current user: public

If you have questions about the server, please let us know.

Query: IDP01074 gene: fpr; ferredoxin-NADP reductase STM4084 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MADWVTGKVTKVQNWTDALFSLTVHAPINPFTAGQFTKLGLEIDGERVQRAYSYVNAPDNPNLEFYLVTVPQGKLSPRLAALKPGDEVQVVSDASGFFVLDEVPDCETLWMLATGTAIGPYLSILQYGQDVARFKNLVLVHAARFAADLSYLPLMLELQQRYEGKLRIQTVVSRENVPGSLTGRVPALIENGELEKAVGLPMDKETSHVMLCGNPQMVRDTQQLLKETRQMTKHLRRRPGHMTAEHYWLast
1 -102.000IDP01074 gene: fpr; ferredoxin-NADP reductase STM4084 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali  100  1MADWVTGKVTKVQNWTDALFSLTVHAPINPFTAGQFTKLGLEIDGERVQRAYSYVNAPDNPNLEFYLVTVPQGKLSPRLAALKPGDEVQVVSDASGFFVLDEVPDCETLWMLATGTAIGPYLSILQYGQDVARFKNLVLVHAARFAADLSYLPLMLELQQRYEGKLRIQTVVSRENVPGSLTGRVPALIENGELEKAVGLPMDKETSHVMLCGNPQMVRDTQQLLKETRQMTKHLRRRPGHMTAEHYW 248
2 -60.900IDP01319 gene: fre; FMN reductase VC0312 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  3....IQCQVKSVQPLATHTYQILLQPEHVAYQAGQYLMVVM---GEKDKRPFSLASSPCRSNLELHIGAADHSAFAHQVEKFQQAHWVEVDVPHGNAALQES---ERPLLLIAGGTGFSYVRSILDHCLSQGKTQPIYLYWGARDAAQLYALNELQELAKQHAHLQVVPVVEQAQDDWAGKVGNVLQAINNDF--------ASLEAFDIYIAGRFEMAGAAREQFQNKQARRDRMFADAYAFI..... 236
3 -55.100IDP04140 gene: ascD; cdp-6-deoxy-delta-3,4-glucoseen reductase [Yersinia pestis CO92] YPO3116 [Yersinia pestis CO92]  ali follow..  17  98.KKTYPCKLDSIEFIGEDIAILSLRLPPIQYLAGQYIDLIIN----GQRRSYSIANAPGGNNIELHVRKVVNGVFSNIINELKLQQLLRIEGPQGTFFVRED---NLPIVFLAGGTGFAPVKSMVEALINKNDQRQVHIYWGMPAGHNF-YSDIANEWAIKHPNIHYVPVVSGDDSTWTGATGFVHQAVLEDI--------PDLSLFNVYACGSLAMITAARNDFINHGLAENKFFSDAFVPS..... 328
4 -54.900IDP00562 gene: hmp; nitric oxide dioxygenase YPO2908 [Yersinia pestis CO92]  ali follow..  15  150.RTLRRFRIIKKEQQSEVICSFVLAPEDLHYKPGQYLGIYIEHESLEFQRQYSLTTAPNGKTYRIAVKREEQGTVSNLLHRLNEGDIVRIAPPRGDFFL--DVSPDTPVALISAGVGQTPMLSMLNTLYSQQHAAPVHWLHAAENGRVHAFADEVSAIAAKMPN-LSRHVWYREPDLQDHSQGLMDLSSYQWLA--------DDPKRHYYFCGPLPFMQFIGRQLLAQGIAPEQIHYECFGPH..... 393
5 -50.800IDP00644 flavohemoprotein, putative SACOL0220 [Staphylococcus aureus subsp. aureus COL]  ali follow..  17  147.IGFKPFKITNIKQESEDIKSFTVETEESEFTPGQYITVDVSSDKLRAKRHYSIVSGEKNHGVKRDVTTEHEGEVSTILHDIKEGDMINLAAPVGGFVLENT---TEPQLFLGSGIGVTPLVAMYEAASAKG--LDTQMVQVAENEQHLPFKDNFNSIASHHDN-AKLYTHLKDKQ------GYIGAEELQVFL---------ANKPEIYICGGTKFLQSMIEALKSLNYDMDRVHYETFIPRLS... 378
6 -50.700IDP01484 nitric oxide dioxygenase VCA0183 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  152.RDGRTFVVREKQVESAYVTSFVLVPADLDYQPGQYIGIEVTPEGSDYRRQYSLSHASNGREYRISVKRDNPGLVSHYLHNVKVGDSVKLYAPAGDFFYVER---ERPVVLISAGVGATPMQAILHTLAKQNK-SGVTYLYACNSAKEHTFAQETAQLIAQQGW----QVWYRDESADDVLQGEMQ----------LAELILPIEDGDFYLCGPIGFMQYVVKQLLALGVDKARIHYEVFGPHAQ... 391
7 -46.900IDP91897 oxidoreductase, NAD-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007685 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  17  178ISFPYLGKITHLKRLNHDTREIQIHLCRFNYQSGQFAFLKIFQEGESAPHPFSISGGHGQT-LYFTVKNS--GDHTNNIDNLQAGSKVTLDRAYGHMIIEEG---RENQVWIAGGIGITPFISYIREHPILD--KQVHFYYSFRGDENAVYLDLLRNYAQKNPN-FELHLIDSTKD------GYLNFEQKE-----------VPEHATVYMCGPISMMKALAKQIKKQNPK-TELIYEGFKF...... 395
8 -37.800IDP01841 gene: asrB; anaerobic sulfite reductase subunit B [Salmonella typhimurium LT2] STM2549 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  17  18.....AYRILSITRHTPLEWNFRVAVD-FPAHWGQFVEVSLPRVGE---APISVSDYG-DGWIDLLIRNV--GKVTSALFTLKEGDNVWLRGCYGNGYPVDTL-RHKPLLVVAGGTGVAPVKGLMRYFVENPEIGQLDMILGYKNRDCVLYKEEMATWRGKHN------LVLTLDEGEADDRYQIGRVTDR-----ADMTLSDIDTMQAIVVGPPIMITFTVKMLLQKGLKPEQIW-----VDYERRM 238
9 -35.500IDP04424 gene: pyrK; dihydroorotate dehydrogenase electron transfer subunit [Bacillus anthracis str. `Ames Ancestor`] GBAA4024 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  17  1MMQKQNMIVVNQKEIAKNIYELVLQGTLVMNEPGQFVHIKVAEGIAPLRRPISICNDQEKNEFTMLYRAE--GQGTKTLATRKQGEMVDVLGPLGHGFPVEEAEAGQTALLVGGGIGVPPLYELSQRLVAKG--VRVIHILGFQTKDVVFYEEKFAELGD---------TYVATVDGTHGTKGFVTDVIDHYG----------IDFDILYSCGPLAMLRALEGRYKEK.................... 209
10 -23.900IDP02581 gene: cysJ; sulfite reductase subunit alpha [Yersinia pestis CO92] YPO3372 [Yersinia pestis CO92]  ali follow..  17  393.................................................RLYSIASSQTENEVHITVGVVRSGGASGYLADLEVDGDIRVFIEHNDNFRLPA-NPETPVIMIGPGTGIAPFRAFMQQREVDGASGKNWLFFGNPHFTDFLYQVEWQRYVKE-GVLTRIDLAWSRDQAHKIY---VQDKLREQGAELWNWIQ---QGAHIYVCGDANMAKDVEQVLLDVVALHGAMDAEQADEYLSE.. 594
11 -23.200IDP95246 acinetobactin utilization protein [Acinetobacter baumannii ATCC 17978] YP_001085413 [Acinetobacter baumannii ATCC 17978]  ali follow..  14  2..EQLEMTIVSIQTPYPSIVRIQGKINTLQ-APNLAIRLIVS-EGQPISRVYTVRSNPINAQIEIFVKHEDLSPAMEWLNSAQVGTKIGLIGPRPHF--IPNFTAKKHVVMFADDTAVPALYSILKQWELGISADIFIESFEKDIASQLPELEHVK------------IHSFHKEHHTSQ----------KGLLLKAAFALEHYENITIWAACERNEARALRQFFEDQQLNKNDVR-------IAGYW 225
12 -15.300IDP95029 NADPH-cytochrome p450 reductase [Plasmodium falciparum 3D7] AAN37091 [Plasmodium falciparum 3D7]  ali follow..  14  528..................................................TNKYTYMYKQNIIELLVCLYK-GLCSDYLINLNPGSFVYSKIENSMLALNKNIFNDYTILYISVGAAFSSLIQVLRHRHYLYSTKKDLLFLGFRQKSDFYFKDEMKSYLYF----SYIFLAFSQDVEDKFV--YYNKLNCNDSSRKWVEDNIISNNNNVNDNNDNNNNNVNDNNVNRNNHSNNHCNNN.......... 752

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.