current user: public

If you have questions about the server, please let us know.

Query: IDP01368 transferase, hexapeptide repeat family VC0238 [Vibrio cholerae O1 biovar El Tor str. N16961], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst MQMAGFGLIAKLRNKIRVKPNNKIQIGKNTRIRYCDIYVNGNNNQLIIHNGANLKGVSIELNGNNCLLEIGENCVIGENCFLSCRESGTKLVIGKECMFSRNVKLMTSDGHDILRDGKRINPAKSIYIGSHVWLADNVTILKGVDIGSGSIIGINSTVTKSIGQYCIAAGNPARKIKDNISWNTTLSYLast
1 -74.500IDP01368 transferase, hexapeptide repeat family VC0238 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali  100  1MQMAGFGLIAKLRNKIRVKPNNKIQIGKNTRIRYCDIYVNGNNNQLIIHNGANLKGVSIELNGNNCLLEIGENCVIGENCFLSCRESGTKLVIGKECMFSRNVKLMTSDGHDILRDGKRINPAKSIYIGSHVWLADNVTILKGVDIGSGSIIGINSTVTKSIGQYCIAAGNPARKIKDNISWNTTLSY 188
2 -44.800IDP04551 gene: maa; maltose transacetylase [Clostridium perfringens ATCC 13124] CPF_2912 [Clostridium perfringens ATCC 13124]  ali follow..  25  65..............................................STGESIYMEPNFKCDYGYN--ISVGNNFYANFDCVML---DVCKITIGENCFFAPGVHIYTATHPIDPIERLNYEFGKPVTIGNNVWIGGHATINPGVTIGNNVVVASGAVVTKDVPDNVVVGGNPAKIIKK.......... 191
3 -44.300IDP01515 hexapeptide-repeat containing-acetyltransferase VCA0836 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  23  56...............................................LGHKSCVQPPFHCEFGKT--IRIGDHTFINMNVVML---DGAPITIGDHVLIGPSTQFYTAS-HSLDYRRRQETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPPDTLVGGTPARILRS.......... 182
4 -44.200IDP01020 gene: wcaF; putative colanic acid biosynthesis acetyltransferase WcaF STM2110 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  28  53..............................................KIGKNVVIRPSVKITYPWK--LTVGDYAWVGDDAVLY---TLGEINIGAHAVISQKGYLCTGS-HDYTSAHFDI-NAAPIVIGEKCWLATDVFVAPGVTIGHGTVVGARSSVFKSLPANAICRGNPAVVTRQ.......... 177
5 -44.000IDP02453 gene: maA; maltose O-acetyltransferase [Bacillus anthracis str. `Ames Ancestor`] GBAA3402 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  27  73................................................................GYNIHVGKSFFANFNCVIL---DVCEVRIGDHCMFAPGVHIYTAT-HPLHPVERNKEYGKPVKIGNNVWVGGGAIINPGVSIGDNAVIASGAVVTKDVPNNVVVGGNPAKVIKT.......... 184
6 -43.800IDP05262 gene: maa; maltose O-acetyltransferase [Clostridium difficile 630] CD0872 [Peptoclostridium difficile 630]  ali follow..  31  56...............................................VGKQINVEQNIRCDYGYN--IHVGENFFANYDCIFL---DVCKIEIGDNVMLAPNVQIYTAY-HPIDAQLRNIEYGSPVKIGDNVWIGGGVIITPGITIGDNVVIGAGSVVTKDIPPNTVAVGNPCRVIKK.......... 182
7 -43.500IDP00698 galactoside O-acetyltransferase SACOL2570 [Staphylococcus aureus subsp. aureus COL]  ali follow..  29  57...............................................TTDNVSISIPFDTDYGWN--VKLGKNVYVNTNCYFM---DGGQITIGDNVFIGPNCGFYTAT-HPLNFHHRNFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRK.......... 183
8 -43.400IDP02428 O-acetyltransferase, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA3580 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  20  16.......................LSVGKNVLISKKASIY--NPGVISVGNNVRIDDFCIL----SGKVTIGSYSHIAAYTALYGGEVG--IEMYDFANISSRTIVYAAIDGPTIPNQYKNVKTGKVILKKHVIIGAHSIIFPNVVIGEGVAVGAMSMVKESLDDWYIYVGVPVRKIKAR......... 171
9 -43.000IDP06500 hypothetical protein spr0965 [Streptococcus pneumoniae R6] NP_358559 [Streptococcus pneumoniae R6]  ali follow..  17  65....TIGNNCLFFPRTLIYSKETFSLGTRGKISKDCIF---RANKINIGREFWCNEAVRIWNQKSANIKIGDYQFIGPRAQINV---SDSVELMGYGGLGIETMIFTHGAHGQSATDGFYAEQNKVIIQKNVSILTRAIILPGVIVSQGTTVAANAIVTKSFPKHSLIGGVPARYIGQ.......... 237
10 -42.400IDP04303 gene: lacA; galactoside O-acetyltransferase [Clostridium perfringens ATCC 13124] CPF_0251 [Clostridium perfringens ATCC 13124]  ali follow..  28  59...............................................IGDDCYIEPPFHANWGGK-NVHFGNGVYANFNLTMV---DDCDIFVGNNVMFGPNVTVSAGT-HPIHPELRSAQYNIPIHIGNNVWIGANSVILPGVNIGDNSVIGAGSIVTKDIPSNVVAVGNPCRVLRE.......... 186
11 -42.000IDP00054 acetyltransferase, CYSE/LACA/LPXA/NODL family BA_3600 [Bacillus anthracis str. Ames]  ali follow..  29  12..................................................................KYDIGDYTYSKVGPTIFSWNDETKLKIGKFCSLGEEVVFLLGGEHRAAHITGHPSSKGDIVVGNDVWIGYQSCISSGVTIGNGAIIGARSVITKDVPPYAIVAGNPAKFVRYRFP....... 141
12 -40.800IDP00661 acetyltransferase, putative SACOL0827 [Staphylococcus aureus subsp. aureus COL]  ali follow..  24  56...................................................................INIGNQSSIAYKVMLDIFYPE-LITIGSNSVIGYNVTILTHE-ALVDEFRY-----GPVTIGSNTLIGANATILPGITIGDNVKVAAGTVVSKDIPDNGFAYGNPMYIKMIR......... 160
13 -39.800IDP02750 transferase hexapeptide domain-containing protein [Bacillus anthracis str. `Ames Ancestor`] GBAA5389 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  25  56...................................................................MKVGKKTSFALMVMPDIMFPE-KITVGDNSIIGYNTTLLAHEY------LIREYRLGEIVIGNEVMIGANTTILPGVRIGDGAIVSAGTLVHKDVPSGAFVGGNPMRVIYT.......... 159
14 -37.000IDP91546 gene: vat; acetyltransferase [Staphylococcus aureus] AAA26683 [Staphylococcus aureus]  ali follow..  29  33.................................................................ENILVGEYSYYDSKRGESFEDQVDKLIIGRFCSIGPGTTFIMNGANHRMPSLKDLPLKGDIEIGNDVWIGRDVTIMPGVKIGDGAIIAAEAVVTKNVAPYSIVGGNPLKFIRKRLQW...... 186
15 -37.000IDP93935 chloramphenicol acetyltransferase [Yersinia enterocolitica subsp. enterocolitica WA-314] EKA27919 [Yersinia enterocolitica subsp. enterocolitica WA-314]  ali follow..  32  34..................................................................NIIIGDYTYYDDPQDSENFERGDKLIIGKFCALAHGVKFMNGANHKMAPSRDELPYKGDTHVGNDVWIGYDVLIMPGVTIGNGAIISSRSVVTRDVPAYSVVGGNPATLIKNRIAW...... 188
16 -36.900IDP00043 acetyltransferase, CYSE/LACA/LPXA/NODL family BA_2629 [Bacillus anthracis str. Ames]  ali follow..  29  26................................................................KANILVGDYSYYDAKDGETFEDRGDRLIIGKFCCIASGVTFMNGANHRMTPNLSDLPYKGDTVIGNDVWIGMDATIMPGIKIGDGAIIAAKSVVTRDVAPYTIVGGNPANKIRERIQW...... 181
17 -36.900IDP00651 gene: cap5H; capsular polysaccharide biosynthesis protein Cap5H SACOL0143 [Staphylococcus aureus subsp. aureus COL]  ali follow..  28  49..................................................................NSHIGEYSYIGFGSDF------NNVEVGRYCSISSDVKIGLGK-HPTQKFIDFNDQPSRTTIKNDVWIGANVIIMDGLTINTGAVIAAGSVVTKNVGAYEVVGGVPAKVIKKRFDWEKT... 191
18 -36.500IDP92709 gene: satA; streptogramin A acetyltransferase [Enterococcus faecium] AAA24783 [Enterococcus faecium]  ali follow..  31  29..................................................................NVEVGEYSYYDSKNGETFDKLNDKLKIGKFCSIGPGVTIIMNGANKHMPKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEIKQRIKW...... 181
19 -36.500IDP01143 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase, putative BA_4194 [Bacillus anthracis str. Ames]  ali follow..  28  101..........................................RDHVEIGDNAVIMMNATI----NIGAVIGEGSMIDMNAVL-----GGRATVGKNCHVGAGAVLAGV---------IEPPSAKPVIVEDDVVIGANVVVLEGVTVGKGAVVAAGAVVTEDVPPYTVVAGTPARVIKE.......... 218
20 -35.700IDP01350 chloramphenicol acetyltransferase VCA0300 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  28  21..................................................................NIIVGKHSYYSGYYHGHSFDDCVKLVIGSFCSIGSGAVFMMAGGHRSADARDGFTRSGDTIIGHDVWIGTEAMIMPGVKIGHGAIIASRSVVTKDVAPYEVVGSNPAKHIKFRMAW...... 176
21 -35.000IDP01349 antibiotic acetyltransferase VCA0253 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  25  53................................................................GFEASVVRYLHGDEISQRWDPLWEDQLVIGDYVCIGAEVVILMGGNHTMDVIEQAYVGKGNTEIGDGAWLGMRAMIMPGVKIGEGAIVAANSVVTKDVAPYSIVAGSPAQLVKYRLKV...... 193
22 -31.300IDP00571 gene: dapD; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase YPO1041 [Yersinia pestis CO92]  ali follow..  16  112..........................................RKGAFIARNTVLMPSYV-----NIGAFVDEGTMVDTWATV-----GSCAQIGKNVHLSGGVGIGGV-------------QANPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEVHYGRVPA......... 229
23 -30.900IDP01785 gene: dapD; 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [Coxiella burnetii RSA 493] CBU_0667 [Coxiella burnetii RSA 493]  ali follow..  17  113.............................................AYLAPNTVLMPSYI-----NIGAYVDSGTLIDTWATV-----GSCAQIGKNVHLSGGAGIGGV-------------QAHPTIIEDDCFIGARSEIVEGVMVEKGSVISMGVFVGQSTPIYNRQTQEITYGRIPA......... 227
24 -29.100IDP05257 putative transferase [Clostridium difficile 630] CD2748 [Peptoclostridium difficile 630]  ali follow..  19  26...........................................GNVKIGKDSSIWYNAVV-RGDEGPITIGENTNIQDCSIVHG---DTETIIGNNVTVGHRSIVH------------------GCKISDNVLIGMGSIILDNAEIGEYTLIGAGTLITKKFPPGVLIMGSPGKVVRE.......... 140
25 -28.300IDP00898 gene: wcaB; putative colanic acid biosynthesis acetyltransferase WcaB STM2114 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  25  58...................................................................YEIQAAATIGRRFTI---HHGYAVVINKHVVAGDDFTIR----HGVTIGNRGADSLACPVIGNGVELGANVILLGDITIGNHVTIGAGSVVLDSIPDHALVVGEKARVKVST......... 162
26 -27.000IDP01056 gene: yrdA; putative ferripyochelin-binding protein STM3399 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  18  1...........MSDTLRPYKNLFPGIGQRVMIDTSSVVI----GDVRLADDVGIWPLVVI-RGDVNYVAIGARTNIQDGSVLHVTHKSSSNPHGNPLIIGEDVTV----GHKVM---------HGCTIGNRVLVGMGSIVLDGAIIEDDVMIGAGSLVPKRLESGYLYLGSPVKQIRP.......... 152
27 -25.800IDP90794 gene: cysE; serine acetyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0763c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  21  68...................................................................VDLHPGAELGRRIFI---DHANGVVIGQTAIIEDDVLIYQG---TLGGTSLEKGTKRHPTIKKGVIIGSGAKVLGNITIGENAKIGSNAVVVKDIGANLTAVGIPAYIIEER......... 174
28 -25.200IDP02535 gene: cysE; serine O-acetyltransferase [Bacillus anthracis str. `Ames Ancestor`] GBAA0088 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  27  66...................................................................IEIHPGATIGRRFFI---DHGMGVVIGETCEIGDNVTIYQG---TLGGTGKEKGKRHP-TIQDNVLIATGAKVLGSITVGENSKIGAGSVVLKEVPAHSTVVGIPGRVVIQN......... 171
29 -24.200IDP01343 gene: cysE; serine acetyltransferase VC2649 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  24  142...................................................................VDIHPAARIGRGIML---DHATGIVIGETAVVEDDVSILQD---TLGGTGKECGDRHP-KIREGVMIGAGAKILGNIEVGEGAKIGSGSVVLQAVPPHTTVAGVPARIVGRP......... 247
30 -24.000IDP00538 gene: cysE; serine acetyltransferase YPO0070 [Yersinia pestis CO92]  ali follow..  27  142...................................................................VDIHPAATIGCGIML---DHATGIVIGETAVVENDVSILQS---TLGGTGKTSGDRHP-KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVGKP......... 247
31 -21.800IDP01019 gene: lpxA; UDP-N-acetylglucosamine acyltransferase STM0228 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  16  44.....LKSHVVVNGQTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTITVQGGGLTKVGSDNLLMINAHV-----AHDCTVGNRCILANNATL-----------------AGHVSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNI........ 199
32 -21.800IDP90556 gene: lpxA; UDP-N-acetylglucosamine acyltransferase YPO1056 [Yersinia pestis CO92]  ali follow..  16  44.....LKSHVVVNGITKIGCDNQIYQFASIGEANQDLKYAGEPTRVEVGDRNRIRESVTITTQGGGVTKVGCDNLLMVNTHV-----AHDCVIGNRCILANNAAL-----------------GGHVEIDDYAIIGGMTAIHQFCVIGAHVMVGGCSGITQDVPPFVIAQGNHATPFGINI........ 199
33 -21.600IDP01449 UDP-N-acetylglucosamine acyltransferase VC2248 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  19  44.....LLSHVVVKGPTKIGRFNRIFQFASIGEACQDLKYAGEDTQLIIGDRNTIRESVTMTVQDKGITIVGSDNLFMINAHV-----AHDCVIGDRCIFANNATL-----------------AGHVKVGNQAIVGGMSAIHQFCHIGDHCMLGGGSIVVQDVPPYVMAQGNHCAPFGINV........ 199
34 -20.700IDP90748 gene: lpxA; UDP-N-acetylglucosamine acyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0274 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  19  29....................SKDAKIGNNVVIKQGARI----LSDTTIGDHSRVFSYAIVKEEQKSGVVIGKNATIREFATIGTAKGDGFTRIGDNAFIMAYCHI----AHDCLLGNNIITLAGHVELGDFTVVGGLTPIHQFVKVGEGCMIAGASALSQDIVPFCLAEGNRASIRSLNLVGIRR... 201
35 -20.300IDP01633 gene: lpxA; UDP-N-acetylglucosamine acyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT1569c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  17  27....................GKNVVIGENTELKSHVTI----GDNAVIGKNNRIFQYASIKKGDFSQVVIGDNNIIRECATIGTAKEIGVTSVGNNNIIMCYVHI----GHDCKMGSYINGLAGHVHIDDYAILSSNVGVHQFCRVGKHAFIAHAALVGKDVPPYLMVTAVNAGSTPCGIN....... 195
36 -17.800IDP05540 gene: glmU; bifunctional protein [Clostridium difficile 630] CD3515 [Peptoclostridium difficile 630]  ali follow..  18  298.....................TNSEIGDGTEIKNSTIIDSKVGENSTVGPYAYLRPKSDL----GNNVKIGDNAIIEDGSKASHLSYIGDAHVGKNVNIGCGVVFVNYDGKN----------KFKSIVKDNAFIGSNSNLVAPVVVEEKGYIATGSTITHDVPDGALAIARERQVIKEG......... 446
37 -17.600IDP01179 Bifunctional protein glmU [Includes: UDP-N-acetylglucosamine pyrophosphorylase (N-acetylglucosamine-1-phosphate uridyltransferase); Glucosamine-1-phosphate N-acetyltransferase ] BA_0048 [Bacillus anthracis str. Ames]  ali follow..  16  300.....................RDSEIGDRTTIRQSTVHDSKLGTEVSVGPFAHIRPDSVI----GDEVRVGNKTVFGNRSKASHLSYIGDAQVGEDVNLGCGSITVNYDGKN----------KFKTVIGNGVFIGCNSNLVAPVTVEDGAYVAAGSTITENVPSKALSVARARQVNKED......... 448
38 -17.400IDP00656 gene: glmU; UDP-N-acetylglucosamine pyrophosphorylase SACOL0543 [Staphylococcus aureus subsp. aureus COL]  ali follow..  15  299.....................NNSTIENGACIQQSVVNDASVGANTKVGPFAQLRPGAQL----GADVKVGNKADLKDGAKVSHLSYIGDAVIGERTNIGCGTITVNYDGEN----------KFKTIVGKDSFVGCNVNLVAPVTIGDDVLVAAGSTITDDVPNDSLAVARARQTTKEG--YRK.... 450
39 -17.000IDP90716 gene: lpxD; UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0576 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  15  191...........................................GNVVLEDFVEVGACTTIDRAVFDSTIIKAGTKVDNLVQI-----GHNCNIGQNCIIVAQTGI-----------------SGSSELGRNVIMGGQSATSGHLKIGDFSTIAARGGVSKNLEGGRVYGGFPIMLQKD.......... 303
40 -17.000IDP00356 gene: gcaD; hypothetical protein lmo0198 lmo0198 [Listeria monocytogenes EGD-e]  ali follow..  20  300.....................VNSVIGERVHVRTSSIFESKVGDDVQIGPYAHLRPESDI----HDHVKIGNKAVVGEGTKLPHFIYMGDAEIGKNVNVGCGSIAVNYDGKN----------KAKTIIGDNVFVGCNSNLIAPVKVGDRAFIAAGSTITKDVPEDALGIARAKQDNKLG......... 448
41 -17.000IDP01928 gene: lpxD1; UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT0286c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  24  206...........................................GNVVIGSFVDIGSNTCINNAKYGSTIIGDYTKIDNLVQI-----GHNVIIGKGCMICGQAGI-----------------SGSVTIGDGVIIAGNAGIKDHTNIGSDARIGGKAGVMWDVPAGESHMGYPAYKDSE.......... 318
42 -16.900IDP90723 gene: glmU; UDP-N-acetylglucosamine pyrophosphorylase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0821 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  16  242...........MQQGVIFHLPQSTFIGADVEFVGECEVYEN-EGKSKIINSIIKSSSVI-------ENSIVENSDVGPLAHLRPNCELKNTHIGNFVECKNAKLNTVKAGHLSYLGDCEIDSGTNIIIGKNVFVGSDTQFIAPVKIEDEVIIAAGSTVSINVEKGALFINRAGHKMIKD......... 421
43 -16.700IDP00427 gene: glmU; bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase YPO4119 [Yersinia pestis CO92]  ali follow..  14  299.....................KNCVIGDDSEISPYTVLEDARDANCTVGPFARLRPGAEL----AEGAHVGNKARLGKGSKAGHLSYLGDAEIGAGVNIGAGTITCNYDGAN----------KFKTIIGDDVFVGSDTQLVAPVTVANGATIGAGTTVTRDVAENELVISRVKQVHIQG......... 448
44 -16.600IDP00318 gene: glmU; UDP-N-acetylglucosamine pyrophosphorylase CBU_1947 [Coxiella burnetii RSA 493]  ali follow..  14  298.....................KNTTVGENTEIHANSVIEAAVKANCSVGPFARLRPGSVL----EEGAKVGNKTTLGRGSKANHLTYLGDTIIGKNVNVGAGTITCNYDGAN----------KWQTKIEDGAFIGSNVALVAPLTVGKNATIGAGSTLSQDAPPDQLTVARERQRTIKG......... 447
45 -16.500IDP02698 gene: glmU; UDP-N-acetylglucosamine pyrophosphorylase/glucosamine-1-phosphate N-acetyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT0387 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  18  296.....................KNCIIEDNVRIKSNSMVDGSIREGAIVGPFARVRPECDV----KEGAVIGNKTILGKGSKASHLTYLGDSEIGANCNIGAGVITCNYDGVN----------KHKTVIGDYAFIGSDSQLIAPVNIGQGATVGAGSTIVKDVPADNLAISRARQRHIDT......... 445
46 -16.300IDP01477 gene: glmU; bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase VC2762 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  18  296.....................KDCEIDDNTVIRPYSVIEGATGENCTVGPFTRLRPGAEL----RDDAHVGNNARLGEGSKANHLTYLGDAEIGKGVNVGAGVITCNYDGAN----------KHKTVIGDDVFVGSDCQLVAPVTIGNGATIGAGTTLTKNVAEGELVITRAPERKIAG......... 445
47 -15.100IDP06172 gene: lpxD; UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Helicobacter pylori J99] NP_222903 [Helicobacter pylori J99]  ali follow..  21  193...........................................GIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNLVQI-----GHNCVLGEHSIVVSQVGL-----------------SGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKDLPPNTNFAGAPAMEIHE.......... 306
48 -14.800IDP90874 gene: lpxD; UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Yersinia pestis CO92] YPO1054 [Yersinia pestis CO92]  ali follow..  18  199...........................................GSVHIGDRVEIGACTTIDRGALDNTIIGNGVIIDNQCQI-----AHNVVIGDNTAVAGGVIM-----------------AGSLKVGRYCMIGGASVINGHMEICDKVTITGMGMVMRPITPGLYSSGIPLQPNKM.......... 312
49 -14.800IDP00134 gene: VC2250; Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence VC_2250 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  18  199...........................................GSVRIGDRVEIGACTTIDRGALDDTVIEDNVIIDNQLQI-----AHNVHIGYGSALAGGTVI-----------------AGSTRIGKYCIIGGASVINGHIEIADGVTITGMGMVMRSIEKGMYSSGIPLQTNKE.......... 312
50 -14.600IDP01632 gene: lpxD; UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT1571c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  20  198...........................................GRVIIEDDVEIGSGTTVDRGAIDDTIIKKGARIDNLVQI-----AHNVVIGRNTALAGVTAV-----------------AGSTTIGDNCLIGGQSAITGHISICDNTIIGGASNIGKSITPGMYYAAFEAKPRIQ.......... 311

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35