current user: public

If you have questions about the server, please let us know.

Query: IDP01609 gene: dnaJ1; heat shock protein, hsp40 [Francisella tularensis subsp. tularensis SCHU S4] FTT1512c [Francisella tularensis subsp. tularensis SCHU S4], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .
# Score Template Links and tools%idFirst MADYYSLLGVSRDASEADIKKAYRRLAKKYHPDVNKEKGAEDKFKEIQTAYDVLGDKEKKKLYDTYGENWDKVQQGGFGGAGGGFGGFSQSGRSQSFNFEDLGDIFGDLFGGGAGARGFGGGQPRARKGEDINISLRLNVEDAIKGGSRTVSYNYQKVGANGMPTMQHQSVDVKIPPAMGNGKKLRVKGKGGAGIGANAPAGDLYIKIEVVDHKNYKVDGNDIYEHINIAPWEAALGTSLEIDTPYGKKKMKVPEGSQSGRKMRIKGKGLGDGDFYIVYDVKLPLADTDEKKEFYKQMQEKMNFNPRALast
1 -129.000IDP01609 gene: dnaJ1; heat shock protein, hsp40 [Francisella tularensis subsp. tularensis SCHU S4] FTT1512c [Francisella tularensis subsp. tularensis SCHU S4]  ali  100  1MADYYSLLGVSRDASEADIKKAYRRLAKKYHPDVNKEKGAEDKFKEIQTAYDVLGDKEKKKLYDTYGENWDKVQQGGFGGAGGGFGGFSQSGRSQSFNFEDLGDIFGDLFGGGAGARGFGGGQPRARKGEDINISLRLNVEDAIKGGSRTVSYNYQKVGANGMPTMQHQSVDVKIPPAMGNGKKLRVKGKGGAGIGANAPAGDLYIKIEVVDHKNYKVDGNDIYEHINIAPWEAALGTSLEIDTPYGKKKMKVPEGSQSGRKMRIKGKGLGDGDFYIVYDVKLPLADTDEKKEFYKQMQEKMNFNPRA 308
2 -95.100IDP01653 gene: dnaJ; chaperone protein dnaJ [Bacillus anthracis str. `Ames Ancestor`] GBAA4538 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  36  4.RDYYEVLGLSKGASKDEIKKAYRRLAKKYHPDVSKEENAIEKFKEVQEAYEVLSDDQKRAQYDQFGHAGANQGFGG------------FGGGGDFGGGFGFEDIFSSFFGGGGGRR---RDPNAPRQGADLQYQVTLEFEEAIFGKELNVEIPCKHCSGSGQVSRKRKKINVKIPAGIDNGQQIRVSGKGEAGV-NGGPAGDLYVVVHVRSHEFFEREGDHIICEMPLTFAQMALGAEVEVPTVHGKVKLKIPAGTQTGTEFRLKGKGAPQGDQYVVVRVVVPTKLTSHQKDLLREFAGQEEQDD.. 358
3 -93.600IDP01404 dnaJ protein VC0856 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  38  4.RDFYEVLGVGRDASERDIKKAYKRLAMKYHPDRNSDAGAAEKFKEVKEAYEILTDAQKKAAYDQYGHAAFEQGAGGFG------------GGGFGGGGADFGDIFGDVFGDIFGGGR-RGGGPRAQRGSDLRYNMELSLEEAVRGCSKEIEVPCGTCHGHGQVQQKTKTLNVKIPAGVDTGDRIRLSGEGEAGE-MGAPAGDLYVQVHVKEHHIFERDGNNLYCEVPVSFAMAALGGEVEVPTLDGRVSLKVPAETQTGRMFRMRGKGVKLGDLIVKLVVETPVNLSARQKELLKEFEESCGGEAAT 359
4 -92.200IDP00478 gene: dnaJ; chaperone protein DnaJ YPO0469 [Yersinia pestis CO92]  ali follow..  33  4.RDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSDKNAEEKFKEAKEAYEILTDAQKRAAYDQYGHAAFEQGGMG------------GGGFGGGGGGADFSDIFGDVFGDIFGGG---RRQQRASRGSDLRYNMDLTLEEAVRGVTKEIRIPCPTCHGAGQVQEKSKTLSVKIPAGVDTGDRIRLSGEGEAGE-HGAPSGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDGRVKLKIPAETQTGKMFRMRGKGVKQGDLLCRVVVETPVSLSEKQKQLLRELEESFVGAAGE 357
5 -89.500IDP02168 gene: dnaJ; chaperone protein dnaJ [Coxiella burnetii RSA 493] CBU_1289 [Coxiella burnetii RSA 493]  ali follow..  37  4.RDYYEVLGVNLNATEAEVKKAFRRLAMKYHPDRNPDKDAEVKFKEAREAYEVLCDSRKRASYDQFGHAGVEQTFGG--------------AGAGGFGFGDLGDIFGDIFGDIFGGA--RGGQAREQRGADLAYELVLSLEEAVHGLSRTIKVPCPRCNGSGQMRQQTKTLSVKIPPGIDTGDRIRLAGEGEAGL-FGAPPGDLYVQVRVKPHPLFHREGNDLHSEVPIDFTTAALGGEMEIPTLDGSVRLTIPPETQGGKQFRLRGKGVKVGDLICHIVVETPVKLSPEQKDYLKQFAELLKKDEKN 355
6 -77.900IDP91676 DNJA3_HUMAN [Homo sapiens]  ali follow..  27  92.EDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSAGFDPGASGSQHSYWKGG-----------PTVDPEELFRKIFGEFSSSS---FGDFQTVFDQPQEYFMELTFNQAAKGVNKEFTVNCHYCGGSGMETKQKKRVMIPVPAGVEDGQTVRMPVGK----------REIFITFRVQKSPVFRRDGADIHSDLFISIAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPYGDHYIHIKIRVPKRLTSRQQSLILSYAEDETDVEGT 437
7 -24.100IDP06072 hypothetical protein jhp0418 [Helicobacter pylori J99] NP_223136 [Helicobacter pylori J99]  ali follow..  19  191LEEAKNLFEIQTHTTMQDLEKKALDLSAPYYHKMNDNKQDFISLKKIALASQLLENDLKDS....................................................................................................................................................................................................................................................... 255
8 -18.400IDP01304 gene: hscB; co-chaperone HscB VC0751 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  26  2..NYFELFGLPIELDGSLLSSQFRALQKRFHPDNFATASERDR-AQINDAYQTLKDPLRRAEY..................................................................................................................................................................................................................................................... 70
9 -5.740IDP93911 general secretion pathway protein D [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007724 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  10  289...........KFAKAESLLDVLNGVSTVIKADAQTNSAAPDLLRDLEQVINQLDIRRAQVLVENLGVQWFNRNGGGSNFPENGASASSITSNDMGSSLKGITGLATGFYRGNWSGLFTALRTNSQNDILATPSIVTLDNMEAEFSVGQEVPVLSGSQTTTGTVDRKSVGIKLKVKPQINKGDSVLLESSVAEKAPGGTGDLGATFNTRMVKNAVMVGSNNIV-----------VVGGLLDSTSHDVTSKVDIP-----GFLFRSTSQKMVKRNLMLFIRPTI-VDASKKKLDKFQQEQDIDRTTNGQ 626
10 -5.740IDP95391 set238a-028 [Vibrio cholerae]  ali follow..  13  36..SIVACYENKNEESDAVLNKSYNDLKKLVPYDDETKGVYWSNIVKSQKNWIQMRDSQCLAKGVFFENGT.............................................................................................................................................................................................................................................. 106

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.