current user: public

If you have questions about the server, please let us know.

Query: IDP01448 outer membrane protein OmpA VC2213 [Vibrio cholerae O1 biovar El Tor str. N16961], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst MKKLAAIISATLLFASSAAVAEVYVGGKVGKSWLDDACLAGQSCEDDDQVVGAFLGYQANKWLSLEAGYDYLGKFTAAGLNDEKVQAVTLAPKLSIPLTEGIALYGKVGGAYVDYGSKDDYSYLGAAGLEFNTNHNVTMRLEYQNLTDINNDIVRARAETATLGIAYKFGGSEEPAPVVEQRPAEPAPVAAPVEKVAVTKTFTFQHLDSSTFATASAELKPATVQKLDKIVGYLNQYPQAKVEVVGHTDSTGSEAYNQKLSERRAQAVAKALEAQGIDASRISAKGLGESSPIASNATAEGREKNRRVELVIPEFQYQVTELast
1 -110.000IDP01448 outer membrane protein OmpA VC2213 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali  100  1MKKLAAIISATLLFASSAAVAEVYVGGKVGKSWLDDACLAGQSCEDDDQVVGAFLGYQANKWLSLEAGYDYLGKFTAAGLNDEKVQAVTLAPKLSIPLTEGIALYGKVGGAYVDYGSKDDYSYLGAAGLEFNTNHNVTMRLEYQNLTDINNDIVRARAETATLGIAYKFGGSEEPAPVVEQRPAEPAPVAAPVEKVAVTKTFTFQHLDSSTFATASAELKPATVQKLDKIVGYLNQYPQAKVEVVGHTDSTGSEAYNQKLSERRAQAVAKALEAQGIDASRISAKGLGESSPIASNATAEGREKNRRVELVIPEFQYQVTE 321
2 -91.900IDP02586 gene: cadF; fibronectin-binding protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1478c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  24  1MKKIFLCLGLASVLFGADNNVKFEITPTLNYNYFEGNL-----DMDNRYAPGIRLGYHFDDFWLDQLEFGLEHYSDVKTNKTTDITRTYLSAIKGIDVGEKFYFYGLAGGGYEDFSNKSGGFGHYGAGVKFRLSDSLALRLETRDQINFNHANHNW---VSTLGISFGFGVADTRATPQAKCPVEPEGALLDENGCE------KTISLEGHFGFDKTTINPTFQEKIKEIAKVLDENERYDTILEGHTDNIGSRAYNQKLSERRAKSVANELEKYGVEKSRIKTVGYGQDNPRSSNDTKEGRADNRRVDAKFIL....... 318
3 -59.700IDP92704 type VI secretion system OmpA/MotB [Acinetobacter baumannii ATCC 19606 = CIP 70.34] ZP_05827995 [Acinetobacter baumannii ATCC 19606 = CIP 70.34]  ali follow..  29  17......................................................................................................................................SGCQTTGNNLGGVEYDKAALGTLIGAAAGYGISKSNANSSRQNNRAAAIGAVLGAAGAGTGVEVGRNPQLIMPGSITFDTNKSNIKPNFYATLDKVAQTLAEDNKSAILVTGYTDNTGNDSINIPLSQARAQSVKNYLAGKGVPSSRIDAQGYGSSNPIADNSTASGREQNRRVEISIYAKQ..... 217
4 -57.700IDP92702 hypothetical protein YP_1360 [Yersinia pestis biovar Microtus str. 91001] NP_992725 [Yersinia pestis biovar Microtus str. 91001]  ali follow..  24  402.........................................................................................................................................................................RLGLGLYRGERLRPPLLAAIKSYIPPPAPPAPKTVRLDSLSLFDVGKFTLNAGSTKMLVTALIDIKAKPGWLIVVAGHTDITGDAQANHILSLKRAEALRDWMLSTDVSPTCFAVQGYGATRPIADNDTPDGRALNRRVEISLVPQADACQV 558
5 -56.900IDP92703 putative type VI secretion protein [Escherichia coli 042] YP_006098805 [Escherichia coli 042]  ali follow..  28  399.........................................................................................................................................................................RYGLGLYQGMWLIPPVERATGEWVAPRPTQTPKTVRLNSLALFDAGKWTLKPGATKWLVNALVDIKAKAGWLIVVSGHTDNTGDPLRNQALSLKRAEAVRDWMRDTGIPQSCFAVQGYGESRPVAPNDTAEGRARNRRVEISLVPQADACRL 559
6 -48.000IDP92710 peptidoglycan associated lipoprotein OprL precursor [Pseudomonas aeruginosa PAO1] NP_249664 [Pseudomonas aeruginosa PAO1]  ali follow..  26  17...............................................................................................................................................................AVAVGCSSKGGDASGEGANGGVDPNAGYGANSGAVDGSLSDEAALRAITTFYFEYDSSDLKPEAMRALDVHAKDLKGSGQ-RVVLEGHTDERGTREYNMALGERRAKAVQRYLVLQGVSPAQLELVSYGKERPVATGHDEQSWAQNRRVELK.......... 167
7 -46.700IDP00403 gene: pal; peptidoglycan-associated outer membrane lipoprotein YPO1125 [Yersinia pestis CO92]  ali follow..  26  26.........................................................................................................................................................................KSANNDQSGMGAGTGTENGSNLSSEEQARLQMQELQKNNIVYFGFDKYDIGSDFAQMLDAHAAFLRSNPSDKVVVEGHADERGTPEYNIALGERRASAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAFAKNRRAVLV.......... 167
8 -45.700IDP02590 OmpA family protein [Francisella tularensis subsp. tularensis SCHU S4] FTT0831c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  23  27..........................................................................................................................................................................DKDSGPLTFPTLPCTAELLQSNQSFICVEQTGPDLIETNIKFDADSYTLNTQAKEVLDKLFAYLKLTDTTNFTIKGYTDQKILTDYNIRLSKNRASSVEEYLVNKGLSSDGITIKALGYQDPIAPNDSTSSRAINQRVEITLKSRLIEQID 189
9 -40.100IDP04332 putative OmpA family protein [Yersinia pestis CO92] YPO2723 [Yersinia pestis CO92]  ali follow..  33  147..........................................................................................................................................................................................................KVIFKGDSMFMVGSDNVRPEMIDVIKRVAQEVHRVKG-AILIVGHTDSINKPGFNQVLSEKRAANVARYMEQAGIPTDKIRFEGKGETQPVSSNDDATGRSQNRRVEIFVN........ 260
10 -39.700IDP92701 gene: sciP; SciP protein [Salmonella enterica subsp. enterica serovar Typhimurium] CAC48213 [Salmonella enterica subsp. enterica serovar Typhimurium]  ali follow..  33  320..........................................................................................................................................................................................................RVVFRGDAMFVPGQKTVSDAIRPVINKAAREIARVGG-AVTVTGHTDSIHSAEFNLVLSEKRAAEVAALLTSGGVPAGRVHIVGKGDTVPVADNGSKAGRAKNRRVEILVVE....... 434
11 -39.500IDP04712 putative OmpA-family membrane protein [Yersinia pestis CO92] YPO0514 [Yersinia pestis CO92]  ali follow..  35  389..........................................................................................................................................................................................................LLIFTSDGAFRTGEATLSEENKKNIERLGLALAPWPG-DIEVIGHTDNFRSTSGNLKLSAARASVVADKLRESTTHQREISAIGRGESDPLADNATEEGRKRNRRVDILWKIGQRDADK 516
12 -39.300IDP92712 hypothetical protein PA0078 [Pseudomonas aeruginosa PAO1] NP_248768 [Pseudomonas aeruginosa PAO1]  ali follow..  37  331..........................................................................................................................................................................................................VVTIRGDELFASASASVRDEFQPLLLRIADALRKVKG-QVLVTGHSDNIATLRYNWKLSQARAQEVADLLGATTGDAGRFTAEGRSDTEPVATNASAEGRARNRRVEITVFAEGAQ... 449
13 -36.300IDP05056 gene: motB; chemotaxis protein [Clostridium difficile 630] CD0257 [Peptoclostridium difficile 630]  ali follow..  35  115..........................................................................................................................................................................................................LLELDDSILFDSGISELKVDSKATLNKVYDMIKMMKN-KIVIEGHTDNVKSSTHNWDLSSSRAVSVVRYFVEEGMDPRLFSATGCGEYQPLVSNETAKGRAENRRVNILIT........ 229
14 -36.200IDP92714 hypothetical protein VP1390 [Vibrio parahaemolyticus RIMD 2210633] NP_797769 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  21  574.........................................................................................................................................................................KLEQALKDARDQSGNQIDAILVNSSRG---------AGIKIEFAFNSREKELKDKQLAASLANVLEDEPNLRVEIEGHACQVGTEKANMQVSAERAEYAKKLLMKEPVFDGRVSIAAFGESKPVYVPKQGENLRQNRRVVIRIYLQSLNVF. 728
15 -30.100IDP00165 gene: acfA; accessory colonization factor AcfA VC0844 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  18  1MQKTLSAIFLFTTLSANA---APYIGLELGIGTANHSFETNYNPNMEDMFLGGLIGYKFNDNFSFEINYSSYKLEDQYSKSEIEAKQLALISVYSYPIHQQLKTNIKVGVTHTQYEKKNRFGALFSLGLDYNLIPELSVGTELRYQ-----FDKYNDVLSISLNSKYYF........................................................................................................................................................ 215
16 -25.900IDP01854 gene: pagC; virulence membrane protein PAGC precursor [Salmonella typhimurium LT2] STM1246 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  16  1MKNIILSTLVITTVVNVAQADTNAFSVGYAQSKVQDF--------KNIRGVNVKYRYEDDSPVSFISSLSYLYGDRQASHDKFEVKYGSLMVGPAYRLSDNFSLYALAGVGTVKATSSRKTGFAWGAGVQMNPLENIVVDVGYEGS-----NISSTKINGFNVGVGYRF........................................................................................................................................................ 185
17 -23.600IDP90997 gene: ompX; outer membrane protein X [Yersinia pestis KIM 10] y1682 [Yersinia pestis KIM10+]  ali follow..  18  3MKKIACAVAACVLAVTAGSAFAGQSTVSGGYAQSDYQ-----GVANKSSGFNLKYRYEWSDSQLGYITSFTHTEKSGFGDEYNKAQYNAITGGPAYRINDWASIYGLVGVGHGRFTSTSDYGFTYGAGLQFNPAENVALDVSYEQS-----RIRNVDVGTWVAGVGYTF........................................................................................................................................................ 176
18 -17.800CPX_00403_00493 Complex of IDP00403 (31...168) and IDP00493 (23..430) [Undefined organism]  ali follow..  29  40.......................................................................................................................................................................................GTENGSNLSSEEQARLQMQELQKNNIVYFGFDKYDIGSDFAQMLDAHAAFLRSNPSDKVVVEGHADERGTPEYNIALGERRASAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAFAKNRRAVLVYXMKQ..... 172
19 -12.600IDP92713 OmpA domain-containing protein [Pseudomonas putida KT2440] NP_745234 [Pseudomonas putida KT2440]  ali follow..  23  705........................................................................................................................................................................................................IETITLESDTLFAFGRADFQSLKNEGQHQLSAIASKL--GKIIISGHADQLGDSQGNLQVSKQRAQTIRTYLVGKGVPAELVVAQGEGSRKPLVNCDMQQPRTQNRRVEIEVRGLN..... 831
20 -12.600IDP91023 hypothetical protein y2980 [Yersinia pestis KIM 10] y2980 [Yersinia pestis KIM10+]  ali follow..  15  1MNKHLVACAASLLLVAGSASAV-----SFNAETGRHYTNLGFGLGTNTGGLAISGNWARSDHLGLGLGFNLPVGPMTSPEDGSSGGAVAIGGGLSYPINKSFSVYGEGYFAPEELTSGMKSYSEANGGVRWNVFRPLTVDVGYRYIN--EGRRDNRLADGVYIGAGLNF........................................................................................................................................................ 180
21 -10.500IDP06042 hypothetical protein jhp0369 [Helicobacter pylori J99] NP_223088 [Helicobacter pylori J99]  ali follow..  12  93.GELHEKNESILFQQMAKNKSGFFIGVILGDIGINEKFELLSNIQASPLLYGLRSGYQFANGISGEYLGGAMKGFKSDSLASYQTASLNIDLLMDKPIDKELGIFGGVGVGWNGMSQPNAFGLVLNLGVSMTLNLKHRFELALKMETSQTFLYYFKSTNIYYISYNYLL........................................................................................................................................................ 289
22 -9.460IDP06040 hypothetical protein jhp0368 [Helicobacter pylori J99] NP_223087 [Helicobacter pylori J99]  ali follow..  13  4KKRAILWSLMGFCAGLANAKSGLILGINTGFFYNHNSSSITGNILNYLFAYGLRFGYQRPSFFARLVKPNIIPKKAGFGSVGFQSVMLNGDFLLDFPLPFVGKYLYMGGYMAHGVNYTAEWGMSFNAGLALTVLEKNRIEFEFKPFLQSNSSKETWWGAIASIGYQYVF........................................................................................................................................................ 240
23 -9.380IDP00507 hypothetical protein YPO2511 YPO2511 [Yersinia pestis CO92]  ali follow..  20  214......................................................................................................................................................................................................................PDGTMNDVLIQRLEKTLEIAQQLPDALIIVTG-----GVPQ-----NQTEGKLMADWLIKKGIKPERIYQDN-------YARSTVENALYSRYANAIIISSGSHVRR 311

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.