current user: public

If you have questions about the server, please let us know.

Query: IDP01786 hydrolase, putative [Coxiella burnetii RSA 493] CBU_0502 [Coxiella burnetii RSA 493], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst MGVEHILCVGVDLTHAQTVIEIAARFENVSASVGLHPSEKVDHEPTVQELVEVANHPKVVAIGETGLDYYYNHSELGKMRDRFRCHVQAALKLKKPLIIHSRSAQTDTIQIMQEENAQSVGGVMHCFTESWEMAEQAMKLGFYISFSGIVTFKNAKNVAEVAKKVPLEKMLIETDAPYLAPVPYRGKKNEPQYIPYVAERIAELKNIPLNEVARKTTENYYHLFGLast
1 -116.000IDP01786 hydrolase, putative [Coxiella burnetii RSA 493] CBU_0502 [Coxiella burnetii RSA 493]  ali  100  1MGVEHILCVGVDLTHAQTVIEIAARFENVSASVGLHPSEKVDHEPTVQELVEVANHPKVVAIGETGLDYYYNHSELGKMRDRFRCHVQAALKLKKPLIIHSRSAQTDTIQIMQEENAQSVGGVMHCFTESWEMAEQAMKLGFYISFSGIVTFKNAKNVAEVAKKVPLEKMLIETDAPYLAPVPYRGKKNEPQYIPYVAERIAELKNIPLNEVARKTTENYYHLFG 225
2 -104.000IDP00957 gene: ycfH; predicted metallodependent hydrolase STM1202 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  43  33.DVKFCLAVATTLPGYRHMRKLVGKRDNVVFSCGVHPLNQDEAY-DVEELRLLAAEDDVVAMGETGLDYFYTPETKIRQQASFIHHIQIGRELHKPVIVHTRDARADTLAILREEKVTDCGGVLHCFTEDRETAGKLLDLGFYISFSGIVTFRNAEQLRDAARYVPLDRLLVETDSPYLAPVPHRGKENQPAMVRDVAEYMAVLKGVAVEELAQITTDNFARLFH 255
3 -92.400IDP00130 gene: yjjV; putative deoxyribonuclease YjjV NT01ST5659 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  29  32.GVEKIIVPATEAAHFPRVLALAARFPSLYAALGLHPIVIERHADD-KLQQALAQQQNVVAVGEIGLDLYRDDPQFARQERFLDAQLQLAKRYDLPVILHSRRTHDKLAMHLKRQDLP-RTGVVHGFAGSLQQAERFVRLGYKIGVGGTITYPRASKTRDVMARLPLDALLLETDAPDMPLKGFQGQPNRPEQAARVFDALCELRPEPAEVIADTLYRNTITLFR 256
4 -9.390IDP00347 gene: racE; hypothetical protein lmo1237 lmo1237 [Listeria monocytogenes EGD-e]  ali follow..  17  1............................MKQAIGFIDSGVGGLT--VREVLKQLPHEQVYYLGDTARCPYGPRDKEEVAKFTWEMTNFLVDRGIKMLVIACNTATAAALYDIREKLDIPVIGVIQPGSRAALKATRNNKIGV-LGTLGTV---ESMAYPTALKGLNRRVEVDSLACPKFVSVVESGEYKSAIAKKVVAESLLPLKSTKIDTVI............ 180
5 -9.300IDP00007 gene: racE-1; glutamate racemase BA_0847 [Bacillus anthracis str. Ames]  ali follow..  15  8..............................SVIGVLDSGVGGLT--ASEIIRQLPKESICYIGDNERCPYGPRSVEEVQSFVFEMVEFLKQFPLKALVVACNTAAAATLAALQEALSIPVIGVIHPGARAAIKVTKKGKIGV-IGTVGTI---QSNMYEKALHELDTYLKVHSHACPTLATVVENRLEDTAYVTQQVKQALLPLTKEDIDTLI............ 185
6 -9.240IDP05326 gene: murI; glutamate racemase [Clostridium difficile 630] CD3562 [Peptoclostridium difficile 630]  ali follow..  15  6................................IGVFDSGLGGLT--LKEIMKILPNEDIIYFGDTARIPYGSRSKETIIKYTFQAINFLKTKGVKAIVIACNTATARSLKEAQEKYDIPIIGVIEAGARTAVSSTKNKIVGI-IGTEGTI---SSKAYNLEISKIDESIEIVNKACPLFVPIVEEGWANTEVAKLTAKIYLQELKEKNIDSLV............ 181
7 -9.230IDP00351 gene: adeC; hypothetical protein lmo1742 lmo1742 [Listeria monocytogenes EGD-e]  ali follow..  14  118.GIEFMLEDAKGAP--------LDMFVMLPSSVPATEGEHNGETLHAEKLHPLYRHEKVIGLAEV-----MDFPSVAKGSDDILRKIIDAKKEGGRIDGHGAGLTSADLNNYLAVGIRT-----H--STTAKEATDRLRAGMFVMLREGTVGRDLLQTIPAVSEKNSHRFCFCTDDKLINDLITEGSINY-------NIKLAIKNGIDPITAIQMATINAANCHN 316
8 -9.190IDP00018 gene: racE-2; glutamate racemase BA_4717 [Bacillus anthracis str. Ames]  ali follow..  17  5..............................RAIGVIDSGVGGLT--AKELIRQLPKERIIYLGDTARCPYGPRSREEVRQFTWEMTEHLLDLNIKMLVIACNTATAVVLEEMQKQLPIPVVGVIHPGSRTALKVTNTYHVGI-IGTIGTV---KSGAYEEALKSINNRVMVESLACPPFVELVESGNFESEMAYEVVRETLQPLKNTDIDTLI............ 182
9 -8.820IDP04461 gene: pyrC; dihydroorotase [Yersinia pestis CO92] YPO1587 [Yersinia pestis CO92]  ali follow..  12  36.VFARAIVM-TTVASAIAYRERILAAVPAGHKFTPLMTCYLTNSLDAKELTTGFEQGVFTAAKLYPANATTNSTHGVSDIPAIYPLFEQMQKIGMPLLIHGEVTTKDAADYVLAGNRFLGATVTHLMFNRNHMLVGGIRPHLFCL---LKRSTHQQALRAAVASGSDRFFLGTDSAPHAKHRKE-GVFNAPAALPAYASVFEE--LNALQHLEAFCALNGPRFYG 305
10 -8.590IDP00335 gene: murI; glutamate racemase FTT1197c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  10  5..............................RPIGVFDSGIGGLT--VKNLMSILPNEDIIYFGDIARIPYGTKSRATIQKFAAQTAKFLIDQEVKAIIIACNTISAIAKDIVQEIAKA--------VIDVITAGVSLVDNLNTVGVIATPATINSNAYALQIHKKNPNIEVYSNPCGLFVSMIEEGFVSGHIVELVAKEYLSYFHDKNIQALI............ 180

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.