current user: public

If you have questions about the server, please let us know.

Query: IDP01145 oligopeptide ABC transporter, ATP-binding protein BA_0188 [Bacillus anthracis str. Ames], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MTTDLITVKQVTKTYGSKNKEIAALKDISLAIPKGTTLGIIGESGSGKTTLGKLIAGIESPTSGEIDYNGQVVHKLKAAHKRDFLQKVQFIFQDSTAALNPRWKVRDSVTEGYISFGLGDKGLKDKVAGDALERVGLDRRYINRYPHEFSGGQRQRIAIARALLCEPEVLILDEPISALDVSLQIQIVHLLQKIQREQGYTYLFIAHDLPMVHYLCEKVAVLYKGELVEFGNTDEVFRNPQHSYTKTLLASTPKISGLast
1 -122.000IDP01145 oligopeptide ABC transporter, ATP-binding protein BA_0188 [Bacillus anthracis str. Ames]  ali  100  1MTTDLITVKQVTKTYGSKNKEIAALKDISLAIPKGTTLGIIGESGSGKTTLGKLIAGIESPTSGEIDYNGQVVHKLKAAHKRDFLQKVQFIFQDSTAALNPRWKVRDSVTEGYISFGLGDKGLKDKVAGDALERVGLDRRYINRYPHEFSGGQRQRIAIARALLCEPEVLILDEPISALDVSLQIQIVHLLQKIQREQGYTYLFIAHDLPMVHYLCEKVAVLYKGELVEFGNTDEVFRNPQHSYTKTLLASTPKISG 257
2 -113.000IDP01427 peptide ABC transporter, ATP-binding protein VC1684 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  29  2..SALLEVTNLHKDFVTRSGIQHAVKPVSFTLEAGQTIGFIGQNGSGKSTLARMLAGMVAPTGGEIRVNGELL---EHKDYSTRCKLIRMIFQDPNTSLNPRLQIGTILEGPLKRNTSMTPEARMRRVKDTLQRVGLLPEHAYFYPQMLATGQKQRVCLARALILQPSIIIADEALNGLDMAMRSQILNLFLELQEEMGVSFVYVSQHIGVIKHITDKIIVMHEGDVVESGETHEVLADPQHPITQRMIESHFTKA. 257
3 -112.000IDP06300 oligopeptide ABC transporter ATP-binding protein AmiF [Streptococcus pneumoniae TIGR4] NP_346318 [Streptococcus pneumoniae TIGR4]  ali follow..  43  1MSEKLVEIKDLEISFGEGSKKFVAVKNANFFINKGETFSLVGESGSGKTTIGRAIIGLNDTSNGDIIFDGQKINGKKSREAAELIRRIQMIFQDPAASLNERATVDYIISEGLYNHRLKDEEERKEKVQNIIREVGLLAEHLTRYPHEFSGGQRQRIGIARALVMQPDFVIADEPISALDVSVRAQVLNLLKKFQKELGLTYLFIAHDLSVVRFISDRIAVIYKGVIVEVAETEELFNNPIHPYTQALLSAVPIPD. 258
4 -110.000IDP01149 oligopeptide ABC transporter, ATP-binding protein BA_1195 [Bacillus anthracis str. Ames]  ali follow..  47  5.REKLIEVKNVKQHFDVSGGVVKAVNDISFDIYRGETFGLVGESGCGKSTTGRTIIRLYDATAGEVLFDGENVHGKSRAELKKFNRKMQMIFQDPYASLNPRMTVGDIIAEGIDIHGLKNKKERMDRVHELLNTVGLNKEHANRFPHEFSGGQRQRIGIARALAVEPEFIIADEPISALDVSIQAQVVNLLKKLQKEKGLTYLFIAHDLSMVKYISDRIGVMYRGQIVELTTSDELYANPIHPYTKSLLSAIPLPD. 261
5 -109.000IDP01146 oligopeptide ABC transporter, ATP-binding protein BA_0235 [Bacillus anthracis str. Ames]  ali follow..  42  1MSEPLLEVKNLKTYFPIKGGHVKAVDGVSFTIKKGEVFGLVGESGSGKTTIGKTILRLVQKTEGEVKFKGHDVHSLSKEELRKHRPNMQLVFQDPFSSLNPRMRIGEALGEPMLAHGLATKENVREKVTEVLELCGLAPYHIDRYPHEFSGGQRQRIVIARAMVLNPEFIVADEPVAALDVSIQAQIINLFSELQEKKGLSYLFISHDLSVVEHLCTKIGIMYLGTIVETAPRDELFTNPLHPYTKALLSAVPIPD. 263
6 -108.000IDP01062 gene: dppF; dipeptide transporter ATP-binding subunit STM3626 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  41  8LQQPLLRAIDLKKHYPVKKGLVKALDGVSFNLERGKTLAVVGESGCGKSTLGRLLTMIETPTGGELYYQGQDLLKHDPHAQKLRRQKIQIVFQNPYGSLNPRKKVGQILEEPLLINTSLSKAQRREKALAMMAKVGLKTEHYDRYPHMFSGGQRQRIAIARGLMLDPDVVIADEPVSALDVSVRAQVLNLMMDLQQDMGLSYVFISHDLSVVEHIADEVMVMYLGRCVEKGTKEQIFNNPRHPYTQALLSATPRLN. 269
7 -108.000IDP00738 gene: oppF; oligopeptide ABC transporter, ATP-binding protein SACOL0994 [Staphylococcus aureus subsp. aureus COL]  ali follow..  50  4.DEVLLSIKNLKQYFNAGKKEVRAIENISFDIYKGETLGLVGESGCGKSTTGKSIIKLNDITSGEILYEGIDIQKIRKKDLLKFNKKIQMIFQDPYASLNPRLKVMDIVAEGIDIHHLTDKRDRKKRVYDLLETVGLSKEHANRYPHEFSGGQRQRIGIARVLAVEPEFIIADEPISALDVSIQAQVVNLLLKLQRERGITFLFIAHDLSMVKYISDRIAVMHFGKIVEIGPAEEIYQNPLHDYTKSLLSAIPQPD. 261
8 -108.000IDP00712 oligopeptide ABC transporter, ATP-binding protein SACOL0998 [Staphylococcus aureus subsp. aureus COL]  ali follow..  42  2..ENILEVNQIKKYYKIKTGYVKAVDDVSFSIKKGQTFGLVGESGCGKSTLGKVIIRLEDATSGSIIVNGEDITRLQGKKLRKSRQQYQMIFQDPYASLNPMQMVGDIISEPILNYKKLPKEEIKKEVLYLLKCVGLSEDAYYKYAHEFSGGQRQRVGIARALALRPSLIVADEPVSALDVSVQSQVLNLLKDLQEQFNLSYLFIAHDLSVVKHISDVIGVMYLGHIVEIASDKEIYENPKHPYTKALISSIPQID. 261
9 -107.000IDP01411 oligopeptide ABC transporter, ATP-binding protein VC1095 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  41  11.KKLLLDVKDLKVHFNITPKTLKAVDGVNVRLYEGETLGVVGESGCGKSTFARAIIGLVQATHGEVVWLGQDLTRMQEVKRRATRKQIQMIFQDPLASLNPRMTVGDIIAEPLQTFYPLSKQEVKDRVKEMMAKVGLLPNVINRYPHEFSGGQCQRIGIARALILKPKMIICDEPVSALDVSIQAQVVNLLKELQKELGLSLVFIAHDLSVVKHISDRVLVMYLGNAVELGVSKELFANPKHPYTKALMSAVPIPD. 275
10 -106.000IDP00715 peptide ABC transporter, ATP-binding protein SACOL1414 [Staphylococcus aureus subsp. aureus COL]  ali follow..  34  1....MIELKHVTFGY---NKKQMVLQDINITIPDGENVGILGESGCGKSTLASLVLGLFKPVKGEIYLSDNAV---------------LPIFQHPLTSFNPDWTIETSLKEALYYYRLTDNTAQDQLLLQHLSTFELNAQLLTKLPSEVSGGQLQRFNVMRSLLAQPRVLICDEITSNLDVIAEQNVINILKAQTITNLNHFIVISHDLSVLQRLVNRIIVLKDGMIVDDFAIEELFNVDRHPYTKELVQAFS.... 232
11 -104.000IDP00732 peptide ABC transporter, ATP-binding protein SACOL2473 [Staphylococcus aureus subsp. aureus COL]  ali follow..  30  2...TLLTVKHLTITDTWTDQ--PLVSDVNFTLTKGETLGVIGESGSGKSITCKSIIGLNPEVTGEIIFDGTSMLSLSESQLKKYRKDIAMVMQQGSRAFDPSTTVGKQMFETMKVHTSMSTQEIEKTLIEYMDYLSLPKRILKSYPYMLSGGMLQRLMIALALALKPKLIIADEPTTALDTITQYDVLEAFIDIKKHFDCAMIFISHDLTVINKIADRVVVMKNGQLIEQGTRESVLHHPEHVYTKYLLSTKKKIND 259
12 -103.000IDP01390 peptide ABC transporter, ATP-binding protein VC0617 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  32  1MTTPLISIRNLCVDYITDAGDVRACNNVSFDLAPGEVFGLAGESGCGKSTVAFSLMRLHKPTGGEVIFNGEDILKYSDERMQAFRKEMSMVFQSAMNALNPVLTMEEQFCDVITRHTNMTREQAKRRAEGLLEIVDIHPSRLNDYPHQFSGGMRQRLVIAIALALNPKMIIMDEPTTALDVVVQREILQKIYALKEEFGFSILFITHDLSLMVEFSDRIGIMYSGELIEVAPSKQILETPYHPYTKGLGSSFPPLTG 262
13 -101.000IDP00972 gene: oppD; oligopeptide transporter ATP-binding component STM1743 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  35  14.ANVLLEVNDLRVTFATPDGDVTAVNDLNFTLRAGETLGIVGESGSGKSQTAFALMGLLATNGGSATFNGREILNLPERELNTLREQISMIFQDPMTSLNPYMRVGEQLMEVLMLHKGMSKAEAFEESVRMLDAVKMPRKRMKMYPHEFSGGMRQRVMIAMALLCRPKLLIADEPTTALDVTVQAQIMTLLNELKREFNTAIIMITHDLGVVAGICDKVLVMYAGRTMEYGKARDVFYQPVHPYSIGLLNAVPRLDS 275
14 -100.000IDP06085 gene: dppD; peptide ABC transporter ATP-binding protein [Helicobacter pylori J99] NP_223006 [Helicobacter pylori J99]  ali follow..  37  2....ILEVKDLKTYFFTDKGVNKAVDGVSFGLKKSQTLCIVGESGSGKSITSLSILGLIEKVGGSIQFLGQDLLQLKEKQMQKEIRKIGMIFQEPMTSLNPSYTVGFQINEVLKIHHPLNKKERLERVVYELERVGIPGDKYHEYPFNLSGGQRQRVMIAMAMVCEPEILIADEPTTALDVTIQAQILELMKELQQKKGTSILFITHDLGVVAQIADEVVVMYKGHVVEQASAKELFADPRHPYTKALLNAIPKPGK 263
15 -100.000IDP00711 oligopeptide ABC transporter, ATP-binding protein SACOL0997 [Staphylococcus aureus subsp. aureus COL]  ali follow..  38  1MNNVLLEVKDLETSLKINNEWLATVENISFELSKGEVLGIVGESGCGKSILSKSIIKLLPESNGEVIFDGKRIDTLNEKQLLDIRNDIAMIFQEPMTALNPVFTIKNQLVESIKSHKKISKKEANKLAKDLLKKVGIADEILNSYPHQLSGGMRQRVMIAMAISCSPKLLIADEPTTALDVTIQAQILDLLKELQKETQMAIMMITHDLSVVAEFCDKVLVMYAGQIVEFGGIKEILHNPKHPYTQKLLSTIPKLKE 265
16 -99.500IDP95400 set236a-065 [Undefined organism]  ali follow..  36  4.NKFVLEVSDLHTTFKTDNGDVSAVNGVSFKLEPGKTLGIVGESGSGKSVTAYSIMQILAETGGSVKYKGEDITKWNKKKMADFRKCCSIIFQDPMTSLNPVFTVGYQLEEAVLLHTDRTKKEAKERAIEMLTLVGVNEKRVNQYPHELSGGMRQRVMIAMALACEPDILIADEPTTALDVTIQAQILELMQSLQEKLGMAIIMVTHDLGVIASMCDEIIVMYGGRVCERGTADAIFYSPAHEYTKGLLRSIPTKTN 266
17 -99.400IDP00737 gene: oppD; oligopeptide ABC transporter, ATP-binding protein SACOL0993 [Staphylococcus aureus subsp. aureus COL]  ali follow..  38  1MTERILEVNDLHVSFDITAGEVQAVRGVDFYLNKGETLAIVGESGSGKSVTTKAITKLFQGKKGEILFLGEDLAKKPENELIKLRKDISMIFQDPMTSLNPTMQIGKQVMEPLIKHKNYSKAQAKKRALEILNLVGLPEKRFKAYPHQFSGGQRQRIVIATALACEPKVLIADEPTTALDVTMQAQILDLMKELQQKIDTAIIFITHDLGVVANIADRVAVMYGGQMVETGDVNEIFYDPKHPYTWGLLSSMPDLST 265
18 -98.800IDP01120 oligopeptide ABC transporter, ATP-binding protein BA_1194 [Bacillus anthracis str. Ames]  ali follow..  38  2..KTLLEVKDLQVSFDTHAGEVQAVRGVTFDLKKGETLAIVGESGSGKSVTSKALMGLIPNKNGEIVFEGRDLTKLTEKEMQQVRKDIAMIFQDPMTSLNPTMTIGNQIMEGLIKHQGMSKADARKVALELIDLVGIPEARLKQYPHQFSGGMRQRVVIAMALACNPKLLIADEPTTALDVTIQAQILELMKDIQQKTEAAIIFITHDLGVVANVADRVAVMYAGKVVEIGTVDEIFYNPKHPYTWGLIASMPSLDG 264
19 -97.500IDP01683 oligopeptide ABC transporter, ATP-binding protein [Bacillus anthracis str. `Ames Ancestor`] GBAA0187 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  34  2..AQVLSLENVTLAVEKENSKQAIVKHVSFFINEGEIVALVGESGSGKSVTAQSIIGLNQEDDGNISFESKDLTNLQESEWNQIRKDISFIFQDPLSSLNPTMKVGRQITEVILQHEKKSKKEAKEIAINLLNDLGIHEKRFEQYPHQLSGGMRQRICLAIAFACHPKLVIADEPTTALDVTIQKQIMGLLKERKEKQNTSILLITHDLALVREVADRVVVMYGGRIVEKGTIQEVIGSPKHPYTKSLLQAIPNMDD 263
20 -92.900IDP01301 peptide ABC transporter, ATP-binding protein VC0170 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  36  2...SLLEVKNLRIEYPSRHGVHAAVKSLTLDIQRGEIVGVVGESGAGKSTVGNAVIDLLSPAGGEVYLNGEKISGLSPQAMREVRSKIGFIFQDPMTSLNPLFTVEHQLTETIHANMQVSAEEAYQRALSLMKQVGIPQNRLKQYPHQFSGGMRQRVVIAIALAGEPDLIIADEPTTALDVSIQDQILNLIRELCKKNNVGCMLVTHDMGVVSNVTDRVAVMYRGDLVEFGPTAKVLGTPEHPYTRSLISAVPRSD. 261
21 -90.500IDP01502 ABC transporter, ATP-binding protein VCA0977 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  34  3.PNPLLQVRNLSVSFTTNDGVVDAVKNVSFDIRPGETLAIVGESGSGKSVSTNALMQLLPKPESSIMFEGEELLNKTDTQMRRIRDRIGMIFQEPMTSLNPYMRVGVQVAEAIRCHRNVSQNQAKQRVLELFQLVHLPKGAYQKFPHEFSGGQLQRIMIAMALINEPDILIADEPTTALDVTVQAEVLRLIKEIQANMGMAILFITHDLGVVKFVADRVLVMCKGDVVEQGSTEQLFLQPEHDYTRMLINSIPKGS. 265
22 -89.100IDP02482 gene: oppD; peptide ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_1857 [Coxiella burnetii RSA 493]  ali follow..  43  267.ATALLEAKALKIYFPVKKGDIKAVDGISFKVPAGKTLALVGESGSGKTTTAKAIVRLIAITEGRIQFQSKNLVALSEWRMKRVRKDIQMIFQDPYTSLNPGRMIADSLSEAMSAQKIRKRQAQLNYMDELLKQVGLSPDYKWRYPHEFSGGERQRICIARALALKPKLLILDEPTSALDVSIQMQILKLLEKIQKEHNIAYLLITHNLGIVAYLAHEVAVMKEGKIVEQGPTQLLLKDPSHSYTKKLLDSVLKIE. 529
23 -89.000IDP01654 putative ABC-type transport system ATPase component [Salmonella typhimurium LT2] STM1259 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  26  1....MLSCRDLVIRQ----GGKVLWQNLTFTISAGERVGIHAPSGTGKTTLGRVLAGWQKPTAGDVLLDGSPLP-------LHQYCPVQLVPQHPELTFNPWRSAGDAVRDAW------------QPDPETMRRLHVQPEWLTRRPMQLSGGELARIAILRALDPRTRFLIADEMTAQLDPSIQKAIWVYVLEVCRSRSLGMLVISHQSALLDQVCTRHLQV................................... 195
24 -78.100IDP00706 ABC transporter, ATP-binding protein SACOL0504 [Staphylococcus aureus subsp. aureus COL]  ali follow..  32  1....MIEFRQVSKTFNKKKQKIDALKDVSFTVNRNDIFGVIGYSGAGKSTLVRLVNHLEAASNGQVIVDGHDITNYSDKMMRDIKKDIGMIFQH---NLLNSATVFKNVAMPLILSKK-SKTEIKQRVTEMLEFVGL-SDKKDQFPDELSGGQKQRVAIARALVTNPKILLCDEATSALDPATTASILTLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGKVVETGTVKEVFSHPKTTIAQNFVSTVIQTEP 249
25 -75.600IDP01155 Methionine import ATP-binding protein metN 2 BA_0312 [Bacillus anthracis str. Ames]  ali follow..  34  1....MISFNNVSKVYESGGQSVHAVEDVTLSVEKGEIFGIIGFSGAGKSTLLRLVNMLERPTAGTISIDDKDITSLSTKELRKLRQRIGMIFQS---NLFNSRTVFGNIAYPLKLAKV-PKNEIKERVNELLKFVGL-EDKANNYPEQLSGGQKQRVGIARALATSPDILICDEATSALDPETTTEILNLLKKVNREYNLTILLITHEMHVVKEICHRVAVMEKGKVIEEGKLFDVFTQPKTTTTQNFVRSVINDHL 249
26 -75.300IDP00696 amino acid ABC transporter, ATP-binding protein SACOL2410 [Staphylococcus aureus subsp. aureus COL]  ali follow..  30  1....MIQLTNIHKSF----NDVEVIKGIDLSVEQGEVVTLIGRSGSGKTTLLRMINALEIPTEGTVYVNGKTYTSKDKKSQIEVRKQSGMVFQS---NLFPHKTALENVMEGLITVKKLKKDEARGKSLELLEKVGL-THVKDQRPHALSGGQQQRVAIARALAMNPKVMLFDEPTSALDPELVNDVLKVIKDLANE-GMTMVIVTHEMRFAKEVSNNIVFIHEGMIGEQGAPEEMFNRPKTEELRRFLNVI..... 240
27 -73.500IDP02457 ABC transporter, ATP-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1248 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  26  1MSESLIQVRDLSTKF----GKEWIHKDLNLDIPFEKISCIIGASGCGKTTLMREILMLQPIYSGKIFLLGQEISKLADNPIKAISSKMSMMFQH--CALFSSLTNLQNVIFPLRQHTKLPIDILTDIAIIKLKMVGLKEEAFNKYPSEISGGMLKRVALARTIALDPKVVFLDEPNAGLDPYSARAMDDLILYLKEELKMSVVMITHDLSTIWHIVDDIIYMDEKRIMLHDSVEFVSQQTQYESIRKFFDS...... 247
28 -73.300IDP00916 gene: metN; DL-methionine transporter ATP-binding subunit STM0247 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  34  1....MIKLSNITKVFQQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVQVGGQELTTLSESELTKARRQIGMIFQH---NLLSSRTVFGNVALPLELDNT-PKEEIKRRVTELLDLVGL-GDKHDSYPANLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTVSEVFSHPKTPLAQKFIQSTLHLDI 249
29 -73.000IDP01355 amino acid ABC transporter, ATP-binding protein VC0008 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  29  1....MIKLQNIHKRF----GTSEVLKGIDLEIQRGEIVVIIGSSGTGKSTLLRCVNFLEQADQGSIRIDELTVDKHTKADVLALRRKTGFVFQN---ALFAHLTARQNIAEALITVRGWKKAQAHQRAQQILDDIGL-GDKGDSYPAALSGGQQQRVGIGRAMALQPELLLFDEPTSALDPEWVGEVLALMKKLATQ-HQTMLVVTHEMQFAKEVADRVIFMAEGKIVEQGSPQDIFDHPQDPRLRKFLNQV..... 242
30 -72.800IDP02474 gene: pebC; amino acid ABC transporter ATP-binding protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0922c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  29  1....MIELKNVNKYY----GTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVVNNLVLN--HKNKIEICRKYCAMVFQH---NLYPHMTVLQNLTLAPMKLQKKSKKEAEETAFKYLKVVGL-LDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLDVMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTERARLFLGKI..... 239
31 -72.700IDP01758 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0728 [Coxiella burnetii RSA 493]  ali follow..  26  7.SEPLIEIHGLCNEF----GEQRVHDDLNLTIHRGEIVAIIGPSGCGKTTLLRSILMLRKPTAGTINVFGINILECSRAEALSVQRRWGVMFQS--SALFSSLRVLENVLFPLHEYSHLHSEAQTKLALLKIALVGLDREAVPKYPAELSGGMKKRAALARAMALDPELLFLDEPTTGLDAKSARELNELILHLRKTLELTFVMVTHDLDTLWQVPDRVFFLGEGKVLAALPM-DGLVHHKHPLIQDYFGSGKRTFR 255
32 -72.600IDP02015 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0107 [Coxiella burnetii RSA 493]  ali follow..  34  1....MIELRNVTKTYSAKQGGVLALSDINLRVSAGEMFGVIGKSGAGKSTLIRCVNLLERPDKGSVIVDGQVLTTLSSKVLRQARHRMGMVFQH---NLLSARTAYQNIAFPLQLLGK-NPTEIRKVVLPLLELTDL-TAKINAYPSQLSGGQKQRVAIARALVTNPTVLLCDEMTSALDPETTHSILQLLKNINRELNLSILLITHEMEVIKTVADRVAVLDQGRIVEENDVVSLFKRPKTEIAKKFTHSSIKVKL 249
33 -71.400IDP00608 phosphonate ABC transporter, ATP-binding protein SACOL0127 [Staphylococcus aureus subsp. aureus COL]  ali follow..  31  2...SQIEFKNVSKVY---PNGHVGLKNINLNIEKGEFAVIVGLSGAGKSTLLRSVNRLHDITSGEIFIQGKSITKAHGKALLEMRRNIGMIFQH---NLVKRSSVLRNVLSGRVGYHPLFPKEDKIKAMDALERVNI-LDKYNQRSDELSGGQQQRISIARALCQESEIILADEPVASLDPLTTKQVMDDLRKINQELGITILINLHFVDLAKEYGTRIIGLRDGEVVYDGPASEATDDVFSEIYGRTIKEDEKLG. 255
34 -71.000IDP00939 gene: glnQ; glutamine ABC transporter ATP-binding protein STM0828 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  32  1....MIEFKNVSKHF----GPTQVLHNIDLNIRQGEVVVIIGPSGSGKSTLLRCINKLEEITSGDLIVDGLKVNDPK-VDERLIRQEAGMVFQQ---YLFPHLTALENVMFGPLRVRGVKKEEAEKQAKALLAKVGL-AERAHHYPSELSGGQQQRVAIARALAVKPKMMLFDEPTSALDPELRHEVLKVMQDLAEE-GMTMVIVTHEIGFAEKVASRLIFIDKGRIAEDGSPQALIENPPSPRLQEFLQHV..... 239
35 -71.000IDP01113 amino acid ABC transporter, ATP-binding protein BA_0368 [Bacillus anthracis str. Ames]  ali follow..  29  1....MIQVRNLVKSF----GSLDVLKGIDLEVNEKEVVVLIGASGSGKSTLLRCLNFLEMYDEGEIHLQGERIDP-KHSNLNKVRENVGMVFQH---NLFPHMTSLENIIEAPIHVKKLETANAKEIGNQLLQKVGL-QDKADVTPHLLSGGQKQRIAIARALAMNPKIMLFDEPTSALDPELVGEVLQVMKELAEE-GMTMVIVTHEMNFARDVADRVIFMDDGKIVEDAPPAQFFSTPSHERAKQFLRNV..... 239
36 -70.700IDP01641 gene: artP; amino acid ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0481 [Coxiella burnetii RSA 493]  ali follow..  29  2...NKIQVESLKKSY----HGTVVLKEVSFAAKAGEVVTLLGDSGAGKSTLLRCLNLLEMPDEGRMVINDLEFHKPTRQSLIALRSKVGMVFQQ---HLWAHRTILQNLIEAPCQVLKISKAEAVKKAECLLDQVGI-LAKKDDYPARLSGGQQQRAAIARALMMEPEVMLFDEPTSALDPKMITAMRDLIHELAQK-GMTIVIATHEMKFAREVAHKTVFLHEGRIVEEGQPEVMFRSPKTQVFGDFIASV..... 248
37 -70.700IDP02608 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0178 [Coxiella burnetii RSA 493]  ali follow..  30  1....MITLDRITKFY--RSVKSPAVDSVSFEVKDGETLVLLGSSGSGKTTLMKMINRLIEPTSGTIKIEGKDVREYN---LSELRRSIGYVFQQ---GLFPHMTIEKNITILLKLLHY-PKAKRIQRAAELLEMVHLDPQKFQRYSDELSGGQQQRVGVARALAADPKYLLMDEPFGALDAMTRSALQEEMIHLNQKLGKTIVFVTHDIFEAFRIADRIAVMHKGKLEQIGTKNELLNNPATEFVEQLVKQPAQQIE 246
38 -70.500IDP00933 gene: gltL; glutamate/aspartate transporter STM0662 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  33  1....MITLKNVSKWY----GHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPVQKGEITVNGIIVND-KKTDLAKLRSRVGMVFQH---ELFPHLSIIENLTLAQVKVLKRDKAAARDKGLKLLERVGL-SAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEPTSALDPEMINEVLDVMVELANE-GMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKEEFFANPSSDRAKDFLAKI..... 239
39 -70.200IDP01147 amino acid ABC transporter, ATP-binding protein BA_0639 [Bacillus anthracis str. Ames]  ali follow..  30  2....LIEFRNVNKYY----GNFQVLKDINVQVKKGEVVVVVGPSGSGKSTLLRCINQLESITDGELIVQNTEVHN-AKTDMNELRRNIGMVFQH---YLYPHKTVLQNITLAPIKVNKISKEEAEKTAMFYLEKVGI-PEKANVYPHQLSGGQQQRVAIARGLAMQPEIMLFDEPTSALDPEMIGEVLDVMKTLAKE-GMTMVVVTHEMGFAREVADRILFMDDGKIIEDTTPAQFFASPEQERARLFLSRV..... 240
40 -70.100IDP00978 gene: yecC; putative amino-acid ABC transporter ATP-binding protein YecC STM1951 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  32  2...SAIEVTNLVKKF----HGQTVLHGIDLEVKPGEVVAIIGPSGSGKTTLLRCINLLEQPEAGTIKVGDIIIDSQQKGLIRQLRQHVGFVFQS---NLFPHRTVLENIIEGPVIVKGEPKAEATALARELLAKVGL-AGKESRYPRRLSGGQQQRVAIARALAMRPEVILFDEPTSALDPELVGEVLNTIRQLAQE-KRTMVIVTHEMSFARDVADRAIFMDQGQIVEQGPAKTLFADPQHPRTRQFLEKF..... 247
41 -69.800IDP01414 amino acid ABC transporter, ATP-binding protein VC1359 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  31  7.QDFMIQIKDMNKWY----GEFHVLKNINLNVKKGERIVICGPSGSGKSTMIRCINRLEEHQKGQIIVAGNELTE-DLKNIELVRREVGMCFQH---NLFPHLTVLENCTLAPIWVKKMPKDKAEEIAMKYLTRVRI-PEQADKYPGQLSGGQQQRVAIARSLCMNPQIMLFDEPTSALDPEMVREVLDVMVELAEE-GMTMLCVTHEMGFAKEVADRVIFMDAGEIIEENNPKEFFENPQSDRTQNFLAQI..... 248
42 -69.600IDP01464 ABC transporter, ATP-binding protein VC2520 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  30  3.QSDLVTIKNLRFSR----SQRVIFDDIDLHVPKGKVTAIMGPSGIGKTTLLRLIGGQLLPEQGEIWFDGENIPTLSRRKLYRARKKMSMLFQS--GALFTDLNVFDNVAYPLREHTELDEAMIKTLVLLKLEAVGL-RGAAYLMPSELSGGMARRAALARAIALDPELIMYDEPFVGQDPITMGVLVELIRNLNRALGVTSVVVSHDVPEVMSIADWVYLLADGKVIAQGSPQALRDNPDPRVQQFLCGDA..... 246
43 -69.200IDP01431 amino acid ABC transporter, ATP-binding protein VC1864 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  32  3.DVPALEIKNLHKTF----GQNEVLKGISLQAQKGDVISIIGSSGSGKSTFLRCINLLETPTAGEIWVKGELIQPAKEKQVQRIRSRLAMVFQS---NLWSHMTVLENVIEAPVHVLGVPKAQAIEQAERLLRKVGL-YERKDYYPGHLSGGQQQRAAIARALAVEPEVMLFDEPTSALDPELVGEVLGVMRDLAEE-GRTMLVVTHEMAFARDVSNHVMFLHQGKVEEQGKPEKLFKNPDSERLKQFISSI..... 255
44 -69.000IDP01340 phosphate ABC transporter, ATP-binding protein VCA0073 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  28  1MKTTKFNIENLDLFY----GENQALKSINLPIPTRQVTALIGPSGCGKSTLLRCLNRMNDLIEGKLTMDGQDVY--GNIDVSDLRIRVGMVFQKP--NPFP-MSIYENVAYGLRAQGIKDKKHLDEVVERSLRGAAL-KDRLKSHAFGLSGGQQQRLCIARTIAMEPDVILMDEPTSALDPIATHKIEELMEDLKK--NYTIVIVTHSMQQARRISDRTAFFLMGELVEHDDTQVIFSNPRDDRTRGYVNGD..... 249
45 -68.900IDP01505 amino acid ABC transporter, ATP-binding protein VCA1037 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  33  2...KVIEFHQVSKWY----GQFQALKSISLTVNKGEIVVICGPSGSGKSTLIRTVNGLESIDSGEIIVLPE-------DERTRRSGKIGMVFQH---NLFPHLTVLENLTLAPIRTLKLSAQEAKERAYHFLQRVKI-TDQTHKYPIQLSGGQQQRVAIARSLCMQPEILLFDEPTSALDPETINEVLEVMVDLAQD-GITMMCVTHEMGFARKVAHRVMFMDEGEILEVGSPEQLFQNPTHPRTQQFLNQI..... 236
46 -68.200IDP01157 Phosphonates import ATP-binding protein phnC BA_3749 [Bacillus anthracis str. Ames]  ali follow..  27  1....MIEFRNVSKVY---PNGTKGLNNINLKIQKGEFVVMVGLSGAGKSTLLRSVNRLHEITEGEIMIEGESITAAKGKGLRRMRRDIGMIFQS---NLVKRSTVLKNVLAGRVGYHSLFPKEDLELAFQSLKRVNI-LEKAYARADELSGGQQQRVSIARALAQEAKIILADEPVASLDPLTTKQVLEDLKKINEDFGITTIVNLHSIDLARQYATRIIGLHAGEIVFDGLVEEATDEKFAEIYGDVVQKS..... 249
47 -68.000IDP00944 gene: artP; arginine transporter ATP-binding subunit STM0891 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  32  3.....IQLNGINCFY----GAHQALFDITLDCPEGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLTIAGNHFDTPSDKAIRELRQNVGMVFQQ---NLWPHLTVVQNLIEAPCRVLGLTKDQALARAEKLLERLRL-KPYSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIHELAET-NITQVIVTHEVEVARKTASRVIYMENGHIVEHGDA-GCFAHPQTEAFKNYLS....... 241
48 -67.800IDP06166 ABC transporter ATP-binding protein [Helicobacter pylori J99] NP_223403 [Helicobacter pylori J99]  ali follow..  25  2..SVIIAANNLCLQYQQN---EPVIKHANLRIKRKDFVFISGPSGSGKSTLLRSFYGDLKVFSGKLEVCNINMNNASKSTILDLRKNIGVVFQD---KLIQDYTIEQNIKLPMVICGI-KKEECHLQLEKLLGHIDL-RHKANRYPKELSGGEQQRVAMARAMANCPELILADEPTGNLDDYSSDKIWSLLRGMNTQLNATIVVVTHKFPKNFSAYHRKFYIEEGEVYEYS.......................... 223
49 -67.600IDP00988 gene: yehX; putative ABC-type proline/glycine betaine transport system ATPase component STM2163 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  25  1....MIEFNHVSKTF----GDQQAVSDLNLHFSEGSFSVLIGTSGSGKSTTLKMINRLVEHDSGTIRFAGEEIRSLP---VLELRRRMGYAIQS---GLFPHWTVAQNIATVPQLQKW-SRARINDRIDELMALLGLESALRDRYPHQLSGGQQQRVGVARALAADPQVLLMDEPFGALDPVTRGALQQEMTRIHQLLGRTIVLVTHDIDEALRLADHLVLMDGGHVIQQGSPLSMLTSPENDFVQAFFGRSELGVR 243
50 -67.200IDP02684 gene: lolD; lipoprotein releasing system, subunit D, ABC transporter, ATP-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT0405 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  32  1MNDVVLSCKNVSKKYTEFKTDIAILKDVNLEIKKGEKVAILGLSGSGKTTLLNVLGGLDKCSAGEVYLMGERFDNQSVNKRAKMRNKLGFIYQ--LHHLLPEFTAIENVMIPLAITKKYTKKESIKLANEILKKVGL-DHRADHKPAELSGGERQRVAIARALVTNPNCILADEPTGNLDSQRSESIFALMQQLSDDFGTSFVIVTHDEKLASR-MNKIYRLVDGELEL............................ 226
51 -67.000IDP01607 ABC transporter, ATP-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1608 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  25  4.....ISFKNVSFYR----DSRCIYDDITFTIPTNKITTILGPSGAGKTTILQLIAGLIKPTLGKICIDNAIIEKTKETQLEKLRHRMGFLFQS--GALFTHLSVYDNIAFPLRKNTNLDEKLIRNIVLLKLQAVGL-AHTINMMPSELSGGMARRVALARSIAMDPDIMMYDEPFTGQDPASFNKLLELISTLNESLNMTSIIVSHDIQESLSISDHIIIVGNKKIIASDSPENIK-NSKDQQIQNFLAGKPLDYN 248
52 -66.800IDP90824 ABC transporter ATP-binding protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0774c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  32  1....MIKIKNLKKYY----GKELVINDVSLEIKKGEIYAIVGHSGAGKSTLLRCINGLENYQEGSLKVFDQEIKDLKSKELRMLRKDIGMIFQN---ALMERKNVFENVAMPLRTHYYMSEKEIAQKVNSLLEIVGL-DHKNKSYPRELSGGQKQRVAIARALALNPKILLSDEATSALDPNTTKNILELISKINAEFGITVVLVTHEMDVVKDIAQKALLLEHGQIIGSGAIDELFLRPNAKMKEFL......... 253
53 -66.500IDP02039 putative ABC transport ATP-binding subunit [Yersinia pestis CO92] YPO1198 [Yersinia pestis CO92]  ali follow..  27  1....MIQFHQVSKYF----AGKRAVDNLSLQISKGEFTVLIGTSGSGKSTTLKMINRLIEHDEGKIRFAGEEIRNYKPED---LRRRMGYAIQS---GLFPHWTVERNIATVPQLLKW-PKDRIRQRVVELLELLHLDPQQFHRYPHQLSGGQQQRVGVARALAVDPEVLLMDEPFGALDPVTRSALQLEITRIHQLSGRTIVLVTHDIDEALSLADRIVLMDEGRVIQQGTPLEMLAQPANDFVRDFFGRSDLGIK 244
54 -65.100IDP02381 gene: proV-1; glycine betaine/L-proline ABC transporter, ATP-binding protein [Bacillus anthracis str. `Ames Ancestor`] GBAA2279 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  27  1....MIQFNQVSKSY---EDGTKAVDSLHLEIKKGEFFVLIGPSGCGKTTTMKMINRLIETTEGSILIDGKDIQQYNINE---LRWDIGYVLQQ---ALFPHMTIAENIAVVPEMRKW-SKEKIKARVDELLQMVGLDPDVYNRMPDELSGGQKQRIGVVRALAANPKIVLMDEPFSALDPLSREQLQKDIVQLQKKIQKTIVFVTHDMQEALSLGDRICIMKEGKVVQLDTPEGIIHNPKNEFVEEFIGNRGRPWY 245
55 -65.000IDP06323 phosphate transporter ATP-binding protein [Streptococcus pneumoniae TIGR4] NP_345855 [Streptococcus pneumoniae TIGR4]  ali follow..  22  17.EKVALSTKDVHVYY----GKNESIKGIDMQFERNKITALIGPSGSGKSTYLRSLNRMNDKVTGQILYRGIDVNR-PEINVYEMRKHIGMVFQRP--NPFAK-SIYRNITFAHERAGVKDKQVLDEIVETSLRQAALWDQDLHKSALTLSGGQQQRLCIARAISVKPDILLMDEPASALDPIATMQLEETMFELKK--NFTIIIVTHNMQQAARASDYTGFFYLGDLIEYDKTATIFQNAKLQSTNDYVSGH..... 265
56 -64.800IDP00731 ABC transporter, ATP-binding protein SACOL2462 [Staphylococcus aureus subsp. aureus COL]  ali follow..  29  2....LLEIKDLVYKA----SDRIILDHISLKVDKGESIAIIGPSGSGKSTFQKQICNLFSPTSGELYFKGKPYNDYDPEE---LRQRISYLMQQSD------ETIEDNMIFPSLAR---NDKFDRKRAKQLIKDVGLGHYQLSSEVENMSGGERQRIAIARQLMYTPDILLLDESTSALDVNNKEKIENIIFKLADQ-GVAIMWITHSDDQSMRHFQKRITIVDGQISNTEELNQ...................... 218
57 -64.800IDP02687 hypothetical protein lmo2580 [Listeria monocytogenes EGD-e] lmo2580 [Listeria monocytogenes EGD-e]  ali follow..  30  2....TLMMKNITKNYQDGEQVIEVLKNVSLEVAQGEFVAIVGPSGAGKSTFLSIAGALLSPTEGEIAIGGKVLNDLTSKDLTKVRLDVGFIFQG---NLIPYLNVRDQLLVIAELSGD-KGRVAKEKADELLKELGL-TARENNYPESLSGGEKQRVAIARALMNDPDIILADEPTASLDASRGHKVVQMIADEVKRKNKAAIMVTHDERVLDL-VDRVIRIEDGYLKD............................ 222
58 -64.700IDP02371 gene: ftsE; cell division ABC transporter, ATP-binding protein FtsE [Coxiella burnetii RSA 493] CBU_1904 [Coxiella burnetii RSA 493]  ali follow..  33  1....MIRFANVTKNYPNG---HQALNNISFTLKQGEMAFLTGHSGAGKTTLLKLMMMIEAITRGQIYINNRNLSRLSKRQIPYLRRRIGMIFQN---QLLYHRTVFDNVGIPLVISGY-RHSEIKRRVRAALDKVGL-LKKEKLYPFSLSTGEQQRIGIARAIVNKPMLVIADEPTGNLDPELSSEIMRLFEAFNAV-GVTVLIATHDLSLIAPLNYRIITLKEGRLVE............................ 217
59 -64.300IDP01333 phosphate ABC transporter, ATP-binding protein VC0726 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  28  23.QQTAISIEHLSLYY----QQSRALSDISMRIPKGQVTAFIGPSGCGKSTLLRCINRMNDLVEGEVKLHGKNIYH-PDVDVPTLRRRVGMVFQRP--NPFPK-SIYENVVYGLRLQGIKNSRALDDAAEQSLRAAALWKHRLHENAFGLSGGQQQRLVIARAIAIEPEVLLLDEPTSALDPISTLTIEELIHDLKT--KYTVVIVTHNMQQAARVSDHTAFIHMGKLIEYADTDSIFTSPLKKQTEDYITG...... 270
60 -64.300IDP00547 gene: ftsE; cell division protein FtsE YPO3813 [Yersinia pestis CO92]  ali follow..  31  1....MIRFEQVSKAYLGG---RQALQGVDFHLRPAEMAFLTGHSGAGKSTLLKLICGIERPSAGHIWFGGHDISRLKNREVPFLRRQIGMIFQD---HLLLDRTVYDNVAMPLIIAGA-SSEDIRRRVSAALDKVGL-LDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLLADEPTGNLDDALSEGILRLFEEFNRV-GVTVLMATHDTSLIARRRYPILTLSQGRMSGAHHGE....................... 222
61 -64.200IDP00865 gene: ftsE; cell division protein FtsE STM3570 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  32  1....MIRFEHVSKAYLGG---RQALQGVTFHMRPGEMAFLTGHSGAGKSTLLKLICGIERPSAGKIFFSGHDITRLKNREVPFLRRQIGMIFQD---HLLMDRTVYDNVAIPLIIAGA-SGDDIRRRVSAALDKVGL-LDKARNFPIQLSGGEQQRVGIARAVVNKPAVLLADEPTGNLDDALSEGILRLFEEFNRV-GVTVLMATHDIGLISRRSYRQLVLSDGHLHGGLANE....................... 222
62 -64.200IDP00958 gene: lolD; lipoprotein transporter ATP-binding subunit STM1218 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  32  1MNKILLQCDNLCKRYQEGTVQTDVLHDVSFSIGEGEMMAIVGSSGSGKSTLLHLLGGLDTPTSGDVIFSGQPMSKLSSAAKAELRNQLGFIYQ--FHHLLPDFTALENVAMPLLIGKK-KPAEIDARAREMLHAVGL-EHRATHRPSELSGGERQRVAIARALVNNPRLVLADEPTGNLDARNADSIFELLGELNRLQGTAFLVVTHDLQLAKR-MSRQLEMRDGRLTA............................ 225
63 -64.100IDP01520 ABC transporter, ATP-binding protein VCA0782 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  31  1MQTSIISAQSLSKLVSTNQEHLTILKQVNLSIQAGESVAIVGASGAGKSTLMTLLAGLDTPSEGEVYLLGKPLSQLDDEARAALRSEVGFVFQS---LLIPSLSALENVTLPCLLKG---EAEDRERAQKLLKAVGL-EHRMHHSPAQLSGGEQQRVAIARAFMISPQVLFADEPTGNLDQETAAKVIDLLFELNREHGTTLVLVTHDPKLAQR-CQRRFFMQAGELEE............................ 223
64 -64.000IDP00729 ABC transporter, ATP-binding protein SACOL2356 [Staphylococcus aureus subsp. aureus COL]  ali follow..  31  2....ALVVEDIVKNFGEGLSETKVLKGINFEVEQGEFVILNGASGSGKTTLLTILGGLLSQTSGTVLYNDAPLFDKQHRPSDLRLEDIGFIFQS---HLVPYLKVIEQLTLVGQEAGM-TKQQSSTRAIQLLKNIGL-EDRLNVYPHQLSGGEKQRVAIMRAFMNNPKIILADEPTASLDADRATKVVEMIRQQIKEQQMIGIMITHDRRLFEY-ADRVIELEDGKITD............................ 221
65 -64.000IDP00730 amino acid ABC transporter, ATP-binding protein SACOL2453 [Staphylococcus aureus subsp. aureus COL]  ali follow..  30  1....MLSIKHLTKIY---SGNKKAVDDISLDIQSGEFIAFIGTSGSGKTTALRMINRMIEATEGQIEIDGKDVRSMNPVE---LRRNIGYVIQQ---GLMPHMTIKENIVLVPKLLKW-TKEEKDKRAKELIKLVDLPESFLERYPAELSGGQQQRIGVVRALAAEQDIILMDEPFGALDPITRDTLQDLVKTLQRKLGKTFIFVTHDMDEAIKLADKICIMSEGKVVQFDTPDNILRHPANDFVRDFIGQNRLIQD 244
66 -63.900IDP06314 cell division ABC transporter ATP-binding protein FtsE [Streptococcus pneumoniae TIGR4] NP_345254 [Streptococcus pneumoniae TIGR4]  ali follow..  29  2...SIIEMRDVVKKYDNG---TTALRGVSVSVQPGEFAYIVGPSGAGKSTFIRSLYREVKIDKGSLSVAGFNLVKIKKKDVPLLRRSVGVVFQD---KLLPKKTVYENIAYAMEVIGE-NRRNIKRRVMEVLDLVGL-KHKVRSFPNELSGGEQQRIAIARAIVNNPKVLIADEPTGNLDPDNSWEIMNLLERINLQ-GTTILMATHNSQIVNTLRHRVIAIENGRVVRDESKGEYGYD.................. 229
67 -63.600IDP01341 gene: fbpC; ferric transporter ATP-binding subunit VCA0687 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  29  3.KQNFVVLKNICKRF----GSNTVIGNLDLEIKKGSLVTLLGPSGCGKTTVLRLVAGLEKPTSGQIFIDGEDVTERSIQ-----QRDICMVFQS---ALFPHMSLYENVAYGLKMLKL-PSEEVRQRVDEALKIVDL-EGMGERYVDQISGGQQQRVALARALVLKPKVLLFDEPLSNLDANLRRSMRETIRELQQRFDITSLYVTHDQAEAFAVSDTVIVMKQGDIMQIGTPQELYKAPKSMFMANFMGEANMFQG 245
68 -63.500IDP01425 ABC transporter, ATP-binding protein VC1630 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  31  1MSGSMLQLIDLCKGYVDGDEFHPVLQGAELTLNQGDQLALMGESGSGKSTLLNLIAGLDSADSGEIWFPGFPMHHTSEHHRTAFRRDIGQIFQQ---NLLPTLNIADNIRFCRQLKGL---PEDAGLWRQILSALDL-MPLLGRYPEEVSGGQQQRAAIARALYMEPKILLADEPTGSLDERNAEAVMRLLTTLTRQLNCALLLVTHSEKVAQH-MDGCIRLQGGQLHV............................ 223
69 -63.300IDP02070 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_1809 [Coxiella burnetii RSA 493]  ali follow..  36  1....MIEFKNITKVYQFGSNSYKALKGVSFLIEKGELVGIIGASGSGKTTTMNILGLLDHPTSGEYLLRNKNVAYLSPNQRADLRNRIGFIFQL---FLLPRLNALQNVGLPLTYRNL-SGKRINKRALTMLERVGM-AKFHHHKPSELSGGQQQRVAIARALVGKPDIILADEPTGALDSKTSQEVLDLLIQLNREEGCTVVLITHDEQIAAQ-CPRVIKMHDGLIVP............................ 221
70 -63.200IDP00921 gene: ybbA; putative ABC transporter ATP-binding protein YbbA STM0507 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  31  3.AENSVEVHRLRKSVGQGEHELSILTGVELVVKRGETIALIGESGSGKSTLLAILAGLDDGSSGEVSLVGKPLHQMDEEARAQLRAQVGFVFQS---MLIPTLNALENVELPALLRGE-NSGQSKAGAKALLEQLGL-GKRLDHLPAQLSGGEQQRVALARAFNGRPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLILVTHDPALAAR-CDRRLRLVNGQLQEEA.......................... 228
71 -63.100IDP00713 spermidine/putrescine ABC transporter, ATP-binding protein SACOL1108 [Staphylococcus aureus subsp. aureus COL]  ali follow..  36  2..EPLLSLKSVSKSY----DDLNILDDIDIDIESGYFYTLLGPSGCGKTTILKLIAGFEYPDSGEVIYQNKPIGNLPPN-----KRKVNTVFQD---ALFPHLNVYDNIAFGLKLKKL-SKTEIDQKVTEALKLVKL-SGYEKRNINEMSGGQKQRVAIARAIVNEPEILLLDESLSALDLKLRTEMQYELRELQSRLGITFIFVTHDQEEALALSDFLFVLKDGKIQQFGTPTDIYDEPVNRFVADFIGESNIVEG 243
72 -63.000IDP01320 ABC transporter, ATP-binding protein VC1883 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  29  2..NNLLRCHQVCKTYQEGELQTQVLKGVSFELKRGELVSIIGSSGSGKSTLLHILGALDDASEGQVEFLGQSLHQLSSNKQAKIRNQLGFVYQ--FHHLLADFSALENVAMPLLIGGM-NVAKAKAKAQSLLERVGL-GHRVAHRPSELSGGERQRVAIARALVNKPDLVLADEPTGNLDHKTALSIYDLMRELNRESGTAFLVVTHDGELAAK-MDRHMHMKDGLLTDITGA........................ 228
73 -62.900IDP01671 gene: cysA; sulfate/thiosulfate transporter subunit [Yersinia pestis CO92] YPO3012 [Yersinia pestis CO92]  ali follow..  33  3.....IEINNISKYF----GRTKVLNDITLDIPSGQMVALLGPSGSGKTTLLRIIAGLENQNAGRLSFHGTDVSRLHAR-----DRRVGFVFQH---ALFRHMTVFDNIAFGLTVRERPNAAAIKQKVGQLLEMVQL-GHLAERFPSQLSGGQKQRVALARALAVEPQILLLDEPFGALDAQVRKELRRWLRQLHEELKFTSVFVTHDQEEAMEVADRVVVVSQGNIEQVGTPDEVWREPATRFVLEFLGEVNRLSG 245
74 -62.900IDP01336 gene: potA; putrescine/spermidine ABC transporter ATPase protein VC1428 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  30  13VGKPVIRLSGISKSF----DGKEIIGNLNLDVNHGEFLTILGPSGCGKTTVLRMIAGFETADQGQILLDDQDVTQVPAE-----QRHVNTVFQS---ALFPHMTVFENVAFGLRMQKV-PQSEIEPRVMEALRMVRL-AEMAQRKPHQLSGGQQQRIAIARAVVNKPKVLLLDESLSALDYKLRKQMQSELKQLQRQLGITFIFVTHDQEEALSMSDRIIVMRSGKIEQDGSPREIYEDPKNLFVARFIGEINVFQA 256
75 -62.600IDP00705 ABC transporter, ATP-binding protein SACOL0306 [Staphylococcus aureus subsp. aureus COL]  ali follow..  29  1....MLKFENVTKSFKDGNRNIEAVKDTNFEINKGDIIALVGPSGSGKSTFLTMAGALQTPTSGHILINNQDITTMKQKALAKVRMSIGFILQA---NLVPFLTVKQQFTLLKKKNK---NVMSNEDYQQLMSQLGL-TSLLNKLPSEISGGQKQRVAIAKALYTNPSIILADEPTAALDTENAIEVIKILRDQAKQRKKACIIVTHDERLKAY-CDRSYHMKDGVLNLENETVE...................... 225

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.