current user: public

If you have questions about the server, please let us know.

Query: IDP02013 gene: pgtE; outer membrane protease [Salmonella typhimurium LT2] STM2395 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310
# Score Template Links and tools%idFirst MKKHAIAVMMIAVFSESVYAESALFIPDVSPDSVTTSLSVGVLNGKSRELVYDTDTGRKLSQLDWKIKNVATLQGDLSWEPYSFMTLDARGWTSLASGSGHMVDHDWMSSEQPGWTDRSIHPDTSVNYANEYDLNVKGWLLQGDNYKAGVTAGYQETRFSWTARGGSYIYDNGRYIGNFPHGVRGIGYSQRFEMPYIGLAGDYRINDFECNVLFKYSDWVNAHDNDEHYMRKLTFREKTENSRYYGASIDAGYYITSNAKIFAEFAYSKYEEGKGGTQIIDKTSGDTAYFGGDAAGIANNNYTVTAGLQYRFLast
1 -127.000IDP02013 gene: pgtE; outer membrane protease [Salmonella typhimurium LT2] STM2395 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali  100  1MKKHAIAVMMIAVFSESVYAESALFIPDVSPDSVTTSLSVGVLNGKSRELVYDTDTGRKLSQLDWKIKNVATLQGDLSWEPYSFMTLDARGWTSLASGSGHMVDHDWMSSEQPGWTDRSIHPDTSVNYANEYDLNVKGWLLQGDNYKAGVTAGYQETRFSWTARGGSYIYDNGRYIGNFPHGVRGIGYSQRFEMPYIGLAGDYRINDFECNVLFKYSDWVNAHDNDEHYMRKLTFREKTENSRYYGASIDAGYYITSNAKIFAEFAYSKYEEGKGGTQIIDKTSGDTAYFGGDAAGIANNNYTVTAGLQYRF 312
2 -27.700IDP01854 gene: pagC; virulence membrane protein PAGC precursor [Salmonella typhimurium LT2] STM1246 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  1MKNIILSTLVITTSVLVVNVAQAD----------TNAFSVGYAQSKVQ-----------------DFKNIRGVNVKYRYEDDSPVSFISSLSYLYGDRQASGSVEP------------EGIHYHDKFEVKYGSLMVGPAYRLSDNFSLYALAGVGTVKATFKEHSTQD--------------------------------------------------------------GDSFSNKISSRKTGFAWGAGVQMNPLENIVVDVGYEGSNIS--------------------------STKINGFNVGVGYRF 185
3 -25.500IDP00165 gene: acfA; accessory colonization factor AcfA VC0844 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  11  1MQKTLSAIFLFTTLSANA--------------APYIGLELGIGTANHSFETNYQSDAVSLN-----NMEDMFLGGLIGYKFNDNFSFEINY---SSYKLEDQYSKFIGIESLNNQQYRKEHEWSSEIEAKQLALISVYSYPIHQQLKTNIKVGVTHTQYEAYSGKYEELELLLNDDIEIRKALLETGLKKNRFGALFSL--------------------------------------------------GLDYNLIPELSVGTELRYQFDKYNDVLS--------------------------ISLNSKYYF 215
4 -24.800IDP91023 hypothetical protein y2980 [Yersinia pestis KIM 10] y2980 [Yersinia pestis KIM10+]  ali follow..  13  1MNKHLVACAASLLLVAGSASAV----------SFNAETGRHYTNLGFGLGT----------------------------------------------------------------------------NTGGLAISGNWARSDHDGDVLGLGLGFNLPVGPMTATVGAKGI------------YMSPEDGSSGGAVAIGGGLSYPINKFSVYGEGYFAPEELTSGMKSY----------------SEANGGVRWNVFRPLTVDVGYRYINMEGKEGRRDNRLAD-------------------GVYIGAGLNF 180
5 -23.700IDP90997 gene: ompX; outer membrane protein X [Yersinia pestis KIM 10] y1682 [Yersinia pestis KIM10+]  ali follow..  12  3MKKIACLSAVAACVLAVTAGSAFAG---------QSTVSGGYAQSDYQGV----------------ANKSSGFNLKYRYEWSDSQLGYITSFTHTEKSG--------------------FGDEAVYNKAQYNAITGGPAYRINDWASIYGLVGVGHGRFTQNESAFVG-------------------------------------------------------------------DKHSTSDYGFTYGAGLQFNPAENVALDVSYEQSRIR--------------------------NVDVGTWVAGVGYTF 176
6 -18.100IDP01391 outer membrane protein OmpU VC0633 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  10MNKTLIALAVSAAAVATGAYADGINQSG------DKAGSTVYSAKGTSLEVGGKAQDNSRVRLNFLGKAEINDSLYGVGFYEGEFTTNDQTYAGIGGTYGEVT-TDIMSYHGNTAAEKIAVADRVDNMLAYLGVKASYRFADRNAVDAMGNVVTETNAAKYSDNGEDGYSLSAIYTFGDTGFNVGAGYADQDDQNEYMLAASYRMENLYFAGLFTDGELAKDVDYTGYELAAGYNAETAKETSADNFAIDATYYFKPNFRSYISYQFNLLDS--------------------DKVGKVASEDELAIGLRYDF 350
7 -17.300IDP06043 hypothetical protein jhp0370 [Helicobacter pylori J99] NP_223089 [Helicobacter pylori J99]  ali follow..  3LKYWLVYLAFIIGLQATDYDNLEEENQQLDEKINNLKRQLTEKGVSPKEMDKDKFEEEYLERTYPKISSKKRKKLLKSFSIKSGVFLGGGYAYGELNLS---YQGEMLDRYGANAPSAFKNNININAPVSMISVKFGYQKYFVPYFGTRFYGDLLLGGGALKENALKQPVGSFFYVLGAMNTDLLFDMPLDFKGVYAGFGIGLML--------YQDKPNQNGRNLIVGGYSSPNFLWKSLIEVDYTFNVGVSLTLYRKHRLEIGTKLPISYLRMGVEEGAIYHNKENDERLLISANNQFKRSFLLVNYAFIF 313
8 -14.800IDP06040 hypothetical protein jhp0368 [Helicobacter pylori J99] NP_223087 [Helicobacter pylori J99]  ali follow..  10  4KKRAILWSLMGFCAGLSALDYDTLDPKYYKYIKYYKAYEDKEVEELIRDLKRANA--------------------------KSGLILGINTGFFYNHEIMVKTNSS-------------SITGNILNYLFAYGLRFGYQTFRPSFFARLVKPNIIGRRIYIQYYGGAPKKAGFGSVGFQSVM--------------LNGDFLLDFPLPFVGKYLYMGGYMGLG------LGVVAHGVNYTAEWGMSFNAGLALTVLEKNRIEFEFKILNNFPF----------------LQSNSSKETWWGAIASIGYQYVF 240
9 -14.600IDP91024 outer membrane protein C2 [Yersinia pestis KIM 10] y2983 [Yersinia pestis KIM10+]  ali follow..  10  1MKRNILAILIPTLLV--ATTSHAAEIYNKDGNKLDLYGKVKALHYFSDNTKSDGDKSY--VHL----------GFKGVTQITDELSGYGQWEYNFAANYAESQEAKFAGLRYGNLGVATYRNTDFFGLVDGLKFSLQYQGKNGAEGE-GFGLSSSYEIGAGVSVGAAYASSNRTLAQKNSTFGKGDKADA------WTTGLKYSDNGVYLAANYAET---MTPISGTAVINNVSTSVSGFANKTQNIELVAQYLFDFGLKPSIAYIQSKGKDIEGNKNMSTYVDYKINQLNDDNKLKLNTDNVVALGLVYQF 371
10 -14.500IDP01900 gene: apeE; outer membrane esterase [Salmonella typhimurium LT2] STM0570 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  425................................QVLLGGLIAGSLDKQHPDDNYRYDARGFQ-----------AAVFSHLRAGQ-AWLDSDLHFL--------AKFSNIQRSITLGALRRVEEGETNGRLWGARLTSGYDFVMVPWLTTGPMLQYAWDYSHVNGYS------------EKLNTSTSMRFGDQ-----AGWRLDLRHSIIHSWAQIN---YRRQFGDDTYVANGGLKSTALTDKNWVDIAIGADFPLSATVSAFAGLSQT--------------------------GLSDGNQTRYNVGFSARF 656
11 -14.000IDP91022 gene: ompC; outer membrane porin protein C [Yersinia pestis KIM 10] y2966 [Yersinia pestis KIM10+]  ali follow..  10  4MKLRVLSFIIPALLV--AGSASAAEIYNKDGNKLDLYGKIDGLHYFSDNKNLDGDQSY--MRF----------GLKGETQITDQLTGYGQWEYQVNLNKAENEDGNFAGGKNGSSSETNNGRGVADQNGDGYGMSLSYDLGWGVSASAA-TGGLKYDANNVYLAANYTQTYNLTRFGDFSNRSSDAAFGFADKAHNIEVVAQYQFDFGLRPSV------------AYLQSKGKDIGIYGDQDLLKYVDIGATYFFNKNMSTYVDYKINLLDKNDFT-----------------KNARINTDDIVAVGMVYQF 374
12 -13.800IDP04214 gene: ompN; outer membrane protein N precursor [Salmonella typhimurium LT2] STM1473_1_377 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  1MKRKVLALVIPALLAAGAAHAAEIYNKDGNKLDLYGKVDGLHYFSDDS----SKDGDQTYMRV----------GFKGETQINDQLTGYGQWEYNVQANTTEGEGANSWTRLAFAGLKFGDYGSFDYGRNYGANGVATYRNTDFFGLVDGLNFALQYQGANENQVSHEQEGTNNGGDRNVKNAGISSTYDLG-KADAWTVGAKYDANNIYLATMYSETRNMTPYGNDDCRSCVANKTQNFEVTAQYQFDVGATYYFNKNFSTYVDYKINLLDDDDQFYKDAGISTDDI----------------VALGMVYQF 377
13 -13.200IDP90313 gene: ompB; Outer Membrane Protein Analog [Chlamydia trachomatis D/UW-3/CX] CT_713 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  9LRLTFLSFLGIASTSLDAMPAGNPAFPVIPGINIEFDLCNSYDVLSALSNLKLCFCGDYIFSEEAQVKDVPVVTSVTTAGVGPSPDITST-----KTRNFDLVNCNLNTNCVAVAFSLPDRSEVQSNYGFVWDVSLKKVIWKDGVSFVGVGADYRHASCPIDYIIANSQANPEVFIADSDGKCVGLTTYVNYVLPYLAFSIGSVSRQAPDDSFKKLEDRFTNLKFKVRKITSSH----------GNICIGATNYVADNFFYNVEGRW-------------------------------GSQRAVNVSGGFQF 340
14 -12.900IDP06042 hypothetical protein jhp0369 [Helicobacter pylori J99] NP_223088 [Helicobacter pylori J99]  ali follow..  7SKK-IRNLILCFGFILSLCAEENITKENMTETNTTEENTPKDAPILLEEKRAQTLELKEENEVA-EEIHKKKRQLYMLKGELHEKNESILFQQMAKNKSGFFIGVI-DIGINANPYEKFELLSNIQASPLLYGLRSGYQKYFANGISLRFYGEYLGGAMKGFKSDSLASYQTASLNIDLLMDKPIDKEKRFALGIFGGVGVGWNG-------------------------LKEIRGYSQPNAFGLVLNLGVSMTLNLKHRFELALKMPPLKETSQTFLYYF-----------------KSTNIYYISYNYLL 289
15 -12.800IDP01451 outer membrane protein OmpK VC2305 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  31MRKSLLALSLLAATSAPVLAADYSDGDIHKWMQFNLMGAFDELPGKSSHDYLE----EFGGRSGI----------------------------------FDL--VDVFNLATNKSSDKVGDPKIFMKFAPRMSLDTGVDMSFGPVQEVYVASLFEWD------------------------GTDFKTNAFSVNNQKIGLGSDVMVPWFGKVGLNLYGTYDGNRKDWNGFQISTNWFYFFENGSFISYQGYIDYQFGLK-RFAVGYGLKGYKDVYGIK---------------DTDGFKSTGFGHYVAVTYKF 296
16 -12.600IDP95175 capsular polysaccharide synthesis protein CpsB [Klebsiella pneumoniae 700603] EMR18996 [Klebsiella pneumoniae 700603]  ali follow..  137...................EFGIKKPIGTRFFNSELRYSYGAPEGRGKVEVALLRKQLRFRDLDSIKAASDDFDYYMHDQEWNENSLVAELFDQKAKTLRYRYSFITNQRRYELNPLKDSNE---------YYLLFGMKNRLSGKTEINGNVAWLYKDFIFNLHSSQRIKDPTDSGGYILVSNFGVGYEHHWLVDRFSTLVDYSYIT-----------------------EDYKHQSNKRKDQSNLLSLTFNYDFRPSINFKLKLQWNTMHSNKDTDTF----YIGPDYSHAVDRTLGYDDSAIIFMTQVQI 419
17 -11.700IDP90305 gene: ompA; Major Outer Membrane Protein [Chlamydia trachomatis D/UW-3/CX] CT_681 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  12  1MKKLLKSVLVFAALSSASSLQALPVGNPAEPSLMIDGI------------LWEGFGGDPCDPCA-TWCDAISMRVGYYGDFVFDRVLKTDVNKEFQMGAKPTTDTGNSAAPSTLTARENPAYGRHMQDAEMFTNAACMALNIWDRFDVFCTLGATSGYLKGNSASFNLVGLFGDNENQKTVKAESVPN-----------------------------------------MSFDQSVVELYTDTTFAWSVGARAALWECATLGASFQYAQSKPKVGKEFPLDLTAGTDAATGTKDASIDYHEWQASLALSYRL 281
18 -11.600IDP01498 long-chain fatty acid transport protein VCA0862 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  1MLYKSSLAVAISALIAGQVSAAGFQVAEHSASGLGRAFSGEAAVADNASVLARNPAA--MMLFETAQFSGALSIVDPEVNVDDLINDQWAWGLAMFTTYGVATDYP---------NEIYAGDLAGDTSLISVNLNPNIAYRVNPELSLGFGLDLVAAKAKLTRHTLALGWNIGALYELDEQNRIGFGYRSRVKLNFDDLSGFHQLNQWAVHYSYQQTDWSSFEELTATSSQCKNGTCFQKIQDNGRWSVGATYTLNTTWTLRAGLAFDEQAGKATDSDRFWYSAGLTYTLTPQQFESEAVAYISALQFNYRF 411
19 -11.600IDP01409 porin, putative VC0972 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  11  5FKRTLLGAAVAMASTGAFAASETGAIGVLSDFNVQAYGVAAISAFYQEDSNGYDYENE--SRIGFRASKDMFDNVNVFMQIESGYVGEDDTFLGLQGDWGKVR------YSNPGLGRVFDWGGDVAGHYDRKGDIARYDSPAFGGLTFNISAGRG------VGTKSSNHFGAAAHYNAADIVTFHVGYENNSNFKYDYKTKDTAGKDVDNTFLTDATAYIVGFELPLKYTEGASKTVKGQEGEQGQYSLIGQYWNGP-WGFKVGYAANLESEVNGVEQVKNGFVPYIRVGQHDAYDSADKKGFVRVGLEYGF 349
20 -10.900IDP91535 gene: ompA; major outer membrane protein, porin [Chlamydia muridarum Nigg] TC_0052 [Chlamydia muridarum str. Nigg]  ali follow..  10  1MKKLLKSVLAFAVLGSASSLHALPVGNPAEPSLMIISLRLGYYGDFVFDRVLKTDVNKQFEM-HMQDAEMFTNAAYMALNIWDRFDVFCTLGATSGYLKGNSAAFNLVADDIPNVSLSQAVVELYTDTAFAWSVGARAALWECGCATLGASFQYAQSKPKLNIKAGTVSATDTKDAS-----SLALSYRLNMFTPYIGVKASFDADTIRIAQPXLETSILXMTTWNDTLQIVSLQLNKMKSRKSCGLAIGTTIVDADKYAVTVETRL-------------------------------IDERAAHVNAQFRF 387
21 -10.800IDP01776 gene: ybfM; putative outer membrane protein [Salmonella typhimurium LT2] STM0687 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  1MRTLALAIAGITAMSGWIVVPQAQASGFFDDSTLTGGIYYWQRERDRKDVTDGDKYKTNLSHLDFQS----------------GLDIAAFTAIEMAENGDSGHPNEIAFSKKNKGYDEDYSGDKSGISLYKAAAKFKYG-------PVWARAGYIQPTGQTLLAPHWSFMPG--------------TYQ--------GAEAGASFDYGDAGALSFSYMWTNEYKAPWHTEMDKFYQADKKTNVDYLHSIGAKYDFKNDLVLEAAF............................................... 240
22 -10.600IDP00542 gene: fadL; long-chain fatty acid outer membrane transporter YPO2744 [Yersinia pestis CO92]  ali follow..  152................TANLNLSAAYRLNDNFSFGLGFDAVYADAKIVRHLGEAGGGLLPANILYEIDKENRYSFTYRSEVNIDFDGDYSNQLPVIFGGLGGKTVP---------------GSLTLNLPAVWEVSGYNKV--APQWAIHYSMAYT----TWSSFKELKATASNGD----VLFDKHEGFRDAYR--ALGTTYYYD-DNWTFRTGIAF---------DDSPIPAGNRSISIPDQDRFWLSAGTTYAFNKNASVDVGIAYMKGQNVSITEKTPAPSNTTY------EFNSKGSAMLYGVNFNYTF 423
23 -10.600IDP91534 major outer membrane protein precursor [Chlamydia trachomatis] CAA36299 [Chlamydia trachomatis]  ali follow..  1MKKLLKSVLVFAALSSASSLQALPVGNPAEPSLMIISMRMGYSTLSKLVERTNPAYGKHMQDAEMFTN-----AACMTLNIWDRFDVFCTLGATSGYLKGDGVNATKPAADIPNVQLNQSVVELYTDTTFAWSVGARAALWECGCATLGASFQYAQSKPKYVGKEFPLDLTAGTDAATGTKDSLSLSYRLNMFTPYIGVKVDITTLNPTIAGCGSVAGANTEGQISDTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETRL-------------------------------IDERAAHVNAQFRF 395
24 -10.200IDP93831 cellulose synthase subunit BcsC [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001008212 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  13  853.................GTCYKAGCEGDIRQRASGTSIAMGWQNDHWATDIGTTPMGFEVVDVVGGLAYSNSWNIGWTATASRR-----PLSSSLLAFAG-TRDVTWGGVRANG-YHYLTGQNVADNQRLRFMTGYYYKLINEDNRRFT--IGYQKDLSGYTLGQGGYYSPQKYLSLAIP-----VNYRQRTDNWSWELGGSVSLSHSATNDRARYPLQSLLNNSIKSISRNDLDYGDSSNGVGYTLRALIERRLSSHWTLGAGVDIQQ--------------------------AKDYTPSHALIYLRYSM 1140
25 -9.920IDP05034 conserved hypothetical protein [Bacillus anthracis str. Ames] BA_1274 [Bacillus anthracis str. Ames]  ali follow..  15  1MNKKTIFFLLTCLLLVASTTYIICNKREQVPPMLVWE---GQEYYVTNEPAKAEEVGQRLGEVTKKIET................................................................................................................................................................................................................................................... 66
26 -9.880IDP05010 putative lipoprotein [Bacillus anthracis str. Ames] BA_4934 [Bacillus anthracis str. Ames]  ali follow..  11  1MKKVLMLFVLLLTASILLIGCSTKK--EKAGMNLEKAQKVEIESLTDSSEKKVITDKKEIEKLF........................................................................................................................................................................................................................................................ 62
27 -9.440IDP05698 hypothetical protein lmo2186 [Listeria monocytogenes EGD-e] lmo2186 [Listeria monocytogenes EGD-e]  ali follow..  10  1MKKVLVFAAFIVLFSFSFLSTGLTAQAALKDGTYSVDYTV-IQGDSDSASMANDYFDKP-ATVTVNGGKST-------------VSLQVNHSKWITGLWVEGNAVSVTSKNASSDTRKVSFPVSTLSNPVNAKIKV................................................................................................................................................................................ 121
28 -9.300IDP05672 hypothetical protein lmo0778 [Listeria monocytogenes EGD-e] lmo0778 [Listeria monocytogenes EGD-e]  ali follow..  11  1MKKKWLLLILSVIVLCAIIFGIKWLLYRDNLVEMMQVDDTLYIV--SYEPAKQEDALEKIGEIEHRIRH................................................................................................................................................................................................................................................... 67
29 -9.030IDP04414 gene: sepA; SepA, extracellular serine protease of the IgA1 protease family, secreted by a C-terminal autotransporter domain [Shigella flexneri] CAC05786 [Shigella flexneri]  ali follow..  1136...........................ELDGVDLFTGALLTYTDSNASSHAFSGKNKSVGGGLSALFNSGAYFDLIGKYLHHDN---------QHTANFASLGTKDY------------------SSHSWYAGAEVGYRYHLTKESWVEPQIELVYGSVS-------------GKAFSWEDRGMALSMKDK----RTGVDVGRAFDDWKITARAGLGYQFDLLANGETVLQDASGEKRFEGDSRMLMTVGMNAEIKDNMRLGLELEK----SAFGKYN---------------------VDNAINANFRYVF 1364

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.