current user: public

If you have questions about the server, please let us know.

Query: IDP00932 gene: nadD; nicotinic acid mononucleotide adenyltransferase STM0645 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst MKSLQALFGGTFDPVHYGHLKPVETLANLIGLSRVIIMPNNVPPHRPQPEASSAQRKYMLELAIADKPLFTLDERELQRNAPSYTAQTLKAWREEQGPEAPLAFIIGQDSLLNFPTWHDYDTILDNTHLIVCRRPGYPLEMTQAQHQQWLEQHLTHTPDDLHQLPAGKIYLAETPWLNISATLIRERLEKGESCDDLLPENVLNYINQQGLYRLast
1 -110.000IDP00932 gene: nadD; nicotinic acid mononucleotide adenyltransferase STM0645 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali  100  1MKSLQALFGGTFDPVHYGHLKPVETLANLIGLSRVIIMPNNVPPHRPQPEASSAQRKYMLELAIADKPLFTLDERELQRNAPSYTAQTLKAWREEQGPEAPLAFIIGQDSLLNFPTWHDYDTILDNTHLIVCRRPGYPLEMTQAQHQQWLEQHLTHTPDDLHQLPAGKIYLAETPWLNISATLIRERLEKGESCDDLLPENVLNYINQQGLYR 213
2 -107.000IDP90767 gene: nadD; nicotinic acid mononucleotide adenylyltransferase [Yersinia pestis CO92] YPO2607 [Yersinia pestis CO92]  ali follow..  60  8.HSLYALFGGTFDPIHYGHLKPVEALAQQVGLQHIILLPNHVPPHRPQPEANAQQRLKMVELAVAGNPLFSVDSRELLRDSPSFTIETLEALRKERGAEQPLAFIIGQDSLLSLHKWHRWQALLDVCHLLVCARPGYSQSLETPELQQWLESHKVMDPQALSQRPHGAIYLADTPLLDISATDIRRRRHNGESCDDLLPQAVQRYIELQGLYR 219
3 -95.100IDP05299 gene: nadD; nicotinate-nucleotide adenylyltransferase [Clostridium difficile 630] CD2524 [Peptoclostridium difficile 630]  ali follow..  32  27.KIKIGILGGTFDPIHYAHLATAEFIRDKYDIDKIIFIPSGNPPHKLCITTDKYDRYNMTLLATESNEDFLVSKVEIERKKRTYTIDTLKYLKKKY-KNADIYFITGADAICSVEEWKDVKKNFELATFIAATRPGISLLRSQETIEK------------LTKKYNADIITVYVPSLDISSTYIREQLNEGKSIRYLVPENVENYLYENKLYQ 225
4 -85.800IDP90518 hypothetical protein Cj1404 [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1404 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  23  2...KIALFGGSFDPPHNGHNSVVLEALEKLDIDKLIIMPTYINPFKQSFSADEKQRFLWVKKLWGHLPKVEICDFEIRQKRPVPSIESVKYLYKLY-NPSKFYLLIGADHLEKLHLWHDFEKLNSLVEFVIANRNDIGIP---------------------------KNFKDLKTNKKIASSFIRDTLNTNEVCEE-IKDEVKKYYEKLQ... 179
5 -80.100IDP02537 gene: nadD; nicotinic acid mononucleotide adenylyltransferase [Bacillus anthracis str. `Ames Ancestor`] GBAA4558 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  33  1...................MLIANEVYHALNLEEVWFLPNQIPPHKQRDITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKY-PDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRT------------------------PYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYE 170
6 -48.900IDP00667 gene: kdtB; lipopolysaccharide core biosynthesis protein KdtB SACOL1134 [Staphylococcus aureus subsp. aureus COL]  ali follow..  14  1MEHTIAVIPGSFDPITYGHLDIIERSTDRF--DEIHVCVLKNSKKE--GTFSLEERMDLIEQSVKHLPNVKVHQFSGLLVDYCEQVGAKTIIR---------GLRAVSDFEYELRLTSMNKKLNNEIETL--------------------------------------YMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKK.... 158
7 -48.600IDP01225 Phosphopantetheine adenylyltransferase (Pantetheine-phosphate adenylyltransferase) (PPAT) (Dephospho-CoA pyrophosphorylase) BA_4139 [Bacillus anthracis str. Ames]  ali follow..  17  2..TSIAISSGSFDPITLGHLDIIKRGAK---VFDEVYVVVLNNSSKK-PFFSVEERLDLIREATKDIPNVKVDSHSGLLVEYAKMRNANAILR---------GLRAVSDFEYEMQITSMNRKLDENIETFFIMT--------------------------------------NNQYSFLSSSIVKEVARYGGSVVDLVPPVVERALKEK.... 157
8 -47.400IDP00308 gene: coaD; phosphopantetheine adenylyltransferase CBU_0288 [Coxiella burnetii RSA 493]  ali follow..  18  2..KPIAIYPGTFDPLTNGHVDIIERALPLFNKIIVACAP---TSRKD-PHLKLEERVNLIADVLTDERVEVLPLTGL----------LVDFAKTHQANFILRGLRAVSDFDYEFQLAHMNYQLSPEIETIFLPA--------------------------------------REGYSYVSGTMVREIVTLGGDVSPFVPPLVARHLQKR.... 156
9 -46.700IDP90549 gene: coaD; phosphopantetheine adenylyltransferase [Yersinia pestis CO92] YPO0053 [Yersinia pestis CO92]  ali follow..  17  2..ITKAIYPGTFDPITNGHLDLVTRASAMF--SHVILAIADSSSKK--PMFTLDERVALAKKVTAPLKNVEVLGFSELMAEFAKKHNANILVR---------GLRSVSDFEYEWQLANMNRHLMPKLESVFLIP--------------------------------------SEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAK.... 157
10 -44.300IDP02324 gene: coaD; phosphopantetheine adenylyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT0581 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  18  2..NKIAIYPGTFDPITNGHVDLVERALN---IFDEIVVAVSTAYGKN-TLFDIRIREQMIKEVFKDNQRVKVVSFQGLLVDTAVKHNACAIVRG---------LRAVSDFDYEFQMSSMNNKLNSDIQTI--------------------------------------FLTPSEKFSCISSTLVRAVAIHNKRVDEFVPECVFREIKLK.... 158
11 -41.400IDP90508 gene: coaD; phosphopantetheine adenylyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0767c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  17  3.....CLYPGTFDPITNGHLDVIKRALKIFDEVIVAIAKSE----HKKPCYDLEKRKELALLATQNLKNVKIIAFDNLLVDLAKELKVNTIIRG---------LRAVSDFEYELQIGYANHALWEDMETI--------------------------------------YLMPSLKHAFISSSIVRSIVAHGGDVSSLVPKEILPFLKDQS... 156
12 -9.790IDP05514 gene: ribC; riboflavin biosynthesis protein [Clostridium difficile 630] CD1315 [Peptoclostridium difficile 630]  ali follow..  14  21.........GNFDGVHKGHQVLIGKTVEHAKKENIQSIVFTFANHSTKNIISNDDKIKLLEDLGIDIVVIIPFDEYMTKIPAKDFVDEI--LVKKLKAKK---IVIGHDFTFARAKEGNVNLLKSLE-----HEFGFEVEVIKP---------------------------IKINDVRVSSTYIRSLVSQGD..................... 174
13 -9.650IDP00902 gene: ribF; bifunctional riboflavin kinase/FMN adenylyltransferase STM0045 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  18  22.........GNFDGVHRGHRALLQGLQEEGRRRGLPVVVMIFEPQAPARLTRLREKLHYLAQCGVDYVLCVKFDRRFAALTAQTFISEL--LVERLGVQF---LAVGDDFRFGASRAGDFLLLQKAG-----AEYGFAVSSTQT---------------------------FCEGGVRISSTAVRQALAEDN..................... 176
14 -9.620IDP04156 riboflavin kinase/FMN adenylyltransferase [Vibrio cholerae O1 biovar El Tor str. N16961] VC0681 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  22.........GNFDGVHLGHQQVLSQVVQRAQQMGLPSVVMTFEPQAPARLTRLRDKFVQLSKLGVDRLLCVNFNHHFAQLDAHTFIRDL--LVTRLGVK---FLVVGDDFCFGKERQGNFALLQQAG-----QALDFEVVSTQS---------------------------FCLQQLRVSSTAIREALAADQ..................... 176
15 -9.540IDP02555 gene: ribF; riboflavin biosynthesis protein RibF [Coxiella burnetii RSA 493] CBU_0391 [Coxiella burnetii RSA 493]  ali follow..  16  22.........GNFDGLHLGHQALLKTLKQLARELKLPTVVIIFEPQTEARLMRFREKWLGFAEWKIDYLLCLRFDRALADLAAEDFVKQI--LVDRLGAKA---VVVGDDCRFGAKRAGDYALLKQLG-----EEYNFKAIEMPS---------------------------VIYDGQRVSSTRVRQALQAGD..................... 176
16 -9.540IDP90654 gene: ribF; bifunctional riboflavin kinase/FMN adenylyltransferase [Yersinia pestis CO92] YPO0474 [Yersinia pestis CO92]  ali follow..  20  22.........GNFDGVHRGHQALLEQLKREGQRLGLPVMVMIFEPQPLE-LTRLRDKAKYLAQAGVDYLLCVKFDPRFAANTAQAFVAQL--LVEKLGVKF---LTVGDDFRFGAGRQGDFQLLQQAG-----AEFGFDVISTDS---------------------------FCDGGLRISSTAIRQALHDDD..................... 176
17 -9.510IDP01850 gene: ribF; riboflavin biosynthesis protein RibF [Francisella tularensis subsp. tularensis SCHU S4] FTT0916c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  21.........GSFDGVHLGHQAIIKKLLTIAKENNLVPYILFFEPLAPFRIYDFRNKVINIHKLGIKHIICQKFNTKFANITANEFIEEF--LVKKLNTKH---IIVGDDFKFGKNRGGDYALLNQYS-----QTHDFNVDKVST---------------------------LNLDNHRISSSDIRQALTNHD..................... 175
18 -9.010IDP90612 NMPDR 243277.1.peg.3916 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  145..EKVVMTNGCFDILHAGHVSYLNHAAELGDR--IVAVNTDESVKRGRPVNSTDRRMAVLA-GLGAVDWVVP-----------FSEDTPQRLIAAVLPN---LLVKGGD--------YKPEDIAG---------------------------------GKEVIAAGGEVKVLNFEE-GCSTTEIIEAIKGGRG.................... 281

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.