current user: public

If you have questions about the server, please let us know.

Query: IDP01916 hypothetical protein lmo0327 [Listeria monocytogenes EGD-e] lmo0327 [Listeria monocytogenes EGD-e], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .  840    .  850    .  860    .  870    .  880    .  890    .  900    .  910    .  920    .  930    .  940    .  950    .  960    .  970    .  980    .  990    . 1000    . 1010    . 1020    . 1030    . 1040    . 1050    . 1060    . 1070    . 1080    . 1090    . 1100    . 1110    . 1120    . 1130    . 1140    . 1150    . 1160    . 1170    . 1180    . 1190    . 1200    . 1210    . 1220    . 1230    . 1240    . 1250    . 1260    . 1270    . 1280    . 1290    . 1300    . 1310    . 1320    . 1330    . 1340    .
# Score Template Links and tools%idFirst MLKKIFIALIALVVIINTVSFTSVSASTPTWLEQTMNNNEPFIKEIETETGKTRANITQTDLEAITALRVTGASDIPANIDMLTHLTLLKAVQGTISSVPNSVGNLKELKILNLNTNHLSNFPTIVYQLPKLEELQLNDGTIEEIPATITNMASHLKFLTVNNNRLVKVPTIIFSTNWSNSSTGELDLFTTGNQIVTDIPANYVSNFNNGQNMLEFYDGQFQKQDQLTTTPGYTIDVPVGTDFNQLTPDKTKLALTSGRTLLAQHEFEYYDDGSSSLIHNGVAAAPGQATIFIKSKFSTQSNKFARTQVTVNIAALNGGPITVKHEDTKGQELAPPVILNGKDGDPYTTTQKTFPGYTLVATPANQNGAFTLNPATVNYVYSANDYKLTSTFKDAQGQELKAPVVDTKDYHIQDNYTTTAATIPGYSLVSTPANQNGTFGAGNVTVNYVYKKDDYTLTSTYKDTNGQELKAPVVDATTYHYQDTYTTTAAVFPGYTLVATPTNATGTFGSSNITVHYVYQANGYQLTSTFKDQQGKTISPDDVDTKTYHVNDPYTTTAKTIPGYTLVTTPTNNQGNFGTSDITVDYVYKAEDYTLTSTYKDAQGKELKQPVVDSKKYHIQDNYSTSAATIPGYTLVATPANETGTFHTSDVTVNYVYKLTDLKLTSTYKDAQGTELKPPVVDSKTYHIQDNYATTAAVIPGYTLVATPANQSGTFGSTDIQVNYVYQAVAYKLTSTYKDQQGNDLALPKVDTKTYHIQDGYTTSDIAIPGYTLVAAPTNQTGTFGASDVTVNYVYKANDYTLTSTYKDAQGKELKTPVIDSQKYHINDTYTTTGATIPGYTLVAAPANQSGTFGAANVTVNYVYKADDYTLTSTYKDANGKELKAPVVDSKTYHTKDNYSTSAATIPGYTLVAAPANQTGTFNTSNVTVNYFYKANEYTLTSTFKNVQGTELKPAIVKKGFIIKDGYSTSGVTIPGYTLVATPSNKKGTFGASNVTVNYVYKANGYALITTYKDTQGKDLKPLAIDTKTYNINDPYTATALNIPGYTLTTTPANEKGVFGASDETVNYVYKANDYTLTTTYKDANGKELQAPKVDAKTYHIQDTYKTTAAVIPGYTLVAIPKNDQGTFGANNVTVNYVYQTNDYTLTATFKDAQGNELKATEVDAQKYHIHDTYTSKAAVIPGYTLEKTPTNETGTFNASDIQVNYVYKANDYQLTSTFKDQQGNEIALPTVDAKTYHIHEAYTTKARLIPGYSLVAAPKNQIGAFGTSDVTVNYVYKKDAIIKPITPAKPTILTIKTPASKVIKTKVVKQTLPKTGDDDAGLLNLLRLIGLVLILGVFLAVGSKKLRLast
1 -338.000IDP01916 hypothetical protein lmo0327 [Listeria monocytogenes EGD-e] lmo0327 [Listeria monocytogenes EGD-e]  ali  100  1MLKKIFIALIALVVIINTVSFTSVSASTPTWLEQTMNNNEPFIKEIETETGKTRANITQTDLEAITALRVTGASDIPANIDMLTHLTLLKAVQGTISSVPNSVGNLKELKILNLNTNHLSNFPTIVYQLPKLEELQLNDGTIEEIPATITNMASHLKFLTVNNNRLVKVPTIIFSTNWSNSSTGELDLFTTGNQIVTDIPANYVSNFNNGQNMLEFYDGQFQKQDQLTTTPGYTIDVPVGTDFNQLTPDKTKLALTSGRTLLAQHEFEYYDDGSSSLIHNGVAAAPGQATIFIKSKFSTQSNKFARTQVTVNIAALNGGPITVKHEDTKGQELAPPVILNGKDGDPYTTTQKTFPGYTLVATPANQNGAFTLNPATVNYVYSANDYKLTSTFKDAQGQELKAPVVDTKDYHIQDNYTTTAATIPGYSLVSTPANQNGTFGAGNVTVNYVYKKDDYTLTSTYKDTNGQELKAPVVDATTYHYQDTYTTTAAVFPGYTLVATPTNATGTFGSSNITVHYVYQANGYQLTSTFKDQQGKTISPDDVDTKTYHVNDPYTTTAKTIPGYTLVTTPTNNQGNFGTSDITVDYVYKAEDYTLTSTYKDAQGKELKQPVVDSKKYHIQDNYSTSAATIPGYTLVATPANETGTFHTSDVTVNYVYKLTDLKLTSTYKDAQGTELKPPVVDSKTYHIQDNYATTAAVIPGYTLVATPANQSGTFGSTDIQVNYVYQAVAYKLTSTYKDQQGNDLALPKVDTKTYHIQDGYTTSDIAIPGYTLVAAPTNQTGTFGASDVTVNYVYKANDYTLTSTYKDAQGKELKTPVIDSQKYHINDTYTTTGATIPGYTLVAAPANQSGTFGAANVTVNYVYKADDYTLTSTYKDANGKELKAPVVDSKTYHTKDNYSTSAATIPGYTLVAAPANQTGTFNTSNVTVNYFYKANEYTLTSTFKNVQGTELKPAIVKKGFIIKDGYSTSGVTIPGYTLVATPSNKKGTFGASNVTVNYVYKANGYALITTYKDTQGKDLKPLAIDTKTYNINDPYTATALNIPGYTLTTTPANEKGVFGASDETVNYVYKANDYTLTTTYKDANGKELQAPKVDAKTYHIQDTYKTTAAVIPGYTLVAIPKNDQGTFGANNVTVNYVYQTNDYTLTATFKDAQGNELKATEVDAQKYHIHDTYTSKAAVIPGYTLEKTPTNETGTFNASDIQVNYVYKANDYQLTSTFKDQQGNEIALPTVDAKTYHIHEAYTTKARLIPGYSLVAAPKNQIGAFGTSDVTVNYVYKKDAIIKPITPAKPTILTIKTPASKVIKTKVVKQTLPKTGDDDAGLLNLLRLIGLVLILGVFLAVGSKKLR 1348
2 -82.400IDP05699 hypothetical protein lmo2396 [Listeria monocytogenes EGD-e] lmo2396 [Listeria monocytogenes EGD-e]  ali follow..  23  1MYKLV-KIILALFLITTVFLPFSNVKAAPTDVVNIPDPVNSGLKNIIGNPF---DEITEANMATITVADLSNMSGAPTGLDKAVNMTKLYFNQSQIKNL-DKIKNLPNLKKIVAVTTGLNNISA-LGEMPALEEVELGGDYITDFTP---LEKENLTSFSYNSYAWSNPAYHQINNDEFKTKLKSLVKLDLTWNNITDLSP--------------------------------------------------------------------------------------------------------------------TENDHITNLNLNYNQFTNVAPIATMKNKVLYLNNNNLTSIDALNTLRGLTIAYADNNNITDLSNLKNFFEAMV----------------------------------------------------------------------------------------------AQGDYEGLQINNQTITLPTINIKKGATANSTNPTLDINGQKMPVSNISNDGTVSADNKTVSFA----LPIGNKTVTYKAKFTATSSKGVPLSYSINVSQPINVSEQTDSTVSVFYQDENGNELAPTETLSGK--SGEDYQTTEKTIANYQLKEIEGQASGQFTDTDSTVTYVYEKDGAPVTVKYVDADGNDLATSDTLNGK--IDAPYQTSAKSLSGWTVKTTPNNATGVFTNSKQTVTYVYE--------------------------------------------------------------------KADGAPVTVKYVDGDGNELATSDTLNG--KIDAPYQTTAKSLSGWTVKTTPNNATGVFTNSKQTVTYVYEKA--------------------------------------------------------------------DGAPVTVKYVDADGNELATSDTL----------------------------------------------------------------------NGKIDAPYQTTAKSLSGWTVKTTPNNATGVFTNSKQTVTYVYEKDGAPVTVKYVDADGNELATSD--TLNGKIDAPYQTTAESLSGWTVKTTPNNATGVFTNSKQTVTYVYEKDGAPVTVKYVDGDGNELATSDTLN--GKIDAPYQTTAKSLSGWTVKTTPNNATGVFTNSKQTVTYVYEKADAPVTVKYVDADGNELATP--DTLNGKLDTSYAVTAKNLSGWKLTATPSNANGVFTTDAQTVTFVYAKQEDDPKKDDKTPNNTKPDTNKTPIVTTIKRQTKLPKTGDTQQDSILFGLVGTCFVLLGIYSISKKNS.. 940
3 -80.900IDP05555 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo1413 [Listeria monocytogenes EGD-e]  ali follow..  19  1.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MKHAKKSLFTFIIFMTILSITFSAKAAPLMLNLPAPQVDQLYIGDDYITGKLQQEVPMHYPGNAAYVLFNNKQYNITDYTVEN--DVNFRLKLPKTLEAGDTLNYFITGNVLDPVAYPGQESYKLAGPFSPEKANIQVNYVDETNQTLATSDTL--SGKLGETYTTSPKAIDGYQVKETPTNATGTYTTNTETIQINYVYEKTASVEYINEATNESIAPTETLS--GKIGTTFQAEVKEIDGYELSQVPSNQSGTYTDQTQSVIFKYKKVAKDVTVTYKDTKGNQLADPVI--LKGDIGSTFETEAKSFKGYKLTKTPSNHSSVFTSDSQEVEYVYSKDDAVITPPVTPVNPDKPIINPVKPTGKTSTALQLPKTGDSENNLPLIIGVSLLISGVYIFTTRRKRVK. 439
4 -79.500IDP05668 hypothetical protein lmo0576 [Listeria monocytogenes EGD-e] lmo0576 [Listeria monocytogenes EGD-e]  ali follow..  17  2.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KKKYFLCVFAVILFFTGFLFGNSPVNAAETDTS--NVTYNYIDISTLTETQKNSIIKGNPNETLTNDYENYSFVYQKNTSEPTTNTDNTSDNNKNQNGT---LLKAGDVGPNSYLIILGFILIGSGIGLLTLKKRYARQ-----------LLVFLVVLGGSSLLVGSIVQATENSNKTQESQTVAKGTKETKQPESMEGYTYVGYIHTSKNNVVEKGTVTVNYQDEQGNSLATSE--TLKGDIGQPYQTATKNIEGYQLKEVNGNTTGTFTEKAQVVTYVYQKPVATVTVKYLDQDGNKIHDPQTIS--GNIGEPYDASTDQIDGYTLTKLPNNANGIFTNQAIEVTYIYTKEAQKITIKFVDSNGDPFVLTDLTT--YKNGDLVPIY-PNLDQYHMRLNYNQQIYNQGEAVPDIVIPAKEGEERMTFNILDDQGKQIPYV-----ISQNADFSSTGIERWENYQSI--PTNREGTLTSEDVVVTYQILVYGVLIPE.............................................................. 486
5 -78.200IDP05561 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo2026 [Listeria monocytogenes EGD-e]  ali follow..  28  14FMTVLPFQMLEAQAASTS-------------IEQELDGNEPFIAETEKILSKNRQDITLADLETIQKIHVFGADSIPNKISDYKNLTALEANYGTITEVPESVGSLKELVTLNVDENNLQEFPMVIFQLPKLEVLYISRGNITEIPTEITTLASHLKVLDVSNQKLVTIPDSILTTNWKAMHDGKLGMSLAGNQIASDIPANYLDNFNSGGNMLEFYDNPTIDYLQKQDQLTYTGGTIEVPLNTDFKQLTPDKTNLGLKSNIPLFSYYDDGTSANILTNGVATDVGDGYITIKSTLSTNSNPFAKVRVPIKVTAPLKGADVTVQYLDSNGDTLATPDILSGNEGDAYASTPKTIDGYTLTQTPTNAQGTFTEEPQTVIYVYTKNSAPVTVKYLNEEGKILTASDNLT--GNVDDPYQTKAKEFAGYTLSKLPTNASGVFKTNAQTVTYVYKTIPASITMNVGDTWSAKDN---FDSAVDSLGVAVPFDEVKVDGSVDTTKAGVYPVTYSFAGDSVTIKVTVKATVVPAPPITIKPVVPAPANPNTPSTQQTPTKQSGTLKIKATHQEQPIVAGNLKLTGDNLWDSVLYS....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 603
6 -60.500IDP05657 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo0175 [Listeria monocytogenes EGD-e]  ali follow..  17  2.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................FNKKKTIASL-IVLSSLASQIALTPISALADTHDTNNIALLQNTNENVPYKYTSTLTFPTLTNQTQEDYKLEI--KLALPSGMNYTDLQVSVGGEDITNQ--VGTTSFDNSTNTVTFKFDKVKFDWKTSYSGEGGEAKIDSL--VATATATSEDKAGNKSTSTGSLK-PKDISAPVVKAEETEITYSPGSD--VTEEQFLTDIHASVTDNYDSTISLTSNFTSAVNLAVSGDYSVNVQATDKAGNVSNTLNVTVHVSTPAGANITVNHLDSNGNKIAESDT--LTGVVNSNYQSESKKITGYTLETTPTNATGTFTDTPQTVDYIYKKDTVTPTPITVNPVEPDNTNPSTSNSVEKTTYSSLPTTGDTDQSKSSTIFGALLLLISAPLL---LFKKK 415
7 -60.500IDP05663 hypothetical protein lmo0333 [Listeria monocytogenes EGD-e] lmo0333 [Listeria monocytogenes EGD-e]  ali follow..  14  590.LETF-GTMDNLPDLTYVNLSFNRIPSLAPIGDLPLIVSDNNSYLRSLGTMDGVPKLRILDLQN-NYLNYTGTEGNLSSLSDLTNLTELNLRNNVYIDDISGLSTLSRLIYLNLDSNKIEDISA-LSNLTNLQELTLENNKIENISA---SDLENLNKLVVSKNKIIDISP---------ANMVNRGAIVTASNQTYTLP-------------------------TVLSYQSSFTIDNPVIWYDGTLLAPSSIGNSGNYKDGKITWTNMTATSSSTLFNFNRLKDGLTFSGTVTQPYKSAAKVTADAEQTYTIGDTISEEQFLKDVNAKSSDGAP---VTSDFATVVDLNTFGEYEVTLTSEKDGIQGDSCKVIVKVLHGAPVISADQTISYDKHATITEKQFLE-----------DIHASTDLDTAITTNFSTAVNLNKGGDYTVALNSENEDGVKAETVYVTVTVNKDPAPIISAKTEITYDKFSKKTEAAFLDDIDADTNDGSIVTSNFATAVNLDKAGDYTVTLNSINSDGVAGTPTAIIVHVEKEKIATISTNTAQQ---------------------------EKYAKINETQFLKDVHASINASPTTAVLESDFETVVKLDVPGTYTVTITATNEDGGVSAPKEVSVIVRKIPAPEIT-------------------------DKEITYPKFDEVSEAEFLNDIHATISDKNVAITSNFST---------------------------------DVNLNKAGDYTVTLNATNEDGVKATPVEVIVHVQQGERADATISYDKFAN-------------------ITEAKFLEDIHATSSDGQSSTVITSNFQTATNFKTAMSYTVTLNAVNEDGISAEPV-----------------------AVTVTINKEPAAALKADAEVSYAKNEATESDFFKDVHLEGTEAPSTAKATSNF---DSVVDRSKTGDYTVTINATNEDGAVSTPIEVIVHIEAESTANAEVKYNKHEQTDEAKIDEANVEIKTDFAEKVDINKVGTYTVTLTATNEDGQAANPVEVSVIVSDAAAEKVNVKYVDENGSEISAAE--TLTGNLDETFSIDAKSIAGYKC---DATLSGVFSTVEQTVVFHYKAKPGVVTIKYEDTNGKAVDEDKQIT--GEVGDDFEAEAQTVSGYSCRA---IASGKITEEPQTITFTYSTASGEITVQYVDESGKKLADSKK--VTGNIDDSYSVEAKAIEGYSVVG-DDSAKGVFTEKSQTVTFKYKKNTQVSKDDPKVKGKTNQPSSTDTKLKVD--NNSLPATGDTENMILAVLIGFNMLIVASIFLFRKPKTNQ 1778
8 -49.300IDP05755 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo0732 [Listeria monocytogenes EGD-e]  ali follow..  16  23ITGSASKIETTKETNQQVNLKNNVTDIV---TSEDLGGQTWLINEVNRQLAPKTVDVNLTDLAKITTISLRSLTEVPPEIKNLVSLQRLYLFSNKLSEIPAELGELTKLTELRLDYNELSKIPDGLG---NISEIALQNNRLVQIPLSLYENRTGKNEVNVSGNQVTNSQQSEPSVYSAYTFVYPSSTPEYSGHIKANNSFISNLTNDMNLTPFLKNSPTFINLQVVYMFNSELFDGHDVTITDTNDGRVLYDGTLTSD------------------ISIPLTNFKSGVHVINVMLDNAPNNPQNQTTFLIDILPVPAHDLTVNYVDEAGAEIHEPQTVSGNVGDDYDVTTPEIDKYELEQMPTNGLGTLSSEAQTVTYVYKKVNGAVTVKYEDQNGVEITTSDVLT--GKLDATYQSKAKEIAGFTLDNSPANASGIFETNPQTVTYVYQAVPATISTIYVEDKWSAEDNFDS--AVNSVGAAVSFDDLEVEGTVDTTKAGVYPVTYSFAGESVTINVTVKAKDL-------------PAPPVTPTKPVVPIQPTNPDQPDIQAAPGEHQASTDKSEALKVTVAQKEQPTVAG---LKLPTTGDNLWDSVLYS.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 615
9 -36.600IDP01745 hypothetical protein lmo2821 [Listeria monocytogenes EGD-e] lmo2821 [Listeria monocytogenes EGD-e]  ali follow..  21  11.LVSL--TMVSNPLLTFAATNDVIDNT----TEITTDKETSSTQPTIKNTLKAGDTISEEQLATLTSLDCSSITDM-TGIEKLTGLTKLICTSNNITTL--DLSQNTNLTYLACDSNKLTNL--DVTPLTKLTYLNCDTNKLTKLD----SQNPLLTYLNCARNTLTEIDVSHNTQLTE-TPQTQLTTLDCSFNKITELD-KLLNRLNCDTNNITKLDLNQNIQLTFLDCSSNKLTEIDVTPLTQLTYFDCSVNPLTELDVSTLSKLTTLHCIQTDLLEIDLTHNTQLIYFQAEGCRKIKELDVTHNTQLYLLDCQASQNPKLVYLYLNNTELTELDVSHNTKLKSLSCVNAHIQDFSSVGKIPALNNNFEAEGQTITMPKETLTAVSPDLLDQFGNPMNIEPGDGGVYDQATNTITWENLSTDNPAVTYTFTSENGAIVGTVTTPFEAPQPIGEDVTVHYLDDKGEKL--ADDEVLSGNLDDPYTSSAKDIPDYTLTTTPDNATGTFTTTSQSVTYVYTKNAEPVTVNYVDDTGKTLSPSE--ILNGNVGDTYNATAKQIDGYTLSAEPTNATGQFTSSAQTVNYIYTKNKGVVEIHYVDEDNKQLNSTTEIS--GTIGDNYTTEPKTIEGYTLTTTPGNATGTFTTGSQTVTYVYTKNIEPITVNYVDANGKTLAPSETLNGN--VGDTYKATAKQIDGYTLSAEPTNATGQFTSSAQTVNYIYTKNTNTDQPLPTKKPTNTTPTKPSNLKTTEVKKASDTLPKT..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 824
10 -32.400IDP05082 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo2179 [Listeria monocytogenes EGD-e]  ali follow..  11  2.........................................................................................................................................................................................................................................................................................................NHLKKLVSILICTLLIVSLLPFSVWADSQERDGTDVEEITTKEKVTQETTSNETTSEPLKGTTVNKAINAKSFPTGNYSGDFSINSQKDVI------ESGQTVNYNIYLKITGPNTRYQNAKLVEFNQSLNELKIAGATPSYNKTTRQLVYTYQTLNSGVVDKVYTPNGTKLVVTGEDNLSEKVTEQAETTVNATATTALSNDVENSINNNPSQGDIGIW-----SFNLNIPKKSTGSLFMEE----------GKKIVIEYTLADKLDYLGVAGDTPEPTKVEGQKLTWEIAAPT-QIRTFFQPTNFATVENKAVATTNFVTLTDSIVDTSKASVSVSASDPATIPGIATVTGNPDIKVYDTAKLGFSLMLNSAMNDSPWYDLYYDAYYNIDDNLNLDYFRSGDFYFKPNVNYPGWA-KSPKYNLLVKYDGDTDWTTLKEDVELSKMYSRKDLGIPDDK---HFTYAPAGMYAADLSFFTTVKEGYVGEVRNSTQINMYGADSQDYIHYYDDTNPWPEAWKNYAGDRTAQIIPQPTGKNKFVQGSVVFDDTDGNLINIGDNSISVNLESNKASISVKMKNTEQNGFKVTVLNENYQNAGRQL---NVSVAKDTPSNMTVEMFGFLQDTDFNVPEVSGTPTISDTKMEIDSNDINQNGNSEESRITSGNHYILNTSN------LKISKKAKGNRDKEYSGLANATTNSIVSYQLSLENDSDEKIANMVLMDVLPSENDLGITDNSE-RGSKFNLALTKAVEVPKEWKDKVEVTYSTAKNPKRAGILDKHTIYPIGTEPLVDNTEATQADWLTASEVKDWSNIYS-KEGIEWIPGKSMKIQFALDDSVAPVTVQYVDQNHKQIASPETLT--GAYGEKFTAKQKKINNYSLVKIPANVSGTFNEKAQTITFIYQKVTGRIIVNYVDKNGEKIADSIV--LNGKLNSSYTTSSKKISGYKLYQTPKNATGKFLNTSQTVTYVYERTSNLSI------------SSSNKGTENVKKLAKLPHTGDSTTTNLWVIIGLFMLS--GAFVIMKKR... 1152
11 -30.000IDP95186 gene: lmo2445; lmo2445 [Listeria monocytogenes EGD-e] CAD00523 [Listeria monocytogenes EGD-e]  ali follow..  13  45TITQADLDTMTAIPLPSLGLTGEDLSVLNNEV-IELAIWSNNIGELPDLSEAL-PALENIEANG------ANITVFPD--ANYPNLTNVDLSQNNFGFNIPKFVGMEGLVSINMENAGLSGYEDIWMNMPNLDSLILNENHLISIPEDIFLS-QQLGTHSFANQTATYPPTTIKQGENLK................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 219
12 -26.800IDP05081 putative cell surface protein, internalin proteins [Listeria monocytogenes EGD-e] lmo2027 [Listeria monocytogenes EGD-e]  ali follow..  18  90.MQLLERAMFNNVNIVSVMEFGEDLTEFPDI--NTLFFNTPPEGVTRNLSLPDYQNYPEMV-----TMSGSNLIGAIPDFTGMPDLSQLYMADMMITSDVPDFHTIPKLSTLDLSHNQLTNLPD-FQNLTNLAELNLSFNNLTNTMTNFTNL-SNLNNLNLDYNHLNELPSNVLNSIFIENQSGTV.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 274
13 -25.500IDP05538 putative collagen-binding surface protein [Clostridium difficile 630] CD3392 [Peptoclostridium difficile 630]  ali follow..  10  64.................................................................................................................................................................................................................................................................................................................................................KVEGETAYCIDINTDFKNGYKTRADASSRMSADQISDVALSLEYVKQYGEAHKELNYKQVYLLEQCVVWQRLSVHLGWQCDNVRASYDEIPKATQDEVFAGAKAFVKENKGRYECGGYIYSGEGQELGQFNVGNAKLQKTSSNTSITDGNGNYSIAGATYGVFSDKDCTKQLATLTT-----------------DKNGN-----------------TDVIEVKAGTVYIKELSAPAGYKVDKTIYPLTI---KAGETATLKVSDTPKVTDTLVELFKIDMETQKDNPQGNASLAGAEFT---KYYAGFYNKDNLPAE---TRTWVTKTIAETDSDGTTHYITKLADAYKVSGDSFYMQDGK---LTVEETKAPNGYLLDGAYMQAGDKSEQIKGLYLTQITEDGDLAVLTGS---------NQFSVSDKVIRGVKIQKRDLETGDTKPQGSATLK--------DTAFDIISLNDNAVLVEGKLYKKNEVVKTIHTDL---EGVASTSADLLPYGKFRIVESEAPDGYLTDGAKPIDFAITENGKIVDLTDEAHSIYNQIKRGDIEGVKIGAGTHKRLADVPFRITSKTTGESHVVVTDDNGQFSTSADWASHKHNTNAGKTSEDGVWFGASEPDDSKGALPYDAYIIEELKCESNKGFELIPPFEIVVSRNNLVIDLGTLTDEYEKEISIHTTATSKDGEKTILAGKEVTIVDT-VKLDGLTKGTKYQLKGWQMLKEENAELIIDGKRVENDYTFIADEEEMKVEISYTFNASALGGKNLVTFEELYDLSNPDEPVKVAEHKDIEDDGQTVLITERIIKIHTTATDKDGNKELEAGKDVTIIDTVTLE---------GLEVGTQYKLWQMLKEENAELLV-----NGKRVESDIADSENMKVEVAFTFDATSLDGKQLVTFEELYDLSNTDEPKKVTEHKDIEDEGQTITFKEKPEVPEKPEQPQTPEKPSRPSDSPKTGDSTNLMAFIVMLLVSGGGLAGTYLYKRRKMK 1012
14 -25.200IDP05502 putative collagen-binding surface protein [Clostridium difficile 630] CD0386 [Peptoclostridium difficile 630]  ali follow..  11  230.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................FADKDCTKQLATLTTNENGNT----DVVEVTTGTVYIRELSAPAGYKVDKTVYSLKV---EAGKTATLKVSDTPKVTDTLIELFKIDMETQKDNPQGNASLAGFTWKYYAGFYNKENLPAEATRTWV------TKTIAETDSDGTTHYITKLADAYKVSGDSFYKAVLPLGTLTVEETKAPNGYLLDGAYMQAGDKSEQIKGLYVTQITEDGDLAVLSGSNQFS--------VSDKVIRGGVKIQKRDLETGDTKPQGSATLK--------DTAFDIISLNDNVVLVEGKLYKKNEVVKTIHTDI---EGVASTSADLLPYGKFRIVESEAPNGYLTDGAKPIDFAITENGKIVDLTDEAHSIYNQIKRGDIEGVKIGAGTHKRLADVPFRITSKTTGESHVVVTDDNGQFSTSADWASHKHNTNAGKTSEDWFGTSEPDDSKGALPYDTYIIEELRSDSNKGFELIPPFEIVVSRNNLVIDLGTLTDEYEKEISIHTTANSKDGEKTILA---GKEVTIVDTVKLDGLTKGTKYQLKGWQMLKEENAELIIDGKRVENDYTFIADDEAMKVEIAYTFNASELGGKNLVTFEELYDLSNPDEPVKVAEHKDIADDGQTVLITERIIK---HTTATDKDGNKELEAGKEVTIIDTITLEGLEVGTQYKLVG-----WQMLKEENAELLI-----NGKRVESDTADSETMKVEVAFTFDATSLDGKQLVTFEELYDLSNPDEPKKVTEHKDIEDEGQTITFKEKPEVPEEPETPQTPEKPSRPSDSPKTGDNTNLYGLLALLLTSGAGLAGIFFYKRRKMK 1012
15 -24.800IDP05656 hypothetical protein lmo0171 [Listeria monocytogenes EGD-e] lmo0171 [Listeria monocytogenes EGD-e]  ali follow..  11  142.ITSL-TGIEHLTALENINVNNNELTTIDSLFNKSISANNNKITGNFSLVKTLPNAITELDIENLKKLTLKNLSQLNGTLMNLPEIISVDISGNYLDSDDIHLENLPAVKNLDISSNELTRLPK-INDFPLLTTINVRSNKIDRLESSKLVDVPKLATLNADKQAVTLSKTIAAGNFTIPNNVENLAGQMVTPKIISNNGTYSDQSIAWASGELSGLSKVSYTFDEVINSPAIAGKYTGTVNQPIEVKAVPVIVADKSVSYAPVNAKDEATFLQDIRASASENAQITSDYSEVVDFATPGDYTVTLHAKNEFDLKADPVTVVVHINDIQKPQVANSNDISFEVGTELTSEVLLAKSGAVVTDLYDEAIKMEVDLSEV-------------------------------DSSKLGTYEATIIAKSKSGASSDPIKLSVKIVDTEKPIIIIIEKGSELTEGQIIDQVGITATDNYDQDLNIHMDLS-KVDTSKPGSYEVTIYTEDSSGNRSETVTITVKVPEARIGKITIQYMDSENNELAESN--TITGEVGETYETLAKEIEGYTLKENPANSSGVFEETRQTIQYIYVKDIINPEFPVYSENNVTPELPSNNNNSVNGSRQTPSKSVKKQS-KAYSKINQMPMNLPETGDSTNLLF................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 811
16 -24.700IDP95476 internalin [Listeria monocytogenes EGD-e] NP_465993 [Listeria monocytogenes EGD-e]  ali follow..  18  101.VTDV-PDITTIPHLKTLFFADPPGRLTRNLSLPNYQNEMDTITMSGNNLIGSIPDFTGMPALKQLYMSEMLITSELPNFNNIPLLITLDLSSNQLTTIPD-FQNIPNLTFLDLNANLLTNTPD-FQNLPKLTDLNLRHNNLTGTMVNYTNL-PSLESLNLDYNFLTELPSNVLDTIYVQSQNGELPDQTINQGDTCTID............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 310
17 -23.300IDP06545 gene: fms18; LPXTG family cell surface protein Fms18 [Enterococcus faecium DO] AFK59452 [Enterococcus faecium DO]  ali follow..  11  139.................................................................................................................................................................................................................................................................................................................................................................VNGYTLHSIKRSDGSAVNIAAIESKINQAIADYQKKPSFHNSTVKTVLGQSTTVTD--------TNGLNLSEFDEVVENIANIDYRVNGNQL----------------------VITPNANSKESGELTLKKSANTGTPVAYKMAGQQTLMAGAIDKPNTYTIKIDVETEGSLKIKKVDKE----------------------TGNVVPGTVFH-------------------LDFGKTLPAKDVTTDKEGIATLDEIPHGAK------VTITEKSVPPYTIDTTPITAT---SGETISVTSKNTREKGQIILNRKDSPTGEIVQEMTTDEKGHAETPKEIANALELGYYVTETKASNGFVNTFKPVKVELNYVNQTVALVTSNVKGQNQEITGETTLTKEDKDTGNETQGKAEFKGYTLFTAKDGQAVKWSEAFKPELVKGTKASDETVTLTLDEKNQ-----------------VAVKHLAINEYYWQETKAPEGYTLDETKYPVSIKKVDDNEKNAVITRDVTAKEQVIRFGFDFFKFAGSAAGTAETGFNDLTFK--------VSPLEGTSEITGAEDEAITAYNEQLGFDGY-----GKFENLPYGDYLLEEVEAPEGFQKITP-TFKENKADYTKSEYIFTITEKGQKQPIKTVTVPYEKLTWKDGGKELTDLDSTELVDKLSYNLHEIKEDWYVVAQAIDVEATKAAQEKDEKAKPVVI----AETTATLANKEKTGTWKILHKLTAEQVLDKTIVLFNYVYENKKPYEAGDDPVAKDASLNNQAQTVNCTVERHVSIQTKAHLEDGSQTFTHGDVVDMF----DVSITHDVLDGSKEAFETILYALLPDNTTKEIWK---EFTKTVLAEKVDTSKYPEGTSFTFKEINYGKDGNINGKHNED--LKEKTQTLTP------KKVPTTPSAPEQPEIPTVPSDSQESSPTVKTFPQTGEKNSNVLLFIGFTLIFATAGYYF----WNRR 1074
18 -22.800IDP91625 gene: ECs2073; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB35496 [Escherichia coli O157:H7 str. Sakai]  ali follow..  15  94.LTHF--DATNYDRLVKLSLNSNTLESINIHQGTHISMNNNCLRNIDTYFSAAHNKLEFVQLESCEWLSHNQLTDI--VTGNKEELLLLDLSHNKLASLH--NALFPNLNTLLINNNLLSEIKMFYSNFCKVQTLNAANNQLEKINLHFLTYLSSIKSLRLDNNKITRIDTE------NTSDIRSLFPIIKKSESLNFLNISGENNCP.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 305
19 -22.100IDP91619 gene: ECs2672; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB36095 [Escherichia coli O157:H7 str. Sakai]  ali follow..  11  9.LKTQSVQLNKITSNTESTIKQHELVSDDAIINLVSCLGNDKFTPVSEDSNLLNENYGAYDKTG--EFISTNIAELLDKLTKITHSNELNLSSLSLGSVPPLPEWIESCKELELDFNNLTEFPQVPDGITKAKKIFICHNKLSEIPALP----DTAKVFDCSENNIKEIRWFPKNLKEAYIEYNKIEVIPAIPGNLKLLKCNPIKEAFLMPWTLTGIRYEISQRKYIVMNPADYDKYSDMVKKHVIDGEEFIIKYY.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 378
20 -21.900IDP91618 gene: ECs2674; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB36097 [Escherichia coli O157:H7 str. Sakai]  ali follow..  12  9.LKTQSVQLNKITSNTESTIKQHELVSDDAIINLVSCLGNDKFTPVSEDCNLL-NMLSEFKLENYESYDKTNIAELLDKLTKITHSNELDLSYLFLGSVPPLPDWIESCKELELDFNNLTEFPQVPDGITKAKKIFISHNKLSETP----AIPDTAKVFDCGYNKIQEIRYFPKNLKEARIGYNNIEVVPAIPGNLKIL............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 319
21 -21.300IDP05655 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo0159 [Listeria monocytogenes EGD-e]  ali follow..  11  44...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TVELLDKDGVPQTDSIPNSTNVKAGDTMDFTLPS--QLALAT---DLAFDVKDSKGQVTATVKKATNQVTLVFSDY---------------------VEKHSDVKGELDFWTAFNQKVITGNETVDLVFPLENGTTVIDVEVGEKTPVSPTETLFK------YGWVDASNPSLIHWVVRVNYAKVNIPNAVFTDIIGAKQTLNFDSIKAFHGTYSAD--------------RVFTAGAPISSTNFSATSDGFSVALGNLTDSVQISYTTTTTDGGKSTQYDNTAKLAGTDFVTKQTSTWTPASGGGGEGGGTTGSVTLTKEDAKTKATLEGAEFKLVDSKGTVLQENITTNASGQ-----LSIADLKFDTYQLIETKAPTGYKLDTTPVEFTIGENNQAITVTKENTLNTGSVELTKLDAATK-----------------------------------------------------ATLAGATFELQDKEGNTLQTDLKTDENGVLGSYQFVETSAPTGYKLDNSPVSFEVIAGETDQVVKVTKENTLAGATFELQDKEGNTLQTDLKTDENGVLGSYQFVETSAPTGYKLDNSPVSFEVVAGETDQVVKVTKENTLAGATFELQDKEGNTLQTGLTTDENGVL--TYQVETKAPIGYELDTTPVSFEIVAGETDPIVKVTKENTLVPPTPVPPTPVPPTPVPPTPVKTTPIRITQSLPKTGDTNSFAGLGVILIALSLSGLLL----KRK.. 793
22 -19.900IDP01918 hypothetical protein lmo0514 [Listeria monocytogenes EGD-e] lmo0514 [Listeria monocytogenes EGD-e]  ali follow..  10  1MKKALKLFLATICMFIMIYPSTAAHAEETNIVNIPDANLKTYLNGLLKQ--ASDAPITKTQMNTIQTVTLSTYTDL-TGLEEAGNLVTLSLNNTNIQTL-EPIKNQTSLTYLTVGGDNVKDSLVDLNGLVNLQSLSINGSEVTHNVFKTFNKLPKLTYLYAQNSMKITDISALASLPALTNDFESFKNGNLKALAAFGQNTGRTNPRITLKS-SMMPKPLTSFDGTVAPFSKSTSASNTYLGFNDVALPSSRLSITDDGITVSGVTKEEFDNLDEIEYNARYDFPTGSYPTPPSMTSYTISSGTYDQYFDISHTLDLTADESFDYNQYDTKDVHAETDDGTAVKSDFDVKLDVPGEYTVTLNAENAAGLKATPVTVKVTVHEKPVITSDSQISYKKETTKSVDEFLK---------EIHGSVTGNAVLTSDFDKVVDLNTPGEYTVTLNAINDRGTVVVTVTTSDSGHVDPV--PPTPQEETDQTIIPEPQSETTEDSVKEDQAKDGQAKSEEKAD------KTSLTTKENKVEKSEKTNQPKTKALPQTGDT........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 580
23 -19.600IDP05697 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo2178 [Listeria monocytogenes EGD-e]  ali follow..  14  508................................................................................................................................................................................................................................................................................................................ANGNFNLTYKNTNTNAYEITYTDFSDRKIKNEITDENGVSADATIAIQP-------DLLKKEAGTIDYFNNTMTWKITANSDRIKMGITDEFSTGVKALKSYTVRAYTDNTNSVLLTEGKDYTIDKDVTPAGFYIQDKKIVVDFVTDIDLSDVTKTIDNKASISYYDGGIIKYVDEVTASMTPDPGM-------MTNGGKYGSYNSTTGNIDWIVSVNAMNLIFDDAIPTGLTYVEGSLQYRNVASTSE-LYIPLNSVGTVAKTGDKNYPTKVDTTGNKLHLEFANLNSRVFIKYSTKFYSYVQNTAKVSDNGVGEKSYSYQAYASKLFNAMTKTATID---PSFDNKVNWIVTLNNIS-NPTITDTMKTGTTGAQVVKSSFKVMNETTGEDIDSKYYDITYTDNNFTIQFKDYKATAPIKVTYSTISLM--------SGLVSNTATTASPDYGSLPMTYKSRTTSISPAFTIGSGSGTATIGSLEITKVDKKDNSKAKFQLYTLEGDKAGQEATTDSDGKIGKYKLVETEAPTGYTISDEYKDGKEITVTADIATSVTIENTEQTAEFELQNADGTKVADNLVSNADGKIGDYQFVETKAPTGYVLDGAPTKFTVEFNQEAVIVTKENTAKTGSVVLTKEDSVSKA---------------------TLSG-------------------------------AEFELQNATGTKVKDNLTTNADGKL--DYKFVETKATGYELDATPVTFTIEFNQATANVTKENVAKTGSVVLTKLDSKSRSNLAGAEFELQTKLGVSLKDKVTEANGYQLVETKAPTGYDLDATPVEFTIEFNQKAANATFKLVDEDNNVTENLTTDAS--APGDYQLIETKAPAGYELDTVPVDVKITFDQKETTKTNLKTVVSGKVIAEFVDTKGNVLAEKEIH--TGIVGDKYATKAKDIKGYKLTKQPTNKEGVFKETEQKVTFVYEKNKAPIVVNPDKPVTPVKPTKPVDPAKKPTVKTSLPSTGDESPYGIIFTG--LFASFMGLFLLRKSKKIN 1598
24 -19.500IDP02719 gene: inlG; internalin G [Listeria monocytogenes EGD-e] lmo0262 [Listeria monocytogenes EGD-e]  ali follow..  12  17AILGISLWVNASHGMKAQAESIAQPAPINEIFTDPALADEVKTELGKTSVTDEVTQTDLNQITKL-EADDKGINSI-EGIQYLTNLNMLGVSSNQITNI-TPLANLTNLDSLYLGDNKISDVTP-LSGLTQLTFVQLSINQIKDVTPSPLVNMTDLTVLHLEKQQITAAPVVYQTNLVAPDILKNAYGEVVPPTTISNNGTFASPNITWNLDSFTSEVSYDFNQKITLGDNGKVTFAGTVVQPIVEAPVNYITTFDVDGTTTTENVVVDTLITEPAEPTKEGYTFSGWYDAETGGNEWDFAVDKMPATNMTLYAQFTINSYTATF-DVDGETTNQKVDYQALLQEP---TAPTKDGYTFVGWYDAKTGGTETSDITLYARFTKNPSSDN----QTAPGKDDKNDKDKLTIKANDSADATSTPKTSDDSSMIPTILGTLFIGGAILI---LRKKTTNI........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 490
25 -19.500IDP02569 gene: inlE; internalin E [Listeria monocytogenes EGD-e] lmo0264 [Listeria monocytogenes EGD-e]  ali follow..  17  86.ITTI-EGLQYLTNLSELELIDNQVTDLNPLTNLTLRLSGNPLKDVSKTMDLIYTDITDVTLSNLQVLNLNQITDI-TPLAGLSNLQFLSFGSTQVSDL-TPLANLSKLTTLNAMNSKVSDVSP-LTGLSNLTEVYLEENQISDVSP---AKLPNLSIVTLTNQTITNQP.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 266
26 -19.000IDP02661 hypothetical protein lmo1289 [Listeria monocytogenes EGD-e] lmo1289 [Listeria monocytogenes EGD-e]  ali follow..  15  16VMVLVPLSQTSLPSFAAEEIALKEDPQLKKELNLYLNQAEAQMATFRNTLNSGIKDLTGIELKNITTLSINNINASYEPIQTLSSLEKLVINGENVNDIIPDLSVLSNLTFLDLSRTNIDDT-SKISNIPNLNKLDISNNKITKISE---NNLPSLQELRVSDCQITNFK.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 202
27 -18.600IDP05426 hypothetical protein lmo0610 [Listeria monocytogenes EGD-e] lmo0610 [Listeria monocytogenes EGD-e]  ali follow..  12  1.MKKM-GVKIGLCILLIMPFTISFSANVSAEENISIKAAQDVVNIPDPALKSY-SDITEAQMDTITDVTIASLTDL-TGLDYAHNLTILHLTNTGVTDY-SLVANIPSLTNLNISGSNLTTNSPDLNGLTNVTNLNLSSGKLDNSALTKFNKLPNLTFLNLDNNPSITDFMPLKSLPNLADSFPKLTNLAAFGQNVGSAIL---ANQTIFVPFTLMTERSMNFDGYLFPFTTNTASSSTYFTLNGVQISGSRLSIDDTGVTVSGITKDFFDSITKMEYNAFYDNPAGSYNSPPNFNSYSVSSGTYDHYFDIDHSLTITNDSAISYGEQT-EQFLKDVHAETDDGTPVTSDFNTIVDYTVTLNAENAAGLKATPTQVTVTILAKPVITADKSISYTKDQDIAAKTSDGSKVTSDFDSVVDLAKVGTYKVTLNAVSADGLNADPVIILVNVVAGNEPPTPPGPGPDPTPDPTPNPNNPNINPNPDNGQSAKSEIASNPSNSEVNIALPNTGDASQATTVL.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 570
28 -18.400IDP05223 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo0160 [Listeria monocytogenes EGD-e]  ali follow..  12  28.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................VKAATNYGSDFLKTVELLDADGNPQTDFGYYD----------SIKVHYTWEIPNSTNVKE----------GDTMEFVLPP--ELKIVT-DLDFSLKDHDGNTVGHVIAKKSTGQVVITFTD--------------------FVEKNSNISGYLDFWTNWDKSLVEGNENVPVEFPVNGTTETIDVGVGGKNQIDVNYSKQNIQNAVYEDFIGPKQVVDFNIKAFHGEFDPDDNFTPGAEVPSSAITQTTDGFKVDLGNLTDSVKISYYTTSTDNGASPNYNFIKQEIEVATPTSGGGGGGEGTTGSVELTKTDDSSQKNPLEFKLVNGAGATVQTGLKTNADGKLDTYQLIETKAPQGYVLDASPVKFTIDDTHQSLFVSKENTAIKGSVSLELQDKDGNTLKTNLKTDQKGKL--EYQVETKAPTGYILDTTPLKFKISTEALNVTVTKENTKKPEIPKVPVPPKK----PEKPDKIISEDSKQTALPKTGDSPLVNGWGLL--LVAISASGLIALRRK... 565
29 -18.300IDP00034 internalin, putative BA_1346 [Bacillus anthracis str. Ames]  ali follow..  17  96.IEDV-TALAKMEQLDYLNLANNKITNVAPLSATYLTLAGNQIEDI--------KPLYSLPLTDL-VLTRNKVKDL-SGIEQMKQLEELWIGKNEIKDV-TPLSKMTQLKQLHLPNNELKDITP-LSSLVNLQKLDLEANYISDLTP---SNLKKLVFLSFVANEIRDVRP---------IELSKTAYINVQNQKVFLEE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 275
30 -18.200IDP05553 hypothetical protein lmo1136 [Listeria monocytogenes EGD-e] lmo1136 [Listeria monocytogenes EGD-e]  ali follow..  15  88.VQSL-EGVEYLKNLTQVFGYGNQVSDLGPLSNLTIQMPRNQISDLTMSLDFEFNNLQTIELTNMLELNVNPISDI-NAVKNMTQLEFLTLRDCEVSDL-SPVENLSNMLMFWAGRNNISDITP-LKNMSKLLGLSLFGNQIKDVSV---KNLTSLEDFDIKANQVSDISS---------ATSTTLETLTLSFNQIIDIS............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 290
31 -18.000IDP01994 hypothetical protein lmo1290 [Listeria monocytogenes EGD-e] lmo1290 [Listeria monocytogenes EGD-e]  ali follow..  13  1M--SVKSNIVKIGVCFAVLAVPVSQTTLPVFAAEQPGLKASQDNVNIPDSTASTANITEAQMDSLTYITLINVTDL-TGIEYAHNIKDLTINNIHATNY-NQISGLSNLERLRIMGADVTSDKPNLSGLTNLTLLDLSHSAHDDSILTKINTLPKVTSIDLSNGAITDIM----------KTMPELKSLNIQFDGVHDYR............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 203
32 -17.900IDP00005 internalin, putative BA_0552 [Bacillus anthracis str. Ames]  ali follow..  12  606.IEDI-KPLHSLEDLEKLNVSDNGIKNVPELFKMQLDLSNNKLDNAALDGIHQLENLDALLVNN------NEINNL-DEISKVSKLNKLEMMSNKVRDI-SPLASLKNLQWLNLSDNKIQDIST-LSSMLDLLSLKLAGNEIRDVRP---IQLAQWITVDIKNQKIVLEDGQMNQE-------IQIPIYDLEGEIFEDIELKSTDGIVT................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 798
33 -17.700IDP05423 gene: inlH; internalin H [Listeria monocytogenes EGD-e] lmo0263 [Listeria monocytogenes EGD-e]  ali follow..  19  88.VTTI-EGVQYLNNLIGLELKDNQITDLTPLKNLTLELSGNPLKNVSKTLDLTSTQITDVTLSNLQVLYLNQITNI-SPLAGLTNLQYLSIGNAQVSDL-TPLANLSKLTTLKADDNKISDISP-LASLPNLIEVHLKNNQISDVSP---ANTSNLFIVTLTNQTITNQP.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 268
34 -16.900IDP05076 hypothetical protein lmo0801 [Listeria monocytogenes EGD-e] lmo0801 [Listeria monocytogenes EGD-e]  ali follow..  18  115.ITDI-APVANLKKLTTLLINTNQITDISPVADLAFYCGNNPISDISSIFNCYTANVEDISLVNLKTLSLNNIHDI-SDIEKLTALEYLSFSNNPVENP-EVIGNLTNLNTLWLYNAQIRNIDF-TANLPKLKSVYLYNNQISNISE---SNWANIEYLELNNNQITDITP---------ANLTTLKTLKLNDQIITNREIPFQKNIS.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 325
35 -16.900IDP05117 putative collagen-binding protein [Clostridium difficile 630] CD2831 [Peptoclostridium difficile 630]  ali follow..  11  12............................................................................................................................................................................................................................................................................................................................................................................................................................................................SLIMILSM--VVSTIYPTVSYASELGEN--SQIQSGSTNSSTGEEKESDNKKPEQTPEKDKATDNKKP---------EQTPEEEKPTDNKKPEQTPEEDKSTDNKKPEQTPEGEKPIDNKKPEQIPEEDKSTDNKKSE------QALEDEKPLDNKNTEKTPEEDNLLEDENLLKVLEEELNEENEDYGFVVKINNNTIETESMKKISFNLTYTPTSKGI------QAGDSITPDVFNKVNLDYTSECFDKTESNGEYTLTFRELPNGQSVMQGKIGLEAYVKKVDEDTNAKIHETTGKIESGSGDIDVEIKPGDKTDVPDAKGTLKKLVEGKKSTTVFMPVKNKDINYSIQVNEKQEELKLYDEEGLTLINGSV--------SVVTSDGKEVSDFNIEQSKNSISVNFGNIDKSYTVKYKARISDKNAKHGNKYKNVAR--IESDGKKIQEDDATVSIFDRGDDYLLTKGHSGATNITQVGQVINYQIS----------INDDKSPISNVVITDNIPEGMRLTTSGEAGHDFRVVEIPMNGSWT-VITGFTINLSKEEVESKFFIAYISIEDSYINRAVLDANNSEIDKNDEINFKKNSGLISAKKEVDKKVLNSSDNQIVKYKINMSTYGVYVNLLDEVNSVLEEPVQSWVTFDANFTNVKVGETIRNVAQINGSSPPGVETTKQGYAFEAKKVDALDKAKFNLEDAFGNIVVKDLVSDEDGIIGTYYLVEIMAPRGYEKLKDKIKVEIGNKDIGRIVDIGNIENIRQENPPVNPPAPPN-DKPRKPSSSSDTEDTIVINPPVPPSEDIINPPIPEVLNPPVPPSEEM---TPVKQIIPIPEVVKPSVSEEKNNKVKDDTLVNPPVPPKTGDSTTIIGEILLVIGAIV--GLIVLRRNKNTN 972
36 -16.400IDP06520 gene: ebpCfm; pilus subunit protein EbpCfm (Fms9) [Enterococcus faecium DO] AFK59016 [Enterococcus faecium DO]  ali follow..  10  21...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LTNSFGAKKVFAEETAAQVI-LHKKKMTDLPDPLIQNSGKEMSEFDQYQG----DISFSV-------YNVTQEFYAQRDKGASVDAAKQAVQSLTPGTPVASGTTDADGNVTLSLPKKQNGKDA------------YTIKEEPKDGVSAAANMVLAFPVYEMIKQADGSYKYGTEELDTITVGNDGTLKVTKIGTAENEALNGAEFIISKEEGTPSVKKYIQSVTDGLYTWTTDQTKAKHFITGHSYDIGNNDFAEASIEKGQLIVNHLEVGKYNLEEVKAPDNAEMIEKQTITPFEILANSQTPVEKTIKNDTSKVDKTTPNGKDVAIGEKIQ--------YEISNIPLGIADKEGTQNKYTTFKLIDTHDA--LTFDNDSSGTYAYALYDGNKEIDPVNYSVTEQT-DGFTVSVDPNYIPSLTPGGTLKFVYYMHLNEKQANVDNGHTNDQTPPSVDVVTGGKRF-DGDVTSDQTLAGFVVRDQDSDTAKYLSIDPSTKAVSWVSAKESATVFTTTSNGL-----------------------DVTGYYLEETKA-PEK------------YVPLTNRVAFTIDEQSYVTAGQLISPEKIPNKHKGTLPSTGGKGIYVYIGAGVVLLLIAGLYFARRKHSQ.. 624
37 -16.300IDP91680 INLB_LISMO [Listeria monocytogenes]  ali follow..  19  88.IKSV-QGIQYLPNVTKLFLNGNKLTDIKPLANLK---NLGWLFLDENKV----KDLSSLDLKKLKSLSLNGISDI-NGLVHLPQLESLYLGNNKITDI-TVLSRLTKLDTLSLEDNQISDIVP-LAGLTKLQNLYLSKNHISDLRA---AGLKNLDVLELFSQECLNKPIN........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 248
38 -16.200IDP05077 hypothetical protein lmo1115 [Listeria monocytogenes EGD-e] lmo1115 [Listeria monocytogenes EGD-e]  ali follow..  11  143......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................YQQRKAEIMAMVNRHDTLPSWHNQEVKVTVGESITLADSHGVLSGMSLESNNTNATLQQDGNNITI----------------TPNAN------SNDGSITYRKVPQNEVGTSIVYTKPQHQTLVEFHLESAKQATVKVDVIKLGNVQITKVDEETGR-NGTSTELVTDSNGIALIKDIPEGTKITITEVKAPN------------YVNKGVSQVVTIEPNKTIELTFDNKEQLGIATLTKAGEEAKEIEVTESEYGDVHTFKYNANVVAGVTYRIEATQDIHSVDGTLKAKKGDTVATVTTDEK------QWHSPNLYLGEYQAVEVSAPAGYILDTRPIPFSLTYAGQEVELASTAIKATNEFQTLDLRLFKDEESILSWNNNQPEIEVIQGQEKV----GVFTREAQALTDEVHVPANALLGYQTVSDGVASFELKLPQGK---------------YYLKELEAGTSHVLNDTEYDFKFTAENNNATYPIYIYQDTVAVGNETMLKIARTPIINKLHFNEFIIKKLNEQAIFDKESGVEFNYDGLGT-LENEDNEVIQEVTIDKDGQGNFKN-------PVGTFYLKEKSASSTHYLMS-EKVIRIESTKDGIKAFDEDDKLLGETSSTDEEPTILLEIENDLKKGTAELTKKDVSTGELLPNTGIR-------------------ILDEEKNTIAEGRTDDKGIYTFEK-------PAGKYYFQEYDAPTGYQLDDTP-----EITENGEVVKCEMTNNKIPEKI------------------------TSLPQTGDTTN--ITIFALGMLLSVSTLYFRRKKAKIE 873
39 -15.900IDP02440 hypothetical protein lmo0331 [Listeria monocytogenes EGD-e] lmo0331 [Listeria monocytogenes EGD-e]  ali follow..  18  136.LKSI--DVSKNLNLKELTCSNNPLANLD----EELTCENNELTQLDEYLYCPRNQLTKLDVSKNSALDVNQLTNL--DVSKNPALTNLGCTKNQLTDL--DVSQNPNLGTLVCSDNQLTNLD--VSQNQALENLACDNNELKNID----NQALSLKELSCENNQLTNLDLALEILYCDDNQLTDLDVRKNVNLLILFCNNNQLTNLAVGET................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 354
40 -15.600IDP05549 hypothetical protein lmo0549 [Listeria monocytogenes EGD-e] lmo0549 [Listeria monocytogenes EGD-e]  ali follow..  19  55.LKASPLTIPANSTIADLFPDEGMAKTIANQLGRTENNNFQTPTKTDWKVDDVVGSIEGIQLPNLYDVRCKDLSPFLKAPNGYSQLYRLNINNGNISDI-SPLTELSTLNDIDLGGNNISDFPKLPNKFPNLEEISLERNNISDVSPLAKFASTKIKIFNLDENHITDLS.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 251
41 -15.500IDP91566 gene: ECs1568; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB34991 [Escherichia coli O157:H7 str. Sakai]  ali follow..  16  1ML---PTSQLRP-----TGTFCSYSAETSADIKSEITPIQIEEARASGRLYIKDCDIEYLEITSVTIENCNNLTTLTGLPVNTQNLSVINCEKLQITDMPSTVKNLEGIECLTVCHCYISGVPESVRYLNGLSSLSINSYNPENQARIDNLISPSLKTLSLTGSNIILPEKLPESVTSVT................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 206
42 -15.200IDP05666 gene: inlA; internalin A [Listeria monocytogenes EGD-e] lmo0433 [Listeria monocytogenes EGD-e]  ali follow..  16  231.LESL-TPLGILTNLDELSLNGNQLKDIGTLASLTLDLANNQISNLATELKLGANQISNIGLTALTNLELNQLEDI-SPISNLKNLTYLTLYFNNISDISP-VSSLTKLQRLFFYNNKVSDVSS-LANLTNINWLSAGHNQISDLTP---ANLTRITQLGLNDQAWTNAPVNYKANNVTGALIAPATISDGGSYTEPDITWNLPSYTNEVSYTFSQPVTIGKGTTTFSGTVTQPLKAIFNVKFHVDGKETTKEVEAGNLLTEPAKPVKEGHTFVGWFDAQTGGTKWNFSTDKMPTNDINLYAQFSINSYTATF-------------DNDGVTTSQTVDYQGLLQEP---TAPTKEGYTFKGWYDAKTGKMPAKNITLYAQYSANSYTAT----DVDGKSTTQAVDYQGLLKEPKAPTKAGYTFKGWYDEKTDGKATDKMPANDITLYAQFTKNPNTPPTTNNGGNTTPPSANIPGSDTSNTSTGNSASTTSTMNAYDPYNSKEASLPTTGDSDNALYLL............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 780
43 -15.000IDP06539 gene: fms13; LPXTG family cell surface protein Fms13 [Enterococcus faecium DO] AFK58158 [Enterococcus faecium DO]  ali follow..  10  37...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KPSEVTITLH------KKGFSSVPEERPNSGLVSTDFGEENIPGFDLFDVTEVYYDLIRDNPLTPEREDGLNSAEAIEWIQKRHDKQTTNEAGEAVFSTVQVTEEAPSSRDKVYLFLETYSPAHISRIASPMVVMMPVMMPDMVDGVWDGSTWKDTYNTDVHL--------YPKNEIREADKQMNVEESDLRQVTIINEAGEQETISYIDLER--------GKTASYTITAPIPYFIDSVLENGSAVIKNYKITDTPTVG--TYYDQEIEVRYIVEVVSNGFVVTILTEENGVAKVDTLGRLADARGGDLTIT------YNLKVSTELEADDFHNNTAVIEIGRNDEF--------DYEEGVEPPEKVTTGGRKFEKYDASSSELLKDFELWNEDRSEYAIFYKGESPLAVYESGTSGQATEFVADGNGY--------EVQGLDYGTY-KETMAPEGYVLPTGE-------------AAFTEFIISYGSYNEEIQIVGVEN---PGPERVPNMKRGSLPATGGNGLLAFLLIGISLMIGAYSWYRKSKMKSE. 564
44 -14.900IDP91913 cell wall surface anchor family protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100006539 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  12  3.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................CPVFILFYYKIEV-----AGDGTATIVFKDGSAITIPGNQLVAQDPKAQDSTKPTAEKST----QRVDVKDITHLTDEEKV-ATINVAGDGTATITFPDGSVVTILGKDTVQQSAKGESVTQEATPEYKLETTPGGDKGGNTGSSDANANEG---NAIEKAAKNKQDEIKGAPLSDKEKAELLARVEAEKQAALKEIENAKTMEDVKEAETIGVQAIAMVTV--KRPVAPNAAPKTTSAPQATAGTMQDVTYQSPAGKQLPNTGSASSAALASLGLVVATSGFALLGRKTRRRK. 334
45 -14.500IDP05548 hypothetical protein lmo0409 [Listeria monocytogenes EGD-e] lmo0409 [Listeria monocytogenes EGD-e]  ali follow..  12  8.FKQI-TTIMTVVSLLIMVLGIQGNNDVKAAPQVAPPASINQIFPDADLAEGIRAELQKSSVTDVVSVYAKKIASI-EGLEYLTNLKFLNLNGNQITDLSP-LSNLTKLTEIYIGDNKISDISP-LQNLTNVTDLYLVDNDISDLRP---ANLTQMYSLRLGGNSNISDLNPVRNM-------TRLNNLEVTGSILKDLTP----------ADVTSLTRLTLSDNQIEDLSTKLDNIAAYSNKITDITPVTNLTRLQYLDLGSNEITDLSPVANLQKLTSLHLANNQITNISMLEDLTNLTSLGLQNNKISDISVLKN--THVTYLQLGYNQIVDVKIIGGLTNTSLQLTQNHITDISLANLTKIQYSDFSNQMITNLERNFSKTLSVPNNITSIDGTLIAPETISNNGTYDAPNLKWSLPNYLPEVKYTFSQKIPIGTGTSNYSGFITQPLKELLDYKVTFNVEGNTSEVETVTEENL-----PEPTSPTKQGYTFDGWYDAETGQMPANDLTLYAHFSVNSYQANF---DIDGVVTNEAVVYDTLLNEPTTPTKQGYTFDGWYDAETGGNKTMKMPANDVAFYAHFTINNYQANF---DIDGEVKNETIAYDTLLN-----EPTTPTKQGYTFDGWYDAETGEMPANDVTLYAHFTINNYQANF---DIDGAVTEEVVNYDALIPEPTSPSKTGFTFEGWYDAEVGGTKTMKMPANDITLYAHFSKETPIIPS---PDEGLDSDSTNGPITINEPSATSTPSQNNNITVTAGENTTELATAKLPKTGDNAPWKTLFAGILLSSS.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 812
46 -14.500IDP91521 C2 domain-containing protein [Toxoplasma gondii ME49] TGME49_040910 [Toxoplasma gondii ME49]  ali follow..  1283............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................AQRKARKQRRKAGHEGADNGAEDKQGAEGNEEEHGDAAAAAVAEESVSAEAVQGDEEPKKVVKKGAVPRVKKRSYDQVEGTEVAAIAIERDFFTEAEAPDFKNLMSDVEHAINTHLGLSPGRVRAFQARYAEKRIVFAVGPPMDDATEADAVSSVALMEKLRDILPSMAHEEGRFQEVTGGGATLQWDGPGTNILDRIAQEQATAGEGEQQTSEGIPTRDMQVDGTAVLEEAGEKSDKKKKKKEKKEKKEKKEKKEKKEKKEKKKKKGGET----------------AAEPEEASAVLAPPPVPVPAAAIPSVLLPADSEDGEKEQPKEKKKEKKEKKKKKDGETDAEPEEASAVLAPPPVPVPAAAIPSILLPTDGEDGEKEKTKEKKTEKKKEKHTEKKHKKKSEA------LPESETTAVVTVTPGEEDETSPLVPVPSSIASSEAPEPPASTRVTPAPEPKAKPGLSMGAALLAVRARSRLQRKHLAQQLSSSSSSEVSASSASSLSPSSSSSSDFAETRAKADALRARLQAAQARLAAARETEVSSSETESSETSEASFLSSDGEWDALWQSQRAAAMERQQRLQKMVSGVKAAYRRLEEENTRLAA--------TRRRDDKLQRQVEAERERAVELLKEATRRAKEEKDLIARQPPPARDWSDTVVLSTPQIFVNSQAACAPFADSGRDEGGRDEWYEVSDACSRRAESSNESRTTAGAKLRQQQLD----LAG.................... 1988
47 -14.400IDP05452 collagen adhesion protein, C-terminal [Bacillus anthracis str. Sterne] BAS5207 [Bacillus anthracis str. Sterne]  ali follow..  12  9...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LAYALAIINLSKYYDKNTSPIKFTITESQTTSTVTAKNSLTKGGIELTKVNAADE---------KETLEGAVFKIVNRDTNEDARTNLVTNSEGKLVVDDLRPNYKLIETKAP------------------------------------TYYDVNVEPIEFTIEKGQQTLLPLTFKNSLTAGAVFTLQDANGTEIAKDLKTDEHG----VLVIPDLAPGDYQFIETAAPEHYKLDQTPIKFTIERSQTKHVAVFKIVNKDGHDVRTDLTTDKNGRLGDYEFIETKAPTHYDLNETPIKFTVKKGQEKISVTATNSLTKGAVELSKVDDIDGSTLKDAVFKTTNKDGKISVSDLRPGDYQFVETKAPTHYDLNQTPINFTVEKSQTAEGAIFKIVDQNGNDVRTDLTTDKDGKIGDYQFVETKAPTHYDLNQTPINFT---QTATASVTATNSLTKGAVELTKVDDIDGATLEGAVFKIVDMNGNDVRTDLTTDKDYQFIETKAPKHYDLNQNPINFTVEKSQTAEGAIFKIVDSNGHDVRADLTTDKDGKIGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVSVTALNSLTTGSMELTKVDIDHNGTLEGAIEGLKTDGHGKLIVNDLKPGNYQLVETKAPE---YQLDASPISFTIEKAQASPLQITVSNKKVESSSGGDNKPITPPNKEEKPGK................................ 820
48 -14.200IDP92552 gene: NOD2; nucleotide-binding oligomerization domain-containing protein 2 [Homo sapiens] NP_071445 [Homo sapiens]  ali follow..  12  832.ICKLIECALHCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLAL-AEGLRGNTSLQFLGFWG-NRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSLALMLAKNVMLEELCLEENHLQDLAEGLKKNSSLKILKLSNNCITY--LQALERNDTILEVWLRGNTFSLEEVD........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 1029
49 -14.200IDP05371 conserved repeat domain protein [Bacillus anthracis str. Ames] BA_3601 [Bacillus anthracis str. Ames]  ali follow..  297...............................................................................................................................................................................................................................................................................................................................GWDITNVDASSSLVNNQTSATVRFVTNGDGYAAAGFGVQIDNPVKSVNRTVAGVGDTLTYTIT----------VPNTGTGSAENVVLRDSIPNGTTFVAGSVTVGGVTQPNANPATGINLGTTQRIVTFQVRITSFPNPNPIPNRAMVSYQFRPFVGSPLITSMSSSNTVQTTVNQATISMQKSVDLQTATLNDVLTYTVN----------VTNNGNVTANNVIFVDSIPAGTTFVANSVIVNGVARPGANPASSINLGSQTTVVRFQVRVTSNPLVNPIPNRASATFTFTPVPGQQPVSGQATSNTVVTTINIADIRTRKIVDRAFATVNDVLTY-------TVTIE---NTGNVLATNVVFQDPIPIGTTFITNSVTVDGVSQPGANPATGFTVANGSRTVTFQVRVTSTPSGGTIPNRGNVTANFVVIPNQPPITINRQTNTVVTQVNTGGLNVIKEVNTTQAVVGDTLTYTIA----------VQNTGNVPLTNVFFQDAISSAVSFVANSVTINGVPQSGLNPNTGFSLPNQTVVVTFDVLIIQDPENEDILNQANVTASFQVNPSEPPVTINVPSNIVNTTVQSGNFEVVKSVNTDVATVGDVLVY---------TIEIINAGSVPATNVFFQDSIPQGTLFIENSVFVNGVLQEGADPELGFPLNDASVIVTFEVLIDEIPLGNNVVNSANVTGDFLVNPTEPPITVTEPSNTVMTVVNSSGLNVIKSVSATEAGVGDTLTY-------TVRIQ---NSGTVAATNVSFLDPIPSGTTFVANSVIINGTPQPGLNPTTGFPLANGMVTVAFQVTITSVPPNRVLPNNANVTADFQVSPLQPPITIVTISNIVVTRVNVGSLNVMKSVNTLQAGVGDTLTY-------TILIQ---NTGTVPATNIIFQDPIPSGTAFVANSVTINGVVQQGADPMAGFPVPNQTATVTFQVTNPANPPITTVTNSNFVVTQVNTAQLNIQKTSSVQQAALGETYTYSVVI...................... 1290
50 -14.100IDP06525 gene: fms17; LPXTG family cell surface protein Fms17 [Enterococcus faecium DO] AFK58157 [Enterococcus faecium DO]  ali follow..  11  23.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................PHAMSAEESGEDVVEFVLMIRDIDYNDQFEYHENDGLAISEEAGET------ADIISQTVPLNGATFA----DMTDYYHEKKAAENMTPKEFVQQIAETNRNNIRQLITEERLVQIGTSVTTGKDTVGGLGDGYLIFEESIDPEVGLDVDIDQ-----TAIPIAAILPIYHPTENVGYLRDPYFFKYGRQRGTTEKGKPLEGFALYQMIEGGKYYLDMAPANPADNDPLNDKNVSKFISDKEGL-----TTGQRFLPSGTYYFEELKGVEGYEMDEASKRIEVIIPEFSGKVPVSAYESATPRVYNETVKETTDKPKEPSGPSNPGQSGKVFPQTNEAR-TLISLLGILLLLGAVLLIKKERGEKNE 437
51 -14.000IDP05461 conserved repeat domain protein [Bacillus anthracis str. Ames] BA_1618 [Bacillus anthracis str. Ames]  ali follow..  11 1026.................................................................................................................................................................................................................................................................................................................................VLTYLTNAGSVSADSPTFVDTNGTTFIPNTFLINGVLQNNADPNVGVPLPSGSLTVSYQVTVTSLPTQNPTINSSSTQYSFILNPGDPPTIETSLSNTVSTQINLANVVIVKQVDLTIADVGQPITYTIA----------LANPGNTPANNVVVTDILPPGTTLVPNSIFIGGALQLGADPSAGLQVGTGFTTIVFQIGANSLPSPNPVQNSAVLQYNFIADPNSPPVVRNSASNIVTTQINTANIVATKLTSTNFADVGDVITY-------ATILT---NNGNIPASNVTFTDIIPAGTIFLPNTVTINGVPIANANPANGILIANSSRTVAFQVFVPTIPSANPIANQSSTTFQYTYDPSKPAVMQMVASNTVQTTINNATITSVKSADKQFANVNDIITY-------TTTLT---NNGNTLASNIVFTDAIPSGTSFIPNSVTVNGTTLSNANPANGIAIDPANTIISFQVQVNSIPNPNPIPNQSNTTYQYVVNPNLPPASSNTLSNVITTQINNATIIATKSVNTPNAAIGDIVTY-------TIAVT---NTGNIPASATVLTDGLGPGASFIPNSVTINNVSQPGLDPSLGIHLDDGTTFITFQVKPPSGTLTNNALVNYEYTVNPTETPAVGSTVTNTTVTPIVDATLVINKNASTTFATIGD---TITF-------TSVVT---NTGNTTANNIVFTDSIPNGTTFVPNSFKINGVTVPNTNPQNSGNLNANASTLSFQVNITTLPNPNPIPNQSSLQYRFIVDINEPPVSRTVQSNKTFTQVNSASVIATKTASSAFAAVGDTITY-------TTTLT---NSGNTTANTPVFIDILPAELSFVPDSVQINTIPQLGFRPDTGVPLDSGTITISFQAIVGSIPATLNQSSTTYSIIVDPTQPPVTEIATSNPTLIQINEAIIQATKSVDRLFSDVAPGNSFLTYTVL-----------------LENIGNTTATNIIFTDPIPN................................. 1979
52 -13.800IDP05088 LPXTG-motif cell wall anchor domain protein [Bacillus anthracis str. Ames] BA_0871 [Bacillus anthracis str. Ames]  ali follow..  10  331......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................FKFNWPKWKKPAAKKGNLQIKKVDENNENIV----------KDAKFDVIDK--ENNVVDTVTTNEKGIAEVKDLPFDYFVKEISAP------------------------------------EGYIKIDAPVKVTIDNTNIIEVIKNTKKLENGQLKLLKKDSESGQ----------------------LLPGAKFD-------------------VIDKDGKVVETIVTDDKGEALSKQLP------VGSYTLKEVEAPKGYELSSSSVSVDVEANKVVTVNKKIPEKVTGQFEVVKVDAN--------------------DKTKLLSG--------------------AEFEVYKDGKKVAELKTGESGKVMSPK-------PLGEYTVKETKAPAGYKLSDKEWKVTIQNEKEVVKVEAENEKILGSLQIIKMDDKGNVVKEGITTDKSGTVGEYTLEETKAPEGYKALEVTIEVNVVANEVVKLNEKVKEEITGQLEITKVDANDINKKLAGAVFEIWKDGTKIDTLTSDENGYILKEVQAPEGYELSDKEIEFTISNQKFEVVKLQETEKPGEETEKPGEETEKPGEETEKPGEETEKPGEETEKPGEET---KPGEETEKPGGETEKPGKETEKPGEGMENPDKEKENPTLGQGTSHAQQLPATGHD--MNYLPFIGFALVLLGIRLRFMTKNN.. 969
53 -13.600IDP01796 cell wall surface anchor family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA5258 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  12  185..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................AVQTNAVSGSYTILPENAPKGLRIVNENGEEKSTLSINEKDTSSGNFKMKVKSTLTNLQAVQNTTVLLQRNSEKISTDLVVNWESVGSLKIMKLGEKKEVLKGAV---------------------FEVSNENFKQNVT-----------------------TSDKGI-----AELGNLPIGIYSVKEIQAPAGYVLDRSVKKIE---TGETAVLELKNENVKGELEITKVDVADGN---------------------TKLPNAEFT-------------------IYNEQGKEVVKGKTDEKGVAKFK--------PYGKYTYKETIAPNGYVINEETFAFEIKENGEIIKHIVQDKKVEGELEITKVDVADGN---------------------TKLPNAEFT-------------------IYNEQGKEVVKGKTNEQGIAKFK--------PYGKYTYKETIAPNGYVINEEKFG---EIKENGEIIKHIVKNKKEEKASFPSKPNKPTPNGEVKPQQPSTHNEVRLPATGGVSNQFTSLFVLGISFIIAGAYVLRMKNRKE 626
54 -13.200CPX_91689_91672 Complex of C4BPA_HUMAN with ARP4_STRPY [Undefined organism]  ali follow..  1............................................................................................................................................................................................................................................................................................................................................MHPPKTPSGALHRKRKMAAW--PFSRLWKVSDFQMTLIAALLPAVLGNCGPPP--------TLSFAAPMDITLTETRFKTGTTLKYT----PGYVRSHSTQTSDGEWVYNTF--VEIKTDLSFGSQIEFSCSEGFFLIGSTTSREVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAY-------GFSVTYSCDPRFSLLGHASISVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNY-------KDTIVFKCQKGFVLRGSSVIH---DADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTK---DVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQG--------PEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGT--------SPRTPSCGDICNFPPKIAHGHYKQSSSYSFF-------KEEIIYECDKGYILVKPELVNGRLSVDKDQYVEPENVSGYGVVGPQSSGNRTWYPEVPKCEWETPEGCEQVL------TGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSATLDKELXMARKD-KTGTASVAVAVAVLGAGFANQTEVKAAEIKKPQADS-AWNWPKEYNALLKENEELKVEREKYLSY--------------ADDKEKDPQYRALMGENQD---RKREGQYQDKIEELEKERKEKQERQEQLERQYQI------EADKHYQEQQKKHQQEQQQLEAEKQK---AKDKQISDASRQGLSRDLEASRAAKKELEAEHQ----------LKEEKQISDASRQGLSRDLEASR---AKKKVEADLAALTAEHQKLKEDKQISDASRQGLSRDLE---------REAKKKVEADLAEANSKLQALEK---NKELEEGKKLSEKEKAELQARLEAEAKALKEQLAKAEELAKLKGNQTPNAKVA--PQANRSRSAMTQQKRTLPSTGETANPFFTAAAAT-VMVSAGMLALKRKEE.. 983
55 -12.700IDP05456 putative wall-associated protein [Bacillus anthracis str. Ames] BA_1094 [Bacillus anthracis str. Ames]  ali follow..  11  896.....................................................................................................................................................................................................................................................................................................................IEYTKDKYGNTTTYEY-DGASRLSKVKNASGKELVLQYDGNNKKAA-ITFNYDGDLLVSSTTPEGKVYKYGYDNGVLTSIYDPQHTDAKPYKTSYAYENDRLVKVTDPLGKATTLAY---NTGSKEVTLTNPKGRKTVYTYNDAGNPVTTSYEYNANNLVKTTTPKNQTETATYDSVTDEMGTEKFEY-NKDNGIIKATDNEDRKTTVAYVQGANTSSVIHHDQYGNPIETSKELSAGGNLIQNPSFEMNGTEKWVKVDTNNSGSISKDATPAPGGLGGESSLKITTKATNNDWGYIAAIQEVTLEPNTT-DLVNGAAFFNVQSLNENGAGIDGGWHDTRHNKVQGTSDWVNRQVTFKTTEQTRKVKIYLQVENGGSATSGSAWFDKIQLEKGEVSSSDDSFTGHSSIVMERSEYGPNDIGYRNRVILNQKKAETVTLTAMSKSENVVNDAPDKLSKDYAVLAETYYQDGTVVNYYTSFPSGTNDWNRSAAVIPAKFRKNNKGKVWFDDIRLLEGNALIKNE--------Y---DNDGNVVATYDEEGQKNTFTYDASGNKKSET--DEKGNTKLDNLLTKVTLKNGTSVNYR------YDHNGNTTEKSVMFGGKTQTHKYEYDVDNKNTVYI--DENANKIKT-KMPNGSILESVYDTVGEKRNGKDSFTFERDQNGQVTKNGVERTKTYDKADR--VTSATDSRGGKIDHDKANSKTEKLKEQTVTQGGYTNKVSYDYNTLDQNIRVTDGSQTYRFDYDDNGSGSTFNY-DQANKIKDLVVGTSNSILLSERYEYDQ---SGNRTKIKHEGAGGKVT----ETNFVYDPNGTTKSYTY-DGFGNRTSVKVIENGKETKSIAATFNEGNLVKFGNESLTYDVNGNRTSDG-KYKYTWNENNAFATYKY-DEDNRRIEKNVNGQVTRDGDSINPLYETDGNGTVLRQYVYSADGAMKAQGQTLYYHYNPRGDVVAMTNQD.......................................................... 1992
56 -12.500IDP06529 gene: acm; collagen-binding MSCRAMM Acm (Fms8) [Enterococcus faecium DO] AFK59905 [Enterococcus faecium DO]  ali follow..  10  25.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................HVYADAGRDISSNVTSLTVDPTNITDGGNIKVKFSFDEKKQNI------QPGDYLW---------NWPSEGNIRGEGFQKEIPLMIENKNVGTLTVRKDSAQVVFNENIKNFEIQARNVTDTGEENTGPFTVTSGDKTATVNVTKPASGSSSSVFYYKTGDMLPEDTKHIRWFLN----------INNNGTYVEQPVKISDEIQSGQRLDPSTFEIN--VYRGEEGIQQFLQDFPSATFNFSVTDNYIEITIPKNFVNLRKIMVSYKTIIENPEQINFENHSEWFKEFNKPAVDGESFNHTVKNISASGGVNGTVRGELKIFKYINDTEIGIPNVTFE-------RRADEQPIQGQSSILLTSNEQGEASIKGLQ-DYVVKEKEAPNWIDFDPLSSNELKFSINENDTEGVSLPIYNKKKVTN----NWEPVPDAETKRLDNGITSVTWED------IQQYDDSGNEYT--------------FKVQEVDQNGNDYVPSGYQKI---ENGLVVTNENKEVISVSGQKTWEDNENQDGKRPTTITADGQPIQHKEVSEKDDWRYRFTNLPKYRDGQ--------EIIYTVTEDNVPEYSTTIDGYNIKNSYTP----------EKTNISIPGSHITPWKNFPEKT-EREKIRNLFSQKLQIFAHTGESSEQRSNYISKRAVPKQITNKSKSILPKTSSKKSSFAVIIGLLIVTICAGIFL---QKYKK 720
57 -11.800IDP91701 gene: SLIT3; slit homolog 3 protein precursor [Homo sapiens] NP_003053 [Homo sapiens]  ali follow..  17  12..VRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERL---------DLDRNNITRITMDFAGLKNLRVLHLEDNQVSVIERAFQDLKQLERLRLNKNKLQVLPELFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFR------ALRDLEILTLNNNNISRILVTSFNHMPKIRT................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 209
58 -11.600IDP05226 putative membrane associated lipoprotein [Listeria monocytogenes EGD-e] lmo0460 [Listeria monocytogenes EGD-e]  ali follow..  14  216.LMEVDLSGLDTSAVTTM---WDMFNSCRALEELDVSHFDTSSVTNMSYMFYDNRNLEVLDVSNLDTSSVTNMYAMFEDCTSLEELDVSHFDTSSVTDMYRVFNGCEKLKKLDVSNSSATAMVQMFRNCSALEKLDVSNFNTSLVTDAMFAGCTSLEALDVSNFDTSSV-TNMAAMFSDNEKVEKLDLSTFDTSSVTNMG............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 415
59 -11.200IDP05567 pepdidoglycan bound protein [Listeria monocytogenes EGD-e] lmo2576 [Listeria monocytogenes EGD-e]  ali follow..  12  906......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ATFDLYANDEKVDTQTTDKNGVIEFDDLV------YGDYTLKEVSAPEGYTLPTASTENIQVKLEQDEKVVQV-GATLAGAEFSLYDKSGAELQNGLTTDENGELGSYYLKETKAPEGYKLSEKTWEFSVESGQVDAEIQAENEKDLGEAVLTKVDSETNAKLSGAKFNLLNDSGEVIQTNLVSDENGEIRVQNLEPGDYAFQETEAPTNYDLATNTWPF--------TIVAGQTSATMVTAENNKTGKPDVDTGEVILVKQDSATGETLEG--------------AVFDLMTADGAIVASNLTTDANGEIGKYSFKETKAPEGYELATIAPNQPEKITITAENTKLAPIPDAGSVKIIKQDENGETLQTNLKTDEAGELGNYRIQETKAPDGYQLESTPWQFEIVANDTSQAVRLIKTDSETGAVFSLLDESGKVIQANLTTDENGEIGNYSLKETKAPDGYELAEQPWN---QIVKGQVDAVIIKAENSPIIANGAISFEGDETDKPESKTDTLATEVTKLPQTGDKTSFPRVILGGSAVLM--SLLYLRKKSS.. 1530
60 -11.200IDP06530 surface protein [Enterococcus faecium DO] AFK59398 [Enterococcus faecium DO]  ali follow..  10  1..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MTGFDENTGVALYDPAESALTFTTDTEG------SISVNGLIDGNYTLVETKAPDGYQLTNPQKETTFIVKNGKLQQTTGIIHGADEANLG-VNRENTTTDNTITVENVQNYGDFHFIKQDVNTQEKLADAEFSILRAKDPTVKLMKKIANLASGEYPYAWSDEVTGS-DWEEVKLISDSEGK-FSIEGLKQGAYCLQETKA-PEG------------YALPKNEAAYTEFTVDDDP--TTSDETTIDNQPKGILPSTGGMGIIVFILVG--TALVGGAVIYFKKRHQET 269
61 -11.200IDP91037 gene: sdrD; Ser-Asp rich fibrinogen-binding, bone sialoprotein-binding protein [Staphylococcus aureus subsp. aureus Mu3] SAHV_0560 [Staphylococcus aureus subsp. aureus Mu3]  ali follow..  15  571.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KIGNYVWEDT--NKNGVQELGEKGV--------GNVTVTVFDNNTNTKVGEAVTKEDGS----YLIPNLPNGDYRVEFSNLPKGYEVTPSKQGNN--------------LDSNGLSSVITVNGKDNLSADLGIYKPKYNLGDYVWED--TNKNGIQDQDEKGI--------SGVTVTLKDENGNVLKTVTTDAD---DNGNYKVEFTTPEGYTPTTVTSGSDIEKDSNGLTTTGVINGADNMTLYVWEDTNKDGKQDS----TEKGISGVTVTLKNENGEVLQTTKTDKDGKYENGTYKVEFETPSQVGSGTDEGIDSNGTSTTGVIKDKDNDTIDSGFYKPTYNLGDYVWE--DTNKNGVQDKDEKGI--------SGVTVTLKDENDKVLKTVTTDE----------------NGYQFTDLN---NGTYKVEFETPSGYTPTSVTSGNDTEKDSNGLTTTGVIKDADNMTLDSGFKTPKYSLGDYVWYDS--NKDGKQDSTEKGI--------KDVKVILLNEKGEVIGTTKTDE----------------NGYRFDNLD---SGKYK-----VIFEKPTGLTQTGTNTTEDDKDADGGEVDVTITDHDDFTL.................................... 1114
62 -10.800IDP92699 Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrE [Staphylococcus aureus subsp. aureus USA300_TCH1516] YP_001574462 [Staphylococcus aureus subsp. aureus USA300_TCH1516]  ali follow..  10  4............................................................................................................................................................................................................................................................................................................................RDNKKAITKKGMISNRLNKFSIRKYTVG-----TASILVGTTLIFGLGNQEAKAAENTSTENAKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSSSTQKQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKNNPEKLKELVRNDSNTDHSTKPVATAPTSVAPKRVNAKMRF---LIKVTKQTIKVGDGKDNVAAAHDGKDIEYDTEFTIDNKVKKGDTMTINYDKNVIPSDLTDKNDPID-ITDPSGEVIAKGTFDKATKQITYTFTDYVDKYEDIKSRLTLYSYIDKKTVPNETSLNLTFATAGKETSQNVTVDYQDPMVHGDSNIQSIFTKLDEDKQTIEQQIYVNPLKKSATN-QYEDVTSQFDNKKSFSNNVATLDFGDINSAYIIKVVSKYTPTSDGELDIAQGTSMRTT-EEKLYKIGDYVWEDVDKDGVQGTDSKEANVLVTLTYPDGTTKSVRTDANGH------------KDGETYTVKFETPTGYLPTKVNGTTDGEKDSNGSSVTVKINGKDDMSLYVWEDTNKDGIQDANEP------KDVKVTLKDSTGKVIGTTTTDASGKYKNGNYTVEFEYTPTVKNTTADDKDSNGLTTTGVIKDADNMTLDSGFKTPKYSLGDYV---YDSNKDGKQDSTEKGI--------KDVTVTLQNEKGEVIGT----TKTDENGKKYKVIFEKPAGLTQTVTNTTEDDKDADGGEVDVTITDHDDFTLDN-DSDSDSDSDSDSDSDSDSD------SDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDKPMSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGLLFGRRKKQNK 1154
63 -10.600IDP05200 pepdidoglycan bound protein [Listeria monocytogenes EGD-e] lmo2714 [Listeria monocytogenes EGD-e]  ali follow..  12  30..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ENGNNSTPTEEKTTDTTENIITEEKTEPAEPTKDTTVTPPQKSKVQTTIDITDSQEVYSYEQNSKIDLKDFTATLTDYTDTKLTNYRLAANSKLSTAQTGIQEVTLLGDNEDGKTTAVKLNYLVKEKTAQLTITDMNFDLETKIF------TGKTKPFASVYMSSPADENFGEGTTTADKDGYFYAESEEVTYQVPAKKQNEAVVTKNAVKSATTKPTDVTKVTKDDKTDLPSTGDKGTEWIFVVAGVIVILVAVLLL---RKRKK 315
64 -10.500IDP91950 beta-N-acetylhexosaminidase [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100006639 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  10 1001.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SKESLEALDAAKTALNYNLNRNKQAELDTLVANLKAALQGLKPAATHSGSENEVAANVETRPELITRTEEIPFEVIKKENPNLPAGQENIITAGVKGERTHYISVL-----------------TENGKTTETVLDSQVTKEVINQVVEVGAPVTHKGDESGLAPTTEVKPRLDIQKEEIPF-TTVTRENPLLLKGKTQVITKGVNGHRSNFYSVTSADGKEVKTLVNSVVAQEA--------------QIVEVGTMVTHVGDENGQAAIAEEKPKLEIPSQPAPSTAPAEESKALPQDPAPVVIEKKLPETGTHDSAGLVVAGLMATLAAYGL-----TKRKE 1311
65 -10.100IDP05012 cell wall surface anchor family protein [Bacillus anthracis str. Ames] BA_5070 [Bacillus anthracis str. Ames]  ali follow..  12  25.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................DTGTVTKEEATQLQQDKAKKEAAIKEQQKIEEEKKRIAQEQLKNDMAKKEE-----AQQKSEEGKKEAAQVQPKNAATKKEVAKPAVQGEKLPNTASNN---AMMALSACLVGIGTLFGLKRRNKVK 147
66 -10.100IDP91911 G5 domain family protein, partial [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100005012 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  13  245...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KSPTVTAVRKDEAGHKGVEITVDNHDGSQ----PTTVFVQDGAKGETGAIGQDGQ----TPTITTQRGQDGQSTVVTITTPGKDPVTFTVKDGKNGKDGRAPKIKVEDITSPSRIRRATDAAATPTRNGIRVTVYDDVNDNGVYDGGVDKVLNSKDIYNGIDGRDGSAPTITTKDNGDGTHTITVQNPDGSES-PDGSHTITVTNPDGSTKETVVKNGKDGKTPKVEVTDNNDGTHTVKVTDGDGNVTNAIIKDGKDGKAATATDGSHTVTITNPDGTKNEFVVKNGRDGVDGRTPTASVRDNGDGSHTIVITNPEGVTTETTVRDGKSPKVTIT-------DEQNGTHKISVLNGDGTTTETIIKDGKSPVA--TVRDNQDGTYTIRVENGNGTVSETTVRDGKSPTAKVVDNDGTHTITVVNSDGTTTTTTVRYGREPKLEVIDNNDGSHTIKVTGADGKETTTTIFDGKSPKANIV-DNGDGTHTLTIVDSDGREYKSIIKDGKDGKDGVSPTVTVENNNDGTHVVTITNPDGS-KDGKSPKVSVEDNGDGSHTITIINSDGTVTKTVIKDGKDGRDGRDGRDGKDGKCGCQDKPVTPSNDKPVPPAPNVPT----VPEQPVVPTPAQPATPVNANPVAPTTGKENRGDKLPETGSQSDYISVLLGGILLSLYVG-------RRKE 973
67 -10.000IDP93874 putative adhesin [Yersinia enterocolitica subsp. enterocolitica WA-314] EKA29148 [Yersinia enterocolitica subsp. enterocolitica WA-314]  ali follow..  13  645...........................................................................................................................................................................................................................................................................................................................TDKTKLEVLVTDALGHPVPHAISITNEHGIAENNFSSTVTGTANITVQVGTEAPVQAGAIEIKADNSTSKAVYKLKVTDKQGNVVPGAAVESSNIGSFVQGSSTTTDTNGETFIELVSTKAETAKYNAGKVVFV--IDSITLNAKILDANGNPIKNEEIESHKVTFSPATGKTQTNDLGETQITLTSTDVGDITLNAQVVKNNLLVNQASEKLSFTADTVTAAPSVKTLIADGQSQVIYKVVVKDKNGHVVANSPETNLGEFVPAQPTTTMTSTNSQGEATVVLASIKAGFATVKASVNGNKNTSPTQVEFTANRSTAKITLAPMTQRDFVANDKDKVT---------YSVTVVDANNNPVKAEAISENGHPVKIEPASSQTDEQGKATVNIGSVKAGKTQAIADAITFE--SSSVSYVTTVVDANGNPVGQITTTDINGQSSQTITGTQVGKVEVSVALTEGDNAKIKKENIGEAEFV--KQTATLRFTLRDANHNPVSGLASKQSVADHVNVGTISETTAKGVYQATITGMKEGAVDSKIQTLTLQ--TASITYTATVVDAKGNASLADVSVAWITSLGNIAVMTRTNASGKATVTLTSKQTGNATMDAAPVTFTAGGTTTKLTVKVNDINGNPLTGQGGKIKVTAANF-TAFTEVSTGVYSATITGTKAGDGELAKQKLKVI--GNKVTYQATLKDANDNLLGAGIPVHWSVNRDTLMSGKLISLTGVAEVEISRDLVGDALLQATAVKFI--LDIATIQVDIRDSKGNPLPNLANQPKSGEHGLKIETTANPSGDGYLVKMKGTKAGNHTPLSAKVDMVLKVDTVTYTAKVVDANNNLLENIAVSWRLAQGGGQYQGQSYT-TGVAETKLRASILGTYKKAAADVNST--STKAKLTATLKDKFGNLLIGQIVKLTDSNNLKGIKFTADPMDGTYSTEVSATAKGNTQNLTQQPQLLVGNIIPQLSFDNKNVARVFTRALQPKQLLKGLPKGVTVHWSSGNSDVAKV...................... 1999
68 -10.000IDP93937 adhesin [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001005042 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  13  645...........................................................................................................................................................................................................................................................................................................................TDKTKLEVQVTDALGHPVPYVTSITNEHGIAENNFSSTVTGTANITVQVGTSAPVQAGKIEIKAD--TSKAVYKLKVMDKQGNVVPGAAVDLSNIGTFVQGSTTTTDTNGETFIELVSTKAETAKYNAGKVVFVADTDSITLNAKILDANGNPIKNEEIEWDAASHKVTFSPATGKTLGETQITLTSTDVGDITLNAQVVKNNLLVNQAGEKLSFTADSAWSAPSVKTLIADGQAQVIYKVVVKDKNGHVVPNSPETNLGEFVPAQATTTMTSTDSQGEATVVLASIKAGSATVKASVNANKDTSPTQVEFTADSSTATIAITPVTKQVYVANGSEKVT---------YAVTVLDANNNPVKAEAINENGHPVKVEPAPSQTDGQGKATVSIGSVKAGDTQAIADAITFEADTGSISYVTTVVDANGNPVSPSTTTDINGQSSQTITGTQAGKVEISVALTSGNNATNPVKNSNNAEFV--KQTATLKFTLRDANHNPVSGLKQTQSVASHVTIGAVTETTVKGVYQAAITGMKENSVDRQTRTLTLQ--KESITYRAKVIDAQGNASLDNVSVGWRTTLGELAAITKTDTSGIATVTLTSKQAGSATMKAAPVNFT--VITTKLTVNIKDDNGNPLTGKGSEISVTATGL-TTFVEGPNGVYTATITGTKAGVGDLAKQQLKVI-VGDKVTYQATLKDANDNLLGAGIPVHWSVNRDTLMSGKLISLAGVAEVEISRDLAGDALLQATAVKFI--LDIATIQVDIRDSKGNPLPNLASSPKKGEHGLKIETIANPSGDGYLVKMKGTQAGNHTSAKVDMVLK--VDTVTYTAKVVDANNNLLENIAVSRLAQGEGQYQGQSYTGKTGVATTKLSASRLGTYKKAAAGVNST--NTKAKLTATLKDKFGNLLSGQKVKLTDSNSLKKITLSANPMDGTYSTEVTATAKGNTRDLTQQPQIVIGNIIPQLSFAKSKEATTYSRKVHKPLSLTGLPSSATLTAHWSSDNSDVA...................... 1999
69 -9.890CPX_91662_05666 Complex of CADH1_HUMAN with INLA_LISMO [Undefined organism]  ali follow..  18 1014QIADI-TPLANLTNLTGLTLFNNQITDIDPLKNLT---NLNRLELSSNTI----SDISALSLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDI-SVLAKLTNLESLIATNNQISDITP-LGILTNLDELSLNGNQLKDI---TLASLTNLTDLDLANNQISNLA----------SGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGHNQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANVSIPNTVK--NVTGALIAPATISD---GGSYTEPD-NLPSYT-VSYTFSQPVTIGKGTTTFSGTVTQPLKAIFNVKFHVDGKET------TKEVEAGNLLTEPAKPVEGHTFVGWFDAQTGKMPTNDINLYAQFSINSYTATF---DNDG------TTSQTVDYQGLLQEPTAPTKEGYTFKG----ATSKMPAKNITLYAQYSANSYTATF---DVDGK--STTQAVDYQGLLKEP---KAPTKAGYTFKGWYDEKT-----DGKKWDFATDKMPANDITLYAQFTKNPVAPPTTTPPTTNNGGNTTPPSANIPG---SDTSNTSTGNSASTTSTMNAYDPYNSKEASLPTTGDSDNAL................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 1660
70 -9.410IDP06516 von Willebrand factor, type A [Enterococcus faecium DO] EAN10603 [Enterococcus faecium DO]  ali follow..  225.................................................................................................................................................................................................................................................................................................................................IVFVLDKSAS--MSELTAGTNSQTKNAALIEAVNEM--------SKDLLSDPSLDIMVNFYHNSTAINNHEQISSDIFPLTNDINRLTGSENTALNRTP---IGGTPLTLYKDNGGENRNPEKILIVV---GDGTPTFSYAPIQSSYRTSTNGAWSNWTVMEDKIAEDNDVLFRNFEEFSGNTSNAGFTHPVTYASDFNRPEDEVNVHYRYGEVKEGDNKATHWVGDGSSNNNTN------GSPTSQEKSSAINTVAYHHWLKNKYQENPPSIFSIGLGIDGNVSGRQRLDAIGRNVLKNIADLEEDGVTPRYYNANNKNDIVTA--EDISSTFKRTIQQATLYDETGFNAGRSADIQFYHLDPGENGMKYQEPDEERHGQAPPEVVATPTTYVGRENQAYKF---GEGEMVRIKYQVKLDAGAQD----------GNFCTVNNMAYIQNLEDYENDITTGRMYFPSSSIRY--EHKGRNFQVSKKGQNGEPLAGVEDQNPESGEAEPIETSKTTTDGFWIREIAGPPRYQLVDETYQFQIKKYAANEDEMLGHYELVDEYTSGSRVGGPEGKDPNSYYEG--EYHKLSVVQEPNIEGTEYDELYVKLEMRNEFKPIHMNINKLIEGSNMINGAEFELYETDGNGLEIGYPVAKGLSGVNEVEEEKGRLTFYSVDEDGKYVIVDGEKVIHPIGEPDSFVYKDSEETTNYAEYKIIESQNPE---IQLKQTGEENWQYLTRLWVAFTAYNTFDYREIRVRKLDHEGHTLD-----------GAGFDIRKVGDSSFPLYRAYTGNPLEPEESKRLPGIGYFYSRAVGVEKYVDLNYDQPLH--------SIGEYEVSESVAPNGYRLSDQVFQFA-EIIDGVLQVTLEDELAPIDLELLKIDSNSRRLEGAEGLAPDPNDSSLFNASDLLEGVYRIKEVKS-PDS-YRKLPGYFILEISYREEPDIENDRVVPGKETNRIRLQLSVGNDPENPLPATGGSGRLFYILLAAFFMALAGAAYGLFVRQSKK 1341
71 -9.410IDP91904 endo-beta-N-acetylglucosaminidase, partial [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100000777 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  3...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................YFKSGGYMTANEWIWDKES---------------FYLKSDGKMAEKEWVYDSHSQAWYYFKSGGYMTANEWIWDKES--------------------------FYLKSDGKMAEKEWVYDSHSQAWYYFKSGGYMTANYLKSDGKMAEKEWVYDSHSQAWYYFKSGGYMTANFYLKSDGKMAEKEWVYDSHSQAWYYFKSGGYMTANYLKSDGKMAEKEWVYDSHSQA-------------YYFKSGGYMTANEWIWDKESWFYLKSDGKMAEK-YYFKSGGYMAKNETVDGYQLGSDGKWLGGKATNENAAYYQVVPVTANVYDSDGEKLSYISQGSVVWLDKDRKSDDKRLAITISGLSGYMKTEDLQALDASKDFIPYYESDGHRFYHYVAQNASIPVAFHLSDMEVGKKYYSADGLHFDGFKLEN---DLTEATNYSAEELDKVFSLLNINNSLLENKGATKEAEEHYHINALYLLAHSALESN----------------SKIAKDKNNFFGIAYDTTPYLSAKTFDDVDKGILGATK-----IKENYIDRGRTFLGNKAS------MNVEYASDPEKIASMKINEKLGGKD..................................................................................... 573
72 -9.060IDP05436 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo2085 [Listeria monocytogenes EGD-e]  ali follow..  11  13.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MVLLIIGSTSEKVQASPTSSN------WQLKWAIKNNDFEDVDITDYGQNAGTTNVWMVN---------------QAGVDAWGTTNPTGNIEVWQNGNGYNVPAFSGNNFIELNSDGIGPVYQDIRT------IPGSNLTWKFSHRGRTGVDTADLLIGSPESQTRVSNGETWGSFEGNYTVSTANGSLTSGNFLDDVQLYINVNGAKIGDVVWYDFNGDGIQQDSEEPAPGVKVDLLTK--DGTFKESATTNNIGSYLFTDVL--------PGDYQVKFSLPNNDFIFSKANQGNDKSLNSKPDKTGIASVNVPNLKSENFDIDAGITTNGKVEIQKLSGDKALVYAIKDNSQSEVAKITTNQN--PPGNYTATEVTAPLGYQKNTTPKKFTITYGDTNPKLTFQNAEKTGSITIFKQDEANKKGLANAVFDVKSIDGTTLKKVTTNSKGYVITEVTAPPGYEKSANEIRVTIPFNPQKTINITFSDNKIMVPLKPTPTKGSTVVKVSTALPQTGDSSSSSTIFTGLLIVV............... 552
73 -9.050IDP93832 gene: tccC; putative insecticidal toxin complex protein [Yersinia enterocolitica W22703] CAI77380 [Yersinia enterocolitica W22703]  ali follow..  11  1.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MSKTSFDTLCEQTPTLVISDNRGLAIRALAYNRIHASDAPEELITRNRYNAVGQLIASRDARL----DSDNFRYQY------------PLGGAALRTDGVDNGT-------SMQLTDIEGRPVMSLDAKGT--------RSWVTYEPELGRPLAHQQQPEGGQKTVTD----------------------RFFYGENSAEHKAANINGQCIRHYDTAGLQQVDSL-SISGVALQQQRQLLTDTLGPVNWF------------GEEQSWASRLRRESFVTRCTTDVLGQLITQT--DAKGHTQRMAQLSGSWLTIKNGAEQVIVKSLDY---SAAGQKLREESGNXVVTEYRYEAETQRLIGIKTDPVGNILAIHNDAEATRFFRNQKIVPETTYRYQLTEATGRESDSNRAQNASLPALSSLTDGNQYVNYTDRAGNLLXIQHSGASQYSTNITISNISNHG-----------IQQQDGLTAADIRCQF------------DAAGNQQQLQPGQPLQWDARHQLQQVTTV-----------KRGAENTPNDDYEHYLY------------ASDGMRVV---XQXIQHTNXXRQXSXVXYXPGLELRTQHNDSELMEDIDNGQLRYSFDNQIGSSLLE-LDNNGDIISQEE--------GTALFAARNTIE-VRYSGKERDATGLY------FRY-YMP..................................................................... 633

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.