current user: public

If you have questions about the server, please let us know.

Query: IDP01827 gene: fliE; flagellar hook-basal body protein FliE [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0526c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
1 -51.300IDP01827 gene: fliE; flagellar hook-basal body protein FliE [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0526c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali  100  1MNNINDLRLNNNISNTNKSQNSTGIGDEFAKMLKNEINDLNKAQESGEAAMTDIATGQVKDLHQAAIAITKAESSMKFMLEVRNKAISAYKEITRTQI 98
2 -47.200IDP05015 gene: fliE; flagellar hook-basal body protein FliE [Clostridium difficile 630] CD0247 [Peptoclostridium difficile 630]  ali follow..  24  24................PLTLNNKEEKKNFEDVIIDTIDKVNFQQVTADDMKEKFIKGEDVSMHEVMLIGQEAQLSMQYLIEVRNKIHDAYQEMNKVQI 105
3 -10.000IDP91494 type III export protein [Vibrio parahaemolyticus RIMD 2210633] VP1691 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  12  31................EQAMSIPEGNNGLEGGLLENISELKNTIDNAKSSLQDSMKMDPAQLLQMQWALTRITFQEELIAKTVGKTTQNVETLLKAQ. 114
4 -8.850IDP93928 virulence associated protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007710 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  16  4LTNISPSIPSFAEQNLPEMVPGSAIGSEFQKKGANITVAAEREKAALINGADTIDVSNPSELLQFQSRMNNYNHAINFIATLTHKGASAIDSVLKAP. 100
5 -8.660IDP04060 gene: mxiI; MxiI, component of the Mxi-Spa secretion machinery [Shigella flexneri] CAC05813 [Shigella flexneri]  ali follow..  1...MNYIYPVNQVDIIKASDFQSQEISSLEDVVSAKYSDIKMDTDIQVSQIMEMVSNNPESLAKLQTTLSNYSIGVSLAGTLARKTVSAVETLLK... 96
6 -7.790IDP00458 gene: celC; N,N`-diacetylchitobiose-specific PTS system transporter subunit IIA YPO2680 [Yersinia pestis CO92]  ali follow..  52..............................ELMAQSRSALNDAHLVQTQLIEADQGEGKTKVTLVLVHAQDHLMNAMLARELITELIELHQKI..... 114
7 -7.780IDP01307 PTS system, cellobiose-specific IIA component VC1283 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  38..............................EKLCQAKECLNRAHLIQTQLIEADQGEGKVPMTLVMVHAQDHLMTTILAQEMATEMVALHKHLAGEE. 104
8 -7.770IDP01100 gene: celC-2; PTS system, cellobiose-specific IIA component BA_5442 [Bacillus anthracis str. Ames]  ali follow..  13  40..............................EAMVKAKEAINEAHHFQTELIQSEARGEKTEISVLLIHAQDHLMNAITVKELAAEFIDLYKKLEAKG. 106
9 -7.610IDP05287 gene: flgB; flagellar basal-body rod protein [Clostridium difficile 630] CD0245 [Peptoclostridium difficile 630]  ali follow..  13  31...........................TFEETLNDAMPKIEEKTDNSKGLRVD---GNNVDIEEEKVNQAMTTLQYNALISFANGKIAMTKSIIS... 95
10 -6.570IDP93927 hypothetical protein YE3551 [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007709 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  2..ALDGLDATGKWNPSALEAPDITSTGHNMGMVYRALAPLNGMIAQHGTALAEAFKDPKLEIDNKLAELSILTSNFNFGRQFQSNCLKTFRDTTG... 96

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24