current user: public

If you have questions about the server, please let us know.

Query: IDP02154 D-alanyl-D-alanine carboxypeptidase family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA2526 [Bacillus anthracis str. `Ames Ancestor`], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240
# Score Template Links and tools%idFirst MRIKLVGIFTCMIVILGIFIVYTNQSIGKEPRKTNYETRENSINKEKNSTSNNIASSFASVQAVVNKEYGLPEDYKPEDLVVPNVPFSFSGTLEKSYLRKEAAEALERLFDLANKEGIQLNAVSGFRSYDYQKKLYANNVKRKGQEHTDRFSAKPGHSEHQTGLTMDVSSKSANNELELTFANTKEGKWLKENAHRAGFIIRYPKGKESITGYAYEPWHIRYVGDIAESIYKKKLTLEEYMNLLast
1 -106.000IDP02154 D-alanyl-D-alanine carboxypeptidase family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA2526 [Bacillus anthracis str. `Ames Ancestor`]  ali  100  1MRIKLVGIFTCMIVILGIFIVYTNQSIGKEPRKTNYETRENSINKEKNSTSNNIASSFASVQAVVNKEYGLPEDYKPEDLVVPNVPFSFSGTLEKSYLRKEAAEALERLFDLANKEGIQLNAVSGFRSYDYQKKLYANNVKRKGQEHTDRFSAKPGHSEHQTGLTMDVSSKSANNELELTFANTKEGKWLKENAHRAGFIIRYPKGKESITGYAYEPWHIRYVGDIAESIYKKKLTLEEYMNL 243
2 -95.300IDP02767 D-alanyl-D-alanine carboxypeptidase family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA4750 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  43  1MKKIIIISAATIVIGITSFAYFGSKSPLQNEARAVESQQHSNHQKEEIPAFPKVVTNPDSNLVLVNKHRKLPDGYTPEDLTRPNVPFTSPKDKEKTLLRKDAADALENMFEAAKKEGLELTAVSGYRSYKRQKSLHDTYVRRQGKAEADSVSAIPGTSEHQTGLAMDISSKSAKFQLEPIFGETAEGKWVAKHAHEFGFVIRYLEDKTETTEYSYEPWHLRYVGPYATYIYKHHLTLEEAMED 257
3 -88.700IDP91977 D-alanyl-D-alanine carboxypeptidase [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007810 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  31  1MKKRYVILSGLLALTLAACSQEKTKVEENTQKTEQSSQPEGTVGSKSQASSQKSIQGKYDEIILANKRYPLSKDYNPGENP-------------------TAKAELLKLIAAMQAEGYPISQYSGFRSYETQAKLYQDYVNQDGKEAADRYSARPGYSEHQTGLAFDLIGTDG-----DLVTEEKAAQWLLDHAADYGFVVRYLKGKEKETGYMAEEWHLRYVGKEAKEIAASGLSLEEYYGF 231
4 -84.500IDP91775 gene: vanXYE; VanXYE [Enterococcus faecalis] AAL27443 [Enterococcus faecalis]  ali follow..  30  3..........................................................KNYLRLINENNEIKDSERPSHLVQAPFAQ------TNILVDPMVAIQLEKLIKTTGLDS-QIITIDGYRSKETQQALWDETIQEKGLEFAHKYVAKPGCSEHEIGLAVDLGLATKENDIRPSFTDSPIVDKFLKHMTDFGFILRYQKGKESITNINYEPWHFRYVGPHSSIMVQQNWVLEEYIEF 182
5 -83.900IDP91778 gene: vanXYc; D,D-dipeptidase/D,D-carboxypeptidase VanXYc [Enterococcus gallinarum] AF132548_1 [Enterococcus gallinarum]  ali follow..  34  2...........................................................NTLQLINKNHPLKKNQEPPHLVLAPFSD------HDVYLQPEVAKQWERLVRATGLEK-DIRLVDGYRTEKEQRRLWEYSLKENGLAYTKQFVALPGCSEHQIGLAIDVGLKKQEDDICPHFRDSAAADLFMQQMMNYGFILRYPEDKQEITGISYEPWHFRYVGPHSQVITAQKWTLEEYHDY 181
6 -81.500IDP92726 gene: ddcY; metallo D,D carboxypeptidase [Enterococcus faecium] ADD91671 [Enterococcus faecium]  ali follow..  29  1MKRSYKTVAVILLIVL-------------------LTSIGLFFRKTPQKIQVCGEERDSWNLLLVNAKHKIPQGYTVELQKLSN----------DQAVDKRIYPDLQLMLDAARAEGIYPKIVSSFRTTEDQEKIMEDKIAQKAKEEAAKWVAAPGTSEHELGLAVDINAES------SISTDKEVYEWLADNAYQYGFILRYPSNKVYITGVGYEPWHYRYVGKAAKKITEAGITLEEYLGK 218
7 -81.400IDP01682 D-alanyl-D-alanine carboxypeptidase family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA5104 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  30  1MKKWVFISF--FIACTICVGVYISPLFQKEIDVKIGGENGAVKNANIEKIEVTKEQIYKGDLLLVNKDYPVKKDSIRSDIINVNHNSEYVIFDRNLRLSKDVVKKFLNVVDAAGKDGVQFLMNSGYRDFKEQSKLYKEM--------GSDYALPAGYSEHNLGLSLDVGS------TQKKMEKAPEGKWIEENVWKHGFVLRYPKNKSHITGIQYEPWHIRYVGPHSAIMQKKKITLEEYLDF 233
8 -81.200IDP91044 gene: vanY; vanY [Enterococcus faecalis] EFA0002 [Enterococcus faecalis]  ali follow..  25  1MKKLFFLLLLLFLIYLGYLFSQEKVEFQNYDQNPKEHLENSGTSENTQEKTITEEQVYQGNLLLINSKYPVRQESVKSDIVNLELINGYGLLDSNIYMSKEIAQKFSEMVNDAVKGGVSFIINSGYRDFDEQSVLYQEM--------GAEYALPAGYSEHNSGLSLDVGSSL------TKMERAPEGKWIEENAWKYGFILRYPEDKTELTGIQYEPWHIRYVGPHSAIMKEKNFVLEEYMDY 241
9 -79.400IDP91871 gene: vanYB; D,D-carboxypeptidase [Enterococcus faecalis] AAB05624 [Enterococcus faecalis]  ali follow..  25  20SGEKRAFLWAFIISFTVCTLEATQLPPIPATHTGSGTGVAENPEENTLATAKEQGDEQEWSLILVNRQNPIPAQYDVELEQLSN----------GERIDIRISPYLQDLFDAARADGVYPIVASGYRTTEKQQEIMDEKVAEYAKAEAETWVAVPGTSEHQLGLAVDINADG------IHSTGNEVYRWLDENSYRFGFIRRYPPDKTEITGVSNEPWHYRYVGEAATKIYHQGLCLEEYLNT 266
10 -78.000IDP91774 gene: vanXYG; D,D-dipeptidase/D,D-carboxypeptidase [Enterococcus faecalis] AAQ16272 [Enterococcus faecalis]  ali follow..  29  3...............................................KTIELEKEEIYCGNLLLVNKNYPLRDNNVK-GLVPADIRF------PNILMKRDVANVLQLIF-EKISAGNSIVPVSGYRSLEEQTAIYDGSLKDNGEDFTRKYVALPNHSEHQTGLAIDLGLNKKDIDIRPDFPYDGICDEFRRAAPDYGFTQRYARDKEEITGISHEPWHFRYVGPHSKIMQENGFSLEEYTQF 192
11 -61.400IDP00223 putative carboxypeptidase YPO3054 [Yersinia pestis CO92]  ali follow..  23  3.......................................................................DNTLTPQMLTGLSTDHLVV-LSGAHRLQPQAAEAFQAMQQAAKVAGFDLQPASTFRDFGRQLAIWNGKFRAARCEAILRWSALPGTSRHHWGSDLDIYDPSRPWEYDAGGYFYPLTQWLSAHMAEFGFYRPFATDN---GGVAVEPWHLSYRPEQAEHLLTPKILLAAWQS. 201
12 -36.100IDP91776 gene: vanXD; D,D-dipeptidase VanXD [Enterococcus faecium] ACM47288 [Enterococcus faecium]  ali follow..  14  15..............................................................IRWDAKYATWDNFTGKPV--------DGYMVNRVMGTKELGVALRKAQKMAEKLGYGLLLWDGYRPQCAVNCFLNWASQPEDNLTKKRYYPNASQSSHSRGSAVDLTIFRLDTGMLVPMGGHHAASGLSEEESKNRQCLRYIMESSGFEAYRYEWWHYVLADEPPDTYFDFCIA....... 202
13 -23.100IDP91773 gene: vanXB; D,D-dipeptidase [Enterococcus faecalis] AAB05628 [Enterococcus faecalis]  ali follow..  14  15..............................................................VRWDAKYATWDNFTGKPVDGYEVNRII--------GTKAVALALREAQIHAARLGYGLLLWDGYRPKSAVDCFLRWAAQPEDNLTKEKYYPNASQSSHSRGSTIDLTDTGELVSMGSNFDFMDERSHIGNAEAQNRRCLRKIMESSGFQSYRFEWWHYKLIDE.................. 190
14 -20.600IDP91596 gene: vanXst; D-ala-D-ala dipeptidase [Streptomyces toyocaensis] AAD02118 [Streptomyces toyocaensis]  ali follow..  15  21..............................................................LRWDAKYATWDNFTGKPV--------DGYLVNRIVGTKALCAALERARDEAASLGFGLLLWDGYRPQRAVDCFLRWSQQPEDGRTKSRHYPNAARSGHSRGSTVDLTATNELVPMGGDHDLMDPVSHLAPVEARNRQHLRSVMESCGFKAYEYEWWHYTLADE.................. 196
15 -16.700IDP05627 hypothetical protein CD1406 [Clostridium difficile 630] CD1406 [Peptoclostridium difficile 630]  ali follow..  56....................TMQNKNNTTDDSKNNQSSTKKQEDNNIKPTFSYSSIPDNIKNKMIGKSMPTDEPISFDSLSYLKLTFDEKTHQGEMIVNSELAPEVVDIFKELYEKKYPIEKIKLIDDYDAVDEKSMS-DNNTSSFCYRTIAGTNVVSNHGKGRAIDINPLQNPQVSGNDVTPKVSTVYCYNAFVSRGWS-----------------WHFE...................... 267
16 -14.600IDP00233 putative phage-related protein YPO3676 [Yersinia pestis CO92]  ali follow..  14  1................................................................................MMNDKPTFRLSQISEHNLHHVHPDLVLIVRRALTLSHIDFRVIEGIRTPERQRQMVLN-------------HSKTMNSRHLTGHAVDLANNRIPWDDWHAFVHVAKAMKQAAKAMELPLQ-----------G----DWHFEL..................... 127
17 -12.300IDP90420 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_465 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  12  1MNLILLLTLCLSSLLSGCSTDNRQTSYIEAARITTQSSGSLILYPVIEPRSAPTYHWPTPKSPVITNHGTSGSLSTEETLV------GIKHLAKPFSIHPLLVTIAQYI-----HHHFPITIEEGYCCPMHYKFL-------LTSDTSI-------SEQHCKGLAAIVSTQQ....................................................................... 156

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 4 4 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.