current user: public

If you have questions about the server, please let us know.

Query: IDP02208 gene: ffh; signal recognition particle protein, Ffh [Francisella tularensis subsp. tularensis SCHU S4] FTT0964c [Francisella tularensis subsp. tularensis SCHU S4], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .
# Score Template Links and tools%idFirst MFTSLSEKLQSSFKKIKGQTSLTEENIQSALRDIRVSLLEADVALPVVKKFIANIKEKAIGEEVKKSLTPDQTFISFVKKEIEKALGEEAVPINLKTQPPAVILMAGLQGAGKTTSTAKLAKYLKEQHNKKVMVVSADVYRPAAIDQLRTLANSLNVEFFKSDASQQPEDIVTAAIKTAKTKLIDVLIIDTAGRLHIDNDMMDEIKQIHKIAKPIETFFTVDSMTGQDAAVTAKAFNDALELTGVILTKTDGDARGGAALSIREITGKPIKFLGVGEKTDALEPFHPDRVASKILGMGDVLSLIESIEQKTEKKSAEQLTKKLKSGKSFDLEDFKAQIQQMKKMGGVGSIMSKLPNMPANLPGDVGDDMFKKIEAMIDSMTPLERKKPELIKHSRKQRIIKGSGTTIQDLNKLLQQHTQIKKMMKSVIGKKGGMANLMKRMSAMQGMANMPGLFGKRKLast
1 -99.200IDP02208 gene: ffh; signal recognition particle protein, Ffh [Francisella tularensis subsp. tularensis SCHU S4] FTT0964c [Francisella tularensis subsp. tularensis SCHU S4]  ali  100  1MFTSLSEKLQSSFKKIKGQTSLTEENIQSALRDIRVSLLEADVALPVVKKFIANIKEKAIGEEVKKSLTPDQTFISFVKKEIEKALGEEAVPINLKTQPPAVILMAGLQGAGKTTSTAKLAKYLKEQHNKKVMVVSADVYRPAAIDQLRTLANSLNVEFFKSDASQQPEDIVTAAIKTAKTKLIDVLIIDTAGRLHIDNDMMDEIKQIHKIAKPIETFFTVDSMTGQDAAVTAKAFNDALELTGVILTKTDGDARGGAALSIREITGKPIKFLGVGEKTDALEPFHPDRVASKILGMGDVLSLIESIEQKTEKKSAEQLTKKLKSGKSFDLEDFKAQIQQMKKMGGVGSIMSKLPNMPANLPGDVGDDMFKKIEAMIDSMTPLERKKPELIKHSRKQRIIKGSGTTIQDLNKLLQQHTQIKKMMKSVIGKKGGMANLMKRMSAMQGMANMPGLFGKRK 458
2 -95.100IDP00741 gene: ffh; signal recognition particle protein SACOL1253 [Staphylococcus aureus subsp. aureus COL]  ali follow..  47  2AFEGLSERLQATMQKMRGKGKLTEADIKIMMREVRLALLEADVNFKVVKEFIKTVSERALGSDVMQSLTPGQQVIKIVQDELTQLMGGENTSINMSNKPPTVVMMVGLQGAGKTTTAGKLALLMRKKYNKKPMLVAADIYRPAAINQLQTVGKQIDIPVYSEGDQVKPQQIVTNALKHAKEEHLDFVIIDTAGRLHIDEALMNELKEVKDIAKPNEIMLVVDSMTGQDAVNVAESFDDQLDVTGVTLTKLDGDTRGGAALSIRSVTQKPIKFVGMSEKLDGLELFHPERMASRILGMGDVLSLIEKAQQDVDQEKAKDLEKKMRESS-FTLDDFLEQLDQVKNLGPLDDIMKMIPGMNKMKGLNMSEKQIDHIKAIIQSMTPAERNNPDTLNVSRKKRIAKGSGRSLQEVNRLMKQFNDMKKMMKQFTGGGKGKKGKRNQMQNMLKGMNLP....... 454
3 -94.900IDP02129 gene: ffh; signal recognition particle protein [Coxiella burnetii RSA 493] CBU_0450 [Coxiella burnetii RSA 493]  ali follow..  57  1MLNNLTNRLTTSINKLRGLGRLTEENIQSTLHDIRSALIEADVALPVVKDFIEHVREKALGQEVIGNVRPGEALVKVVQDELTHLLGDELVEINLNAQPPIVIVMAGLQGSGKTTTVAKLARWLLEIQKKSVMVASADVYRPAAIQQLETLASQINAIFFPTQADQKPVEIAKAALKQAEKQFMDVLILDTAGRLHIDNVLMEEMKAISDAVTPTEILLVVDSMMGQDAANVAKSFNDTLPLTGVILTKLDGDTRGGAALSMRMITQKPIKFVGVGEKIDALEPFHPNRMASRILGMGDIVSLVEEAQRKVDQKQAAKIAKKLQKGNRFDFDDFLAQLQQMKKMGGMQSLLGKLPGMGQLPKGFLDDKLLVKMQAIIQSMTLKERRFPALINGSRKRRISKGSGTGLQDVNKLLKQFVQMQKMMKRMKGDKM.......................... 435
4 -94.400IDP01220 gene: ffH; signal recognition particle protein BA_3983 [Bacillus anthracis str. Ames]  ali follow..  46  2AFEGLADRLQQTMQKIRGKGKVSEADVKEMMREVRLALLEADVNFKVVKDFVKRVSERAVGQDVMKSLTPGQQVIKVVQEELTELMGGEQSKIAIANKPPTVIMMVGLQGAGKTTTTGKLANLLRKKHNRKPMLVAADIYRPAAIKQLETLGKQLDMPVFSLGDQVSPVEIAKQAIAKAKEDHHDYVLIDTAGHLHIDEELMDELAKVKEVAKPDEIFLVVDAMTGQDAVNVAQSFHEQLGLTGVVLTKLDGDTRGGAALSIKAVTNTPIKFAGMGEKLDALEAFHPERMASRILGMGDVLTLIEKAQATVDEEKAKELEQKMRTLS-FTLDDFLEQLGQVRQLGPLDELLGMLPGANKIKGLQVDEKQIGHIEAIIRSMTKLEREQPEIINASRKKRIAKGSGTTVQEINRLIKQFDDMKKMMKTMTGMQKGKKKGLGGLK................ 445
5 -94.200IDP01385 signal recognition particle protein VC0560 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  59  1MFENLTDRLSKTLKNISGKGRLTEDNIKDTLREVRMALLEADVALPVVRDFVNRVKEGAVGVEVSKSLTPGQEFIKIVRQQLEAVMGESNEALNLAAQPPAVILMAGLQGAGKTTSVGKLSKLLKERDKKKVLVVSADVYRPAAIKQLETLANDLGVDFFPSTPDQKPIDIANAAIDHAKKKFYDVLIVDTAGRLAIDEQMMAEIQALHKAINPVETLFVVDAMTGQDAADTAKAFGDALPLTGVILTKVDGDARGGAALSVRHITGKPIKFIGVGEKTDALEPFHPDRIASRILGMGDVLSLIEDLQRNVDQEKAEKLAKKFKEKKGFDLEDFREQLGQMKNMGGMMGMLDKLPGMSQLPADKVDDRVFKQMEAIINSMTMKERQNPDLIKGSRKKRIAAGSGTQVQDVNRLLKQFTQMQKMMKKMQQGG--MKGMMRNMQGLMGGGGRGGFGGGFF 459
6 -70.200IDP06184 gene: ftsY; hypothetical protein jhp0700 [Helicobacter pylori J99] NP_223418 [Helicobacter pylori J99]  ali follow..  28  1....MFNFFKKIVNKIKGEEVKEKKRESVPKEELEEILIGFDIQYDLIESLLKHLGDLITPKQ----------LEVALLRFVRGESYYDKTRLKTITTKPLVHLIVGVNGAGKTTTIAKLAKLSLKQ-HKKALLGAGDTFRAAAVKQLQLWGEKLNVQVISAKEGSDPSSLAYNTIESAIAKNIDEVFIDTAGRLHNQTNLKNELSKIAHTCSPFYKFLILDGTQGSSGLTQAKIFHETLALDGVIMTKLDGTSKGGAILSVLYELKLPILYLGMGEKEDDLIAFDEERFIEDLVDAVFVEQ............................................................................................................................................................ 293
7 -66.800IDP01629 gene: ftsY; signal recognition particle-docking protein FtsY [Coxiella burnetii RSA 493] CBU_1903 [Coxiella burnetii RSA 493]  ali follow..  30  24WLGRLNESLKRTRSRLTDGLSGKKTIDASLLEELEMILLSADIGIEATQSILNNLSQQVARKSL----SDPKALIDALKIELLNILEPCQKHLEI-SASPFVILTVGVNGVGKTTTIAKLAHFYQSQ-KKRVMLAAGDTFRAAAIEQLQTWGQRNNAPVIAQQPGADSASVIYDAMEAATARHYDLLIADTAGRLHTQSHLMDELAKIKRVMKPHETLLVLDAGTGQNAINQAEQFHEHIGLTGIAITKLDGTAKGGVIFAIAKKMQLPIRFIGMGEKIEDLKPFNAKEFIAALFK.................................................................................................................................................................. 323
8 -66.600IDP01831 gene: ftsY; signal recognition particle-docking protein FtsY [Bacillus anthracis str. `Ames Ancestor`] GBAA3985 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  27  22FKQGLEKTRNSFADKVNDLVFRYRKVDEDFFEELEEILIGADVGVSTVMELIDQLKEEVQRRNI----QDPREVQAVISEKLIEIYKGDSDEVNMQKDGLTVVLFVGVNGVGKTTTIGKMAHKFKSE-GKSVLLAAGDTFRAGAIEQLEVWGDRVGVEVIKQGSGSDPAAVMYDAVQAAKARNVDVLLCDTAGRLQNKVNLMKELEKVKRVIEPHEVLLVIDATTGQNGLSQAKTFREATNVTGIVLTKLDGTAKGGIVLAIRNEMDVPVKFVGLGEQMDDLQQFDPEQYVYGLFA-----NLVETEE...................................................................................................................................................... 328
9 -64.700IDP01359 cell division protein FtsY VC0147 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  32  88FFARLKRSLSRTKANIGAGFFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLTARASRQQL----RDGEALYGLLKEEMAEILSQVEQPLVITEKKPYVILMVGVNGVGKTTTIGKLAKQFQAQ-GKKVMLAAGDTFRAAAVEQLQVWGERNQVPVIAQHTGADSASVIYDAIEAAKARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKPHEIMLTLDAGTGQNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEFIDALFSREE............................................................................................................................................................... 391
10 -57.500IDP00549 gene: ftsY; cell division protein YPO3814 [Yersinia pestis CO92]  ali follow..  31  239FFARLKRSLIKTKQNLGSGFM-GKKIDDDLFEELEEQLLIADVGVETTRKIITSLTEHTSRKQL----KDADALYGKLKEEMSEILSKVDKPLDVSGKSPYVILMVGVNGVGKTTTIGKLARQFQAE-GKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKARGIDVLLADTAGRLQNKAHLMEELKKIVRVMKPHEVMLTLDASTGQNAVSQAKLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEFIEALFARED............................................................................................................................................................... 541
11 -39.500IDP01664 gene: flhF; flagellar biosynthesis regulator FlhF [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0064c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  18  189.INKLNDKIDLLADMMWDAEARKNLMIPPEFASIYKQAKESGMLENHLEAIMKATIENMPAAMKTNKDAVQRYFHSLLRNIL-------PCRVESDIKKQKIMMLVGPTGVGKTTTLAKLAFRYAYGDKRKTGIITLDTYRIGAVEQLFQYAKMMKLPIIDSIEPKDLDEAI------KSLNNCEVILVDTIGNSQYDQSKLAKTKEFLMHSNEIDVNLVVSANTKHEDLMEIYKNFSFLNIDTLIITKFDETKVFGNIFSLVYETNIPLSFFSIGQEVDDLEVANSDFLVHCILE.................................................................................................................................................................. 475
12 -37.300IDP05133 gene: flhF; flagellar biosynthesis regulator FlhF [Clostridium difficile 630] CD0264 [Peptoclostridium difficile 630]  ali follow..  22  81......................FDNKNDNDIDKICKNLLSLELNEEIVESIRIDLQEM---------KFNGIDTSKNLVEILKKKIK------IENQVINGKIALVGPPGVGKTTTIAKLAAKLVFEENKKVGVITIDTYRIGAVEQLKIYTDIMNIPFKGVISPDEMELAL------DEMKDCDVVLIDTTGRGYKNSMQILEIKNLIDKAETDNIHLVLNCTTRESDTKAIIDSYRNVNFKSLIITKLDETITYGSIFNIMNYAQKPISYITTGQNVDDIIKPNEDKIIRLLLGVESI.............................................................................................................................................................. 338

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35