Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: IDP01306 PTS system, cellobiose-specific IIB component VC1281 [Vibrio cholerae O1 biovar El Tor str. N16961], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MKKILLCCSAGMSTSMLVKKMQQAAESKGIECKIDALSVNAFEEAIQEYDVCLLGPQVRFQLEELRKTADEYGKNIAAISPQAYGMMKGDEVLQQALDLINLast
1 -57.100IDP01306 PTS system, cellobiose-specific IIB component VC1281 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali  100  1MKKILLCCSAGMSTSMLVKKMQQAAESKGIECKIDALSVNAFEEAIQEYDVCLLGPQVRFQLEELRKTADEYGKNIAAISPQAYGMMKGDEVLQQALDLIN 101
2 -54.200IDP01818 gene: celA-2; PTS system, cellobiose-specific IIB component [Bacillus anthracis str. `Ames Ancestor`] GBAA5444 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  52  1.MNILLCCSAGMSTSLLVTKMEAAAKARGLEGKIWAVSGDAVKTNIDQADVLLLGPQVRYMLSSMKTLADERNVGIDVINPMHYGMMNGEAVLDHALTLKK 100
3 -54.100IDP01852 gene: celA-3; PTS system, cellobiose-specific IIB component [Bacillus anthracis str. `Ames Ancestor`] GBAA5449 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  44  1.MNILLCCAAGMSSSLIVTKMEKAAEARGIEVKIWAVSGSEVNSHIDEADVLLLGPQVRYLLPKMKELCKGKGVPVDVIQSVHYGLCNGEAILQAALSMKP 100
4 -54.000IDP01795 gene: celA-1; PTS system, cellobiose-specific IIB component [Bacillus anthracis str. `Ames Ancestor`] GBAA0792 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  42  1.MYILLCCAAGMSTSMVVRKMQEEAKKQGKDYKIKAVDSELVKLEIKNADVVLIGPQVKYLFPAVQFLAKSYDIPVAIIEQRDYGMCDGLKVLKQAEQLVL 100
5 -53.600IDP05707 hypothetical protein lmo2762 [Listeria monocytogenes EGD-e] lmo2762 [Listeria monocytogenes EGD-e]  ali follow..  42  1MKKILLVCAAGMSTSLLVTKMKAHATSIGEEIEIEALPVSEASNVVDKMDIVMLGPQVRYQKPQVDELVQG-RIPVIVIDMKDYGMLNGKAVLEKAFAEIG 100
6 -53.400IDP05643 PTS system, IIB component [Clostridium difficile 630] CD3082 [Peptoclostridium difficile 630]  ali follow..  37  12NIRVLLACGSGASTGFMATSMRKSAKKKGIEADIKARSESEIDKYLSEIDCLLLGPHLDYMKEEIQQKANEYNVPVACISKTAYGRLDGAKALEEALELIS 112
7 -53.200IDP05281 PTS system, IIB component [Clostridium difficile 630] CD0136 [Peptoclostridium difficile 630]  ali follow..  37  2KRKVYLFCSFGMSTSLLADKMQKVADEHNLPIEVEAFPIAEIDKIVENPDCILLGPQVKYMLKELKPKFEAQGKLIDIINEVDYGTMNGEKVLKLAIKLIK 104
8 -51.400IDP02601 PTS system, cellobiose-specific IIB component, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA2462 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  34  1.MKVLFVCSGGMSSAIVVNALKKEAEKKGVNMEVHAIGTSEVEEVKNGWDVVMVAPQVRHRFDSVKKFAEEESIPCGIIPPQAYTPLGGPTLLKTVNDLIR 101
9 -51.200IDP05551 putative PTS system, IIB component [Clostridium difficile 630] CD3049 [Peptoclostridium difficile 630]  ali follow..  31  1.MRVLFVCSSGMSSAIAVNALQKEGAKNGIDIDVLAVGTQEFEDEVNGWDIAMVAPQVRHRFDYLKAFADEVSVPCALIQAQAYSPLGGPKLLKQVQELLS 101
10 -11.200IDP05311 PTS system, IIB component [Clostridium difficile 630] CD3014 [Peptoclostridium difficile 630]  ali follow..  17  8....VTACATGVAHTYMAQALKKASKKMGHLIKVETQGATGIDKDAQIAEVVIFAVDT-----KVRNAERFEGKEILEVPVNA-PIKDAEKVINDALKLID 104
11 -10.900IDP05115 PTS system, IIB component [Clostridium difficile 630] CD2567 [Peptoclostridium difficile 630]  ali follow..  20  6....ITSCIAGLAHTPMAKALEQAASKMGHEIKVEQQGAMGRVEEAQDADFILIASDQ-----TISGMERFDGKKVIKVKIGI-ALKKPEAVLTKCIEAIS 102
12 -10.900IDP05665 hypothetical protein lmo0427 [Listeria monocytogenes EGD-e] lmo0427 [Listeria monocytogenes EGD-e]  ali follow..  17  1MKRKIIACATGVAHTYMAQALKKGAKKMGNLIKVETQGATGIEKDVNIGEVVIFAVDT-----KVRNKERFDGKVVLEVPVSA-PIKDAEKVINAALALID 104
13 -10.400IDP05349 PTS system, IIB component [Clostridium difficile 630] CD2487 [Peptoclostridium difficile 630]  ali follow..  13  8....LCACPMGLAHTFMAEAIEQAAKALGYEAKVETQGADGVQDDILGATMIIHAVAI-----TPEGMERFDGCEVYEVELQE-AIKNAEGVIKEIEEDLG 104
14 -9.300IDP00950 gene: wraB; TrpR binding protein WrbA STM1119 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  20  1MAKILVL-SMYGHIETMAHAVAEGAKKVDGAEVIIKRAPVATPQELADYDAIIFGPRFGNMSGQMRTFLDQTG............................ 95
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.