDHDKKQFELRKKRILEIRDDINAH. 305
9 -4.000IDP90123 B15R-like protein [Monkeypox virus] MPXV_ZAI1979_005_035 [Monkeypox virus]  ali follow..  1MET-KSDYEDAVFYFVDDDEICSRDS-DEYITWRNHVIVFNKDITSCGRLYKELIKFDDAAIRYY----------GIDKINEIVEAMSEGDHYINEVHDQESLFATIGICAKIAEHWGYKKISESKFQSLGNITDLMTDDNINILILFLEKKLN....................................................................................................................................... 149
10 -3.990IDP90994 hypothetical protein y1355 [Yersinia pestis KIM 10] y1355 [Yersinia pestis KIM10+]  ali follow..  1.........................................................................................MEVYTTENDQVDAVRRFFSENGKALNQNTAMTEASSAYQKVSTALSTNSAGNVSADSIALAEKFVQSNKNNYGVLVGLELAHDFVEQNAFDKAAQQLSQALGQTKDENLLSLINLRLARVQLQLKKPDEAL--KTLDAVQGDGWTAMAQDVRGDALLSKGDTAGARAAYSKAIESNASQALQALLRMKLNNL........ 209

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 5 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.