current user: public

If you have questions about the server, please let us know.

Query: IDP01905 gene: scsA; suppression of copper sensitivity protein A [Salmonella typhimurium LT2] STM1113 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MAKQQRMGWWFLCLACVVVMVCTAQRMAGLHALQMQATASAAVVSAPSSTDDGSPVTPCELSAKSLLAAPPVLFEGAILALCLLLSLLAPVRVMRLPFSPPRAISPPTLRVHLRFCVFRELast
1 -67.600IDP01905 gene: scsA; suppression of copper sensitivity protein A [Salmonella typhimurium LT2] STM1113 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali  100  1MAKQQRMGWWFLCLACVVVMVCTAQRMAGLHALQMQATASAAVVSAPSSTDDGSPVTPCELSAKSLLAAPPVLFEGAILALCLLLSLLAPVRVMRLPFSPPRAISPPTLRVHLRFCVFRE 120
2 -12.500IDP04197 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_2510 [Clostridium perfringens ATCC 13124]  ali follow..  1.MKKLLVPVLVIIIFALLFVGCTNSSNSSSDSSVEIINSNQQNSNSNNNNSSNNDTKKSDSNNA........................................................ 63
3 -12.400IDP05588 putative lipoprotein [Bacillus anthracis str. Ames] BA_2883 [Bacillus anthracis str. Ames]  ali follow..  1MKVYVKIALLCLTFTCIFALACKGTDEKKETNPTSENSKNEQNTSSEGKKEPEVKSNTDSNSKD........................................................ 65
4 -10.800IDP05763 hypothetical protein lmo2331 [Listeria monocytogenes EGD-e] lmo2331 [Listeria monocytogenes EGD-e]  ali follow..  1MKKGIALLAGFMLAFSIFLTGCGGTDNTRKENHSDGSAEVKNKKDNNTSDEYVEDGLLLKVGEWT....................................................... 65
5 -10.500IDP05442 putative lipoprotein [Bacillus anthracis str. Ames] BA_0171 [Bacillus anthracis str. Ames]  ali follow..  12  1MSKKLLSLFSAVIVAAFVITGCGQSDTTNKEQKENAAKENKTEKTDTTKENKPEEKNP.............................................................. 58
6 -10.400IDP05580 putative lipoprotein [Bacillus anthracis str. Ames] BA_0936 [Bacillus anthracis str. Ames]  ali follow..  1MLKK--GILVLGSAVALSLVACGDSTKEASNEKKEEPKQEAKKENKENKESKKKITAA.............................................................. 57
7 -9.820IDP06159 hypothetical protein jhp0866 [Helicobacter pylori J99] NP_223584 [Helicobacter pylori J99]  ali follow..  12  1MNKKHRLAFLGLIVGVLFFFSCQHRLHMGYYSEVTGDYLFNYNSTIVVAYDRSDAMTS-ELQKLGFYNVFTQAEFPLDKAKNVIYV.................................. 94
8 -9.610IDP05121 conserved hypothetical protein [Bacillus anthracis str. Ames] BA_0915 [Bacillus anthracis str. Ames]  ali follow..  1MLKK--TTCILGGALVFNLSGCGNTSDKTSSESKETNSKQEEKNVQTTDEAKTKENTKQKNTEQ........................................................ 63
9 -9.430IDP05009 putative lipoprotein [Bacillus anthracis str. Ames] BA_4237 [Bacillus anthracis str. Ames]  ali follow..  11  1M--KAWKSIFVLCSFLLMLSGCFHQEEKKVEPKKKESIPETKEYGGRELKKVGQKVKETGWGTFKLEQIHS................................................. 69
10 -9.170IDP02672 hypothetical protein FTT1602 [Francisella tularensis subsp. tularensis SCHU S4] FTT1602 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  2...KKQLFAISITTALLVLSACGQTGPLYLPDEDKLNSGSTLAKSGSSIMVKQNQQNNSTSTSDNQSDTSTKVDN............................................. 73

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.