current user: public

If you have questions about the server, please let us know.

Query: IDP01100 gene: celC-2; PTS system, cellobiose-specific IIA component BA_5442 [Bacillus anthracis str. Ames], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MMTTAEQIPFQLILNSGNARSFAMEALQFAKQGKMAEADEAMVKAKEAINEAHHFQTELIQSEARGEKTEISVLLIHAQDHLMNAITVKELAAEFIDLYKKLEAKGELast
1 -70.200IDP01100 gene: celC-2; PTS system, cellobiose-specific IIA component BA_5442 [Bacillus anthracis str. Ames]  ali  100  1MMTTAEQIPFQLILNSGNARSFAMEALQFAKQGKMAEADEAMVKAKEAINEAHHFQTELIQSEARGEKTEISVLLIHAQDHLMNAITVKELAAEFIDLYKKLEAKGE 107
2 -65.500IDP00458 gene: celC; N,N`-diacetylchitobiose-specific PTS system transporter subunit IIA YPO2680 [Yersinia pestis CO92]  ali follow..  43  13TSDALEDVVMGLIINAGQARSLAYNALKQAKAGDFAQADELMAQSRSALNDAHLVQTQLIEADQGEGKTKVTLVLVHAQDHLMNAMLARELITELIELHQKIQ.... 115
3 -64.200IDP01307 PTS system, cellobiose-specific IIA component VC1283 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  37  2...EQELIVMEIICNAGEARSLCYEALRLARTRSFEQAEEKLCQAKECLNRAHLIQTQLIEADQGEGKVPMTLVMVHAQDHLMTTILAQEMATEMVALHKHLAGEEA 105
4 -7.780IDP01827 gene: fliE; flagellar hook-basal body protein FliE [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0526c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  31.......................................KMLKNEINDLNKAQESGEAAMTDIATGQVKDLHQAAIAITKAESSMKFMLEVRNKAISAYKEITRTQ. 97
5 -7.610IDP05015 gene: fliE; flagellar hook-basal body protein FliE [Clostridium difficile 630] CD0247 [Peptoclostridium difficile 630]  ali follow..  10  38.......................................DVIIDTIDKVNFQQVTADDMKEKFIKGEDVSMHEVMLIGQEAQLSMQYLIEVRNKIHDAYQEMNKVQ. 104
6 -7.420IDP01823 gene: pst; pesticin [Yersinia pestis CO92] YPPCP1.05c [Yersinia pestis CO92]  ali follow..  287LPLRTRTALVSIGYQKGFKLSRTAPTVNKVIAKDWNGLVNAFNNIVDGMSDRRKREGALVQKDIDSGLLK..................................... 357
7 -5.810IDP92768 gene: cas1; Cas1 [Vibrio phage ICP1_2011_A] AGG09389 [Vibrio phage ICP1_2011_A]  ali follow..  10  164..........SLLGHEGTFVKSLYKEYALEYEIEFKRDHKSADNYNKFLTLGNYYAYGIARSSLWALGIDNSFPLLHGSTRRGG------LVFDVADIIK....... 247
8 -4.850IDP04565 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1805 [Clostridium perfringens ATCC 13124]  ali follow..  17  1MIKKIVVAVGLAFS-VGCGNKSLVEGKAAIKQGNYEEATAIFKAASEEDSKDKEEAESLYDL............................................. 66
9 -4.770IDP93890 adhesin [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001005760 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  9.....KPLAIAVLMLASGGMVNMVHAEPTVINSKDISATKTVKEGGSFSVEFKATENEIVSGKLDADTPAFHLVMSDSGEH.......................... 84
10 -4.730IDP06234 glycosyl transferase family protein [Streptococcus pneumoniae TIGR4] NP_344649 [Streptococcus pneumoniae TIGR4]  ali follow..  1MTQNVESLLVSIVISAYNEEKYLPGLIEDLKNQTYPKEDIEITDGTTAIIQQFIKEIRLYNNPKKNQASGFNLGVKHSVGDLIHSKVTETFVMNNVAIIQQ...... 119

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.