current user: public

If you have questions about the server, please let us know.

Query: IDP01682 D-alanyl-D-alanine carboxypeptidase family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA5104 [Bacillus anthracis str. `Ames Ancestor`], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MKKWVFISFFIACTICVGVYISPLFQKEIDVKIGGENGAVKNANIEKIEVTKEQIYKGDLLLVNKDYPVKKDSIRSDIINVNHNSELVRGYVIFDRNLRLSKDVVKKFLNVVDAAGKDGVQHFLMNSGYRDFKEQSKLYKEMGSDYALPAGYSEHNLGLSLDVGSTQKKMEKAPEGKWIEENVWKHGFVLRYPKNKSHITGIQYEPWHIRYVGLPHSAIMQKKKITLEEYLDFLKEKKEITTDVEGKKYTVSYYKVSGNMKVNVPLNKQYEISGNNVDGVIVTVQELast
1 -107.000IDP01682 D-alanyl-D-alanine carboxypeptidase family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA5104 [Bacillus anthracis str. `Ames Ancestor`]  ali  100  1MKKWVFISFFIACTICVGVYISPLFQKEIDVKIGGENGAVKNANIEKIEVTKEQIYKGDLLLVNKDYPVKKDSIRSDIINVNHNSELVRGYVIFDRNLRLSKDVVKKFLNVVDAAGKDGVQHFLMNSGYRDFKEQSKLYKEMGSDYALPAGYSEHNLGLSLDVGSTQKKMEKAPEGKWIEENVWKHGFVLRYPKNKSHITGIQYEPWHIRYVGLPHSAIMQKKKITLEEYLDFLKEKKEITTDVEGKKYTVSYYKVSGNMKVNVPLNKQYEISGNNVDGVIVTVQE 286
2 -102.000IDP91044 gene: vanY; vanY [Enterococcus faecalis] EFA0002 [Enterococcus faecalis]  ali follow..  53  1MKKLFFLLLLLFLIYLGFSQEKVEFQNYDQNPKEHLENSGTSENTQEKTITEEQVYQGNLLLINSKYPVRQESVKSDIVNLSKHDELINGYGLLDSNIYMSKEIAQKFSEMVNDAVKGGVSHFIINSGYRDFDEQSVLYQEMGAEYALPAGYSEHNSGLSLDVGSSLTKMERAPEGKWIEENAWKYGFILRYPEDKTELTGIQYEPWHIRYVGLPHSAIMKEKNFVLEEYMDYLKEEKTISVSVNGEKYEIFYYPVTKNTTIHVPTNLRYEISGNNIDGVIVTVFP 294
3 -83.900IDP91774 gene: vanXYG; D,D-dipeptidase/D,D-carboxypeptidase [Enterococcus faecalis] AAQ16272 [Enterococcus faecalis]  ali follow..  31  2............................................MKTIELEKEEIYCGNLLLVNKNYPLRDNNVK-GLVPADIRF----------PNILMKRDVANVLQLIF-EKISAGNS-IVPVSGYRSLEEQTAIYDGSTRKYVALPNHSEHQTGLAIDLGLIRPDFPYDGICDEFRRAAPDYGFTQRYARDKEEITGISHEPWHFRYVGYPHSKIMQENGFSLEEYTQFIKAYKYLFEQAHRAEIEIYYVPADDKTLIKIPENCVYQISGNNIDGFVVTIWR 250
4 -81.400IDP02154 D-alanyl-D-alanine carboxypeptidase family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA2526 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  30  1MRIKLVGIFMIVILGIFIVYTNQSIGKEPRKTNYETRENSINKEKNSTSNNIASSFASVQAVVNKEYGLPEDYKPEDLVVPNVPFS----FSGTLEKSYLRKEAAEALERLFDLANKEGIQ-LNAVSGFRSYDYQKKLYANNTDRFSAKPGHSEHQTGLTMDVSSLELTFANTKEGKWLKENAHRAGFIIRYPKGKESITGYAYEPWHIRYVG-DIAESIYKKKLTLEEYMNL..................................................... 243
5 -80.700IDP02767 D-alanyl-D-alanine carboxypeptidase family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA4750 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  28  1MKKIIIISAATIVIGITSFAYFGSKSPLQNEARAVESQQHSNHQKEEIPAFPKTNPDSNLVLVNKHRKLPDGYTPEDLTRPNVPFT----SPKDKEKTLLRKDAADALENMFEAAKKEGLE-LTAVSGYRSYKRQKSLHDTYADSVSAIPGTSEHQTGLAMDISSLEPIFGETAEGKWVAKHAHEFGFVIRYLEDKTETTEYSYEPWHLRYVGNPYATYIYKHHLTLEEAMEDKK................................................... 259
6 -77.200IDP91775 gene: vanXYE; VanXYE [Enterococcus faecalis] AAL27443 [Enterococcus faecalis]  ali follow..  29  1......................................................MKKNYLRLINENNEIKDSERPSHLVQAPFAQ----------TNILVDPMVAIQLEKLIKTTGLDS--QIITIDGYRSKETQQALWDETAHKYVAKPGCSEHEIGLAVDLGLIRPSFTDSPIVDKFLKHMTDFGFILRYQKGKESITNINYEPWHFRYVGTPHSSIMVQQNWVLEEYIEFIESIRGTAYE........................................... 192
7 -76.600IDP91778 gene: vanXYc; D,D-dipeptidase/D,D-carboxypeptidase VanXYc [Enterococcus gallinarum] AF132548_1 [Enterococcus gallinarum]  ali follow..  33  2.........................................................NTLQLINKNHPLKKNQEPPHLVLAPFSD----------HDVYLQPEVAKQWERLVRATGLEK--DIRLVDGYRTEKEQRRLWEYSTKQFVALPGCSEHQIGLAIDVGLICPHFRDSAAADLFMQQMMNYGFILRYPEDKQEITGISYEPWHFRYVGLPHSQVITAQKWTLEEYHDYLAQTVR............................................... 187
8 -76.600IDP91977 D-alanyl-D-alanine carboxypeptidase [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007810 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  24  1MKKRYVILSGLLALTLAACSQEKTKVEENTQKTEQSSQPEGTVGSKSQASSQKQGKYDEIILANKRYPLSKDYNPGENP-----------------------TAKAELLKLIAAMQAEGYPISDQYSGFRSYETQAKLYQDYADRYSARPGYSEHQTGLAFDLIGTDDLVTEEKAAQWLLDHAADYGFVVRYLKGKEKETGYMAEEWHLRYVGKE-AKEIAASGLSLEEYYGF..................................................... 231
9 -75.200IDP92726 gene: ddcY; metallo D,D carboxypeptidase [Enterococcus faecium] ADD91671 [Enterococcus faecium]  ali follow..  27  1MKRSYKTVAVILLIVL-----------------LTSIGLFFRKTPQKIQVCGEERDSWNLLLVNAKHKIPQGYTVELQKLSN--------------DQAVDKRIYPDLQLMLDAARAEGIY-PKIVSSFRTTEDQEKIMEDKAAKWVAAPGTSEHELGLAVDINAESSISTDKEVYEWLADNAYQYGFILRYPSNKVYITGVGYEPWHYRYVGKKAAKKITEAGITLEEYLGKTE................................................... 220
10 -72.000IDP91871 gene: vanYB; D,D-carboxypeptidase [Enterococcus faecalis] AAB05624 [Enterococcus faecalis]  ali follow..  25  21GEKRAFLWAFIISFTVCTEATQLPPIPATHTGSGTGVAENPEENTLATAKEQGDEQEWSLILVNRQNPIPAQYDVELEQLSN--------------GERIDIRISPYLQDLFDAARADGVY-PIVASGYRTTEKQQEIMDEKAETWVAVPGTSEHQLGLAVDINADGIHSTGNEVYRWLDENSYRFGFIRRYPPDKTEITGVSNEPWHYRYVGIEAATKIYHQGLCLEEYLNTEK................................................... 268
11 -52.500IDP00223 putative carboxypeptidase YPO3054 [Yersinia pestis CO92]  ali follow..  18  3.....................................................................DNTLTPQMLTGLSTDH-----LVVLSGAHRLQPQAAEAFQAMQQAAKVAGFD-LQPASTFRDFGRQLAIWNGKFRRWSALPGTSRHHWGSDLDIYDPSAGGYFYPLTQWLSAHMAEFGFYRPFATDN---GGVAVEPWHLSYRPLEQAEHLLTPKILLAAWQSQDVAGSEWLASHLPMIFSRF.................................. 221
12 -30.800IDP91776 gene: vanXD; D,D-dipeptidase VanXD [Enterococcus faecium] ACM47288 [Enterococcus faecium]  ali follow..  15  15............................................................IRWDAKYATWDNFTGKPV------------DGYMVNRVMGTKELGVALRKAQKMAEKLGYG-LLLWDGYRPQCAVNCFLNWASQPKGYVASQSSHSRGSAVDLTIFRLDTGMLHAASGLSEEESKNRQCLRYIMESSGFEAYRYEWWHYVLADEPYPDTYFDFCIA............................................................ 202
13 -19.700IDP91773 gene: vanXB; D,D-dipeptidase [Enterococcus faecalis] AAB05628 [Enterococcus faecalis]  ali follow..  13  15............................................................VRWDAKYATWDNFTGKPV------------DGYEVNRIIGTKAVALALREAQIHAARLGYG-LLLWDGYRPKSAVDCFLRWAAQPEDNLASQSSHSRGSTIDLTLYHLDTGELHTAKGIGNAEAQNRRCLRKIMESSGFQSYRFEWWHYKLIDEPYPDTYFNFAVS............................................................ 202
14 -17.300IDP91596 gene: vanXst; D-ala-D-ala dipeptidase [Streptomyces toyocaensis] AAD02118 [Streptomyces toyocaensis]  ali follow..  13  21............................................................LRWDAKYATWDNFTGKPV------------DGYLVNRIVGTKALCAALERARDEAASLGFG-LLLWDGYRPQRAVDCFLRWSQQPEDGRAARSGHSRGSTVDLTLYDLATNELHGAQGLAPVEARNRQHLRSVMESCGFKAYEYEWWHYTLADEPYPDTYFDFPIM............................................................ 208
15 -14.000IDP05627 hypothetical protein CD1406 [Clostridium difficile 630] CD1406 [Peptoclostridium difficile 630]  ali follow..  99.............................................................MIGKSMPTDEPISFDSLSYLKLTY-YGFDEKTHQGEMIVNSELAPEVVDIFKELYEKKYP-IEKIKLIDDYDAVDEKSMSDNNTIAGTNVVSNHGKGRAIDINPLQNPQGMIKKGDDCYNAFVSRGWS-----------------WHFE............................................................................ 267
16 -13.700IDP00233 putative phage-related protein YPO3676 [Yersinia pestis CO92]  ali follow..  12  8..........................................................................................FRLSQISEHNLHHVHPDLVLIVRRALTLSHIDFRVIEGIRTPERQRQMVLN-----HSKTMNSRHLTGHAVDLAPMVN-------NRIPWDDWHAFVHVAKAMKQAAKAMELPLQDWHFEL........................................................................... 127
17 -12.800IDP90420 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_465 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  3LILLLTLCLSSLLSGCSTDNRQTSYIEAARITTQSSGSLILYPVIEPRSAPTYHWPTPKSPVITN-YSFHCHGTSGSLSTEETLVFDCNGIKHLAKPFSIHPLLVTIAQYIHHHF------PITIEEGYCCPMHYKFLLTSDTSI------SEQHCKGLAAIV........................................................................................................................... 152

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 4 4 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.