current user: public

If you have questions about the server, please let us know.

Query: IDP02003 glutathione-regulated potassium-efflux system ancillary protein KefG [Yersinia pestis CO92] YPO0190 [Yersinia pestis CO92], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst MMLQPPKVLLLYAHPESQDSVANRVLLQPVQQLEHVTVHDLYAHYPDFFIDIHHEQQLLRDHQVIVFQHPLYTYSCPALLKEWLDRVLARGFANGVGGHALTGKHWRSVITTGEQEGTYRIGGYNRYPMEDILRPFELTAAMCHMHWINPMIIYWARRQKPETLASHAQAYVQWLQSPLTRGLLast
1 -97.300IDP02003 glutathione-regulated potassium-efflux system ancillary protein KefG [Yersinia pestis CO92] YPO0190 [Yersinia pestis CO92]  ali  100  1MMLQPPKVLLLYAHPESQDSVANRVLLQPVQQLEHVTVHDLYAHYPDFFIDIHHEQQLLRDHQVIVFQHPLYTYSCPALLKEWLDRVLARGFANGVGGHALTGKHWRSVITTGEQEGTYRIGGYNRYPMEDILRPFELTAAMCHMHWINPMIIYWARRQKPETLASHAQAYVQWLQSPLTRGL 183
2 -89.700IDP01979 gene: yheR; glutathione-regulated potassium-efflux system ancillary protein KefG [Salmonella typhimurium LT2] STM3458 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  74  1.MSQPAKVLLLYAHPESQDSVANRVLLKPAIQHNNVTVHDLYARYPDFFIDTPYEQALLREHDVIVFQHPLYTYSCPALLKEWLDRVLSRGFASGPGGNQLVGKYWRSVITTGEPESAYRYDALNRYPMSDVLRPFELTAAMCRMHWMPPIIVYWARRQSPQTLASHAKAYGEWLANPVSA.. 180
3 -88.000IDP01886 gene: yabF; glutathione-regulated potassium-efflux system ancillary protein KefF [Salmonella typhimurium LT2] STM0085 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  38  2.......ILIIYAHPYPHHSHANKRMLEQAGTLENVEIRSLYHLYPDFNIDVAAEQEALSRASLIVWQHPMQWYSVPPLLKLWMDKVLTHGWAYGHGGTALHGKHLLWAVTTGGGENHFAIGSHPG--FDVLSQPLQATALYCGLKWLSPFAMHCTFICDDDTLQAQARQYKQRLLAWQEVN. 174
4 -76.500IDP00106 gene: mdaB; modulator of drug activity B NT01SF3707 [Shigella flexneri 2a str. 2457T]  ali follow..  14  1....MSNILIINGAKKFAHSQLNDTLTEVADGTLRDLGHDVRIVRADSDYNVKAEVQNFLWADVVIWQMPGWWMGAPWTVKKYIDDVFTEGHGTLYSGSLVQDKKYMLSLTWNAPMEAFTEKDQHGVGVDGVYLPFHKANQFLGMEPLPTFIANDVIKMPDVP--RYTEEYRKHLVEIFG... 193
5 -76.400IDP00129 gene: mdaB; NADPH-specific quinone oxidoreductase NT01ST3985 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  16  1....MSNILIINGAKKFAHSQLNDTLTEVADGLLRDLGHQVKIVRADSDYDIKEEVQNFVWADVVIWQMPGWWMGAPWTVKKYMDDVFTEGHGTLYAGGLVQGKKYMLSLTWNAPMEAFTEKDQHGVGVDGVYLPFHKANQFLGMDALPTFIANDVIKMPDVP--RYTAEYRKHLSEIFA... 193
6 -75.800IDP00511 gene: mdaB; putative modulator of drug activity YPO0670 [Yersinia pestis CO92]  ali follow..  18  1....MSNVLIINAMKEFAHSALNLTLTNVAADFLRESGHQVKITTVDQGYDIESEIENYLWADTIIYQMPAWWMGEPWILKKYIDEVFTDGHGRLYSGGLIQGKTYMLSVTWNAPREAFTDPEQHGVGVDGVYLPFHKANQFLGMKPLPTFMCNDV--IKQPDIEGDIARYRQHLAENVNS.. 194
7 -39.900IDP02263 hypothetical protein GBAA0966 [Bacillus anthracis str. `Ames Ancestor`] GBAA0966 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  12  1....MNKTLIINAHPKVDDTSS-ESYKELISNNETIEQINLYDDVVKVTERMSEILQQFKSANTYVIVLPLHNFNIPSKLKDYMDNIMIARETFKYTGLLKDGRRMLVIQASGGIYT----NDDWYTDVEYSHKYLKAMFNFLGIEDYQIVRAQGTAVLDPTELQNAYKEVEEAASRLANKYI 215
8 -38.400IDP04320 gene: acpD; acyl carrier protein phosphodiesterase [Yersinia pestis CO92] YPO2323 [Yersinia pestis CO92]  ali follow..  18  1....MSKVLVLKSSILATSSQSNQLADFFVEQGDQITVRDLAAQPIPVLDGSDELIAELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEGLVTGKRAIILTSRGGIHKDTPTDLVVPY--------LRLFLGFIGITDVEFVFAEGIA-YGPEVATKAQADAKTLLAQVVAA.. 201
9 -37.800IDP04035 azoreductase [Bacillus anthracis str. Sterne] BAS5262 [Bacillus anthracis str. Sterne]  ali follow..  14  1....MTKVLFVKANNRPAEQAVSVKLYEAFLANDTVVELDLYKEELPYVGVADKYLNQFLEADKVVFGFPLWNLTIPAVLHTYIDYLNRAGKTFKYTPGLIGDKKIALLNARGGVYSEGPAAE-----VEMAVKYVASMMGFFGATNMETVVIEGHN-QFPDKAEEIITAGLEEAAKVANK.. 207
10 -19.100IDP95068 azoreductase [Clostridium perfringens B str. ATCC 3626] AGH15624 [Clostridium perfringens B str. ATCC 3626]  ali follow..  13  1.....MKVLLVNGSPNKEGCALKEVSKTLEENGIDTEIFQVGNKPIGG--GVNEFVEKAKDADGFVFGSPVYYAAASGSITSFLDRA------FYSGGKHMAFKPGAVICSARRAGTT---------STLDQLSKYLTICNMPVVSSQYWNMVHGNTPEKVKKDLEGMQTMRVLGRNMAW... 178
11 -17.600IDP00950 gene: wraB; TrpR binding protein WrbA STM1119 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  16  1....MAKILVLYYSMYGHIETMAHAVAEGAKKVDGAEVI-FAKAGGKTQNAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQT-----GGLWASGSLYGKLGSVFSSTGT..................................................................... 116
12 -11.700IDP90863 gene: hemG; protoporphyrinogen oxidase [Yersinia pestis CO92] YPO3761 [Yersinia pestis CO92]  ali follow..  10  1.....MKILILYSSRDGQTKTIASYIAKQLTEAATCEIQDLSQV----------GQIDLSQYQQVIIGASVRYGHFSPVLNKFVNK----------HVAQLSQMPSAFFAVNLTARKPEKRSPQTNTYVRKFLLVFAGALRYPRYSWIDRIMIQLIMRMTGGETDQEVSRFTQDFLALQYK.. 176

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35