current user: public

If you have questions about the server, please let us know.

Query: IDP02246 gene: rnfB; Iron-sulfur cluster-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT0649c [Francisella tularensis subsp. tularensis SCHU S4], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst MIISIEAIDKVLPQIQCQKCTYPDCYSYAKAITNGEKHNKCITGGEKTLKELAKLLNKPEIPLDSSLGQEKPRAVAKIDESMCIGCEKCLLACPVDAIVGAKKLMHTIIEAECTGCELCVEPCPMDCISLVDLAADKQPNNLTNHAYTTQKNHYRDRYEYHKQRVSQTKAKQRDVYKNIATAQEIDKKAYIAASLAKFRNKKKSSPTNELast
1 -84.700IDP02246 gene: rnfB; Iron-sulfur cluster-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT0649c [Francisella tularensis subsp. tularensis SCHU S4]  ali  100  1MIISIEAIDKVLPQIQCQKCTYPDCYSYAKAITNGEKHNKCITGGEKTLKELAKLLNKPEIPLDSSLGQEKPRAVAKIDESMCIGCEKCLLACPVDAIVGAKKLMHTIIEAECTGCELCVEPCPMDCISLVDLAADKQPNNLTNHAYTTQKNHYRDRYEYHKQRVSQTKAKQRDVYKNIATAQEIDKKAYIAASLAKFRNKKKSSPTNE 209
2 -44.700IDP00452 electron transport complex protein RnfB YPO2245 [Yersinia pestis CO92]  ali follow..  50  34.DPVVEQVDAILPQSQCGQCGYPGCRPYAEAVSTGEKINKCAPGGEQVMLKLAELLAVEPQPLDDESAAHPQRKVAFIDEANCIGCTKCIQACPVDAIIGATRAMHTVLSDLCTGCDLCVAPCPTDCIEMIPVATTT........................................................................ 171
3 -30.200IDP06075 gene: nuoI; NADH dehydrogenase subunit I [Helicobacter pylori J99] NP_223907 [Helicobacter pylori J99]  ali follow..  16  23.............................KDTIKTSLGLDLFKGLGLTIKEFFSPSVTIHYPMEQLPLSPRYRAVHHLGSERCIGCGLCEKICTSNCIRIITHKSYTINLGRCIYCGLCAEVCPELAIVMGNRFENASTQRSQYGSKSEFLTSEQDAKNCSHAEFLGFGAVSPNYNERMQATPLDYVQEPSKEESKEESPTSPESHKGD 217
4 -29.400IDP90516 gene: oorD; 2-oxoglutarate-acceptor oxidoreductase subunit OorD [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0535 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  17  4....................................................................TAPKDTPVWVDEHRCKACNICVSYCPAGVLAMRDDMIEVVHPESCIGCTECEIHCPDFAIMVAKRDEFKFAKLTAEAKDRAVAVK........................................................ 95
5 -28.900IDP02723 gene: nuoI; NADH dehydrogenase subunit I [Francisella tularensis subsp. tularensis SCHU S4] FTT0039 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  18  5.............................TNFLKTFLLWELLKGLKVTGKHFFTRKVTVQYPDEKTPISNRFRGLHALGEERCIACKLCEVVCPALAITINSTESYEMDLFKCIFCGYCEESCPVDSIVETNILEYHFEERGENIMTKAKLLAIGDKYEAQIAADRLQDKDFR.................................... 162
6 -28.800IDP00453 putative iron-sulphur protein YPO2969 [Yersinia pestis CO92]  ali follow..  17  69..............TGCGVC-VAACEENLIVMVNQRPCSRCQACSTACQTGALSSAEFHIAARP---------SVKNICQNTYIYCDSCADYCEKQALIWQANQPPTLVTELCDGCGECVFRCPARILEM............................................................................... 187
7 -27.400IDP00512 electron transport complex protein RnfC YPO2244 [Yersinia pestis CO92]  ali follow..  17  291..PLIERVVTL-PGNFWARIGTPVLYLLKLAGFKPQNPPMVIMGGPLMGFTLPSLDVPIVKISNCILAPAETEMGLSEPEQSCIRCGLCVDACPAGLLGEEHEKARNHNLFDCIECGACAYVCPSN-IPLVQYYRQEKAEIRALDQESARAAEAKARFEAKQARLAREKLARELRHKQAAVKLTDADQQTVDAAVSRLTRQSDGSESV. 510
8 -26.200IDP91352 electron transport complex protein RnfC [Vibrio vulnificus CMCP6] VV1_3095 [Vibrio vulnificus CMCP6]  ali follow..  16  291..PMVNRVVTL-PRNVWVPLGTP-----VHALLEDKKLPRLIMGGPMMGFSLPHANVPITKTSNCILAPTRKEISPAGYEMECIRCGACAEACPASLLAEEFDKCEELNLKDCIECGACAFVCPSE-IPLVSYYRQAKAEIRTRAQEADAAERAKLRFEEKKARMEREKEERENRFKKAAEDRRKEMKSTGGDDAIAAAIARVKAQKTQ 512
9 -25.900IDP06055 ferredoxin [Helicobacter pylori J99] NP_222983 [Helicobacter pylori J99]  ali follow..  24  1..........................................................................MSLLVNDECIACDACREECPSEAIEEGDP-IYSIDPDRCTECPRCVSVCPVDAILPDPNNAESKEELKYKYEILKEQD......................................................... 84
10 -23.400IDP01812 ferredoxin [Francisella tularensis subsp. tularensis SCHU S4] FTT1764c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  33  6...............................................................................TESCIKCGDCVEVCPVDCFYEGPNML-VINPDECIDCALCEPECPVNAIKS............................................................................... 57
11 -23.300IDP91439 ferredoxin [Vibrio vulnificus CMCP6] VV1_0471 [Vibrio vulnificus CMCP6]  ali follow..  30  1..........................................................................MALLITDKCINCDMCDPECPNGAISMGDKIF-EIDPNLCTECKTCQSVCPITKCII............................................................................... 61
12 -21.900IDP01518 formate dehydrogenase, iron-sulfur subunit VC1512 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  1....MARMKFLCDTKRCIECN--GCVTACKN----------------------DDALEWGIQRRRVVTLNDGEPGENSISVACMHCTDCMAVCPADCFVHTEDGIVLHNKDLCIGCGYCLFACPFGAPQFPKQAAFGERGKMDKGGPETEPGSEEERRKYGANRIAEGKLPMCASLCSTKALLAGDAEKISDIFRQRVVERGAKGAGWT 190
13 -20.900IDP00543 gene: fdoH; formate dehydrogenase-O, iron-sulfur subunit YPO4057 [Yersinia pestis CO92]  ali follow..  21  91.....GKLEWLIRKDGCMHCADPGC------------LKACPSEG---------------------AIIQYANGIVDFQSEHCIGCGYCIAGCPFDVPRMNKDD----RVYKCTLC-ACVKTCPTGAIHFGTKESMKEVAAGRVAELKTR........................................................... 208
14 -20.700IDP00983 gene: phsB; thiosulfate reductase electron transport protein STM2064 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  17  1MNHLTNQYVMLHDEKRCIGCQ--ACTVACKV------------------NDVPEGFSRVQVQIRAPEQASNALTHFQFVRVSCQHCENCVSVCPTGASYRDENGIVQVDKSRCIGCDYCVAACPFHV.................................................................................. 110
15 -20.600IDP93838 nrfc protein [Yersinia enterocolitica subsp. palearctica Y11] YP_006003981 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  18  81.....PAVKYQFYRHSCQHCDKAPC------------VDVCPTGA---------------------SYRDKATGIVDVNPDLCVGCQYCIAACPYRVRFIHPVT----TADKCDFC-ACVLSCPTKALTFGNLDSPDCELVKLLHQRTVYRAKLHLGTQPKLYRVPFQYGEITG................................... 223
16 -20.300IDP01082 gene: nrfC; putative formate-dependent nitrite reductase STM4279 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  18  81.....PDVKYRFFRHSCQHCDHAPC------------VDVCPTGA---------------------SFRDAASGIVDVNPDLCVGCQYCIAACPYRVRFIHPVS----TADKCDFC-ACVESCPTKALTFGNLDDPNSDISRLLRQKTTYRYKLALGTKPKVYRVPFNYGEVSQ................................... 223
17 -20.100IDP04528 gene: napH; quinol dehydrogenase membrane component [Salmonella typhimurium LT2] STM2257_1_289 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  22  197...................CGH--CPMGALYGV---------------------------------LGSKGVVTVTAKKREKCNRCMDCFHVCPEPHVLRAEQSPAQVTHRDCMTCGRCVDVCSEDVFTI............................................................................... 277
18 -20.000IDP01006 putative anaerobic dimethylsulfoxide reductase STM2529 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  17  67.....NNVFAYTLSISCNHCADPVC------------TKNCPTTA---------------------MHKRPGDGIVRVDTDKCVGCGYCAWSCPYGAPQLNEQT----QMSKCDMC-VCVATCPLEAIKFGPIDELRAKYGSVCDVNGLPDSSITKPNLVVKAHQGAEKEGKRH................................... 208
19 -19.900IDP01308 iron-sulfur cluster-binding protein VC1516 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  413...........................................................................IECQTSDCTLCMSCVAVCPTRALHLAGDSPARFIEQDCVQCGLCVKACPEQVLSATPQLNWNKAARQGVVTLHQEEPAPQSMITMLQTKLRGHSHFATPEALNRIAMCEDCRVVDMFEAMAHDPEQQLK..... 552
20 -19.800IDP00930 putative hydrogenase protein STM0612 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  6...............................LVNSDKCIGCRGCAMACKSFNQLEPDRFWRYVYPLDKDIYPHEERAFYSLACNHCEHCVAACPVEAYTKREDGVVVHNPERCIGCKNCIRNCPYGAPRFNEETRKAEKCSMCYERLDIGMNPACVNACPVGALSIIDLDADPVPDNAVQYPPGFPHMPQLNPGTRFILARQPKQPEDK 185
21 -19.800IDP02074 gene: hybA; hydrogenase 2 protein HybA [Salmonella typhimurium LT2] STM3149 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  16  101.....EENGYAYIKKQCMHCVDPNC------------VSVCPVSA---------------------LKKDPKTGIVHYDKDVCTGCRYCMVACPYNVPKYDYNNPFGA-LHKCELC-GCVEVCPAGAVIFGTREEL----------------------MAEAKKRLALKPGSEYHYPRQTLKTDDTYLHTVPKYYPHLYGEKEGGGTQ. 260
22 -19.700IDP00961 gene: ttrB; tetrathionate reductase complex subunit B STM1385 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  20  95.....QEVTNVLLPRLCNHCDNPPC------------VPVCPVQA----------------------TFQREDGIVVVDNKRCVGCAYCVQACPYDARFINHET----TADKCTFC-ACVESCVGGARIIGDIKDPHSRIATMLHQHRDAIKVLKPENGTSPH.............................................. 224
23 -19.600IDP00878 putative anaerobic dimethylsulfoxide reductase subunit B STM4306 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  23  64..............IACNHCDEPVC------------VSGCPTGA---------------------MHKRKEDGLVVVDDSVCVGCRYCEMRCPYGAPQFDTQA----VMRKCDGC-ICVDSCPQRALDFGPVDELRAKYGTENQIAPLPSA......................................................... 174
24 -19.600IDP01930 gene: narY; nitrate reductase 2 beta subunit [Salmonella typhimurium LT2] STM1578 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  15  172.....ENTFMMYLPRLCEHCLNPSC------------VATCPSGA---------------------IYKREEDGIVLIDQDKCRGWRLCISGCPYKKIYFNWKS----KSEKCIFC-VCSETCVGRIRYL--------------VLLYDADRIEEAASTEHETDLYERQCDVFLNPHDPAVIEEALKQGIPQNVIDAAQRSPVYKMAMD 335
25 -18.100IDP92111 iron-sulfur subunit of succinate dehydrogenase, putative [Toxoplasma gondii ME49] TGME49_015280 [Toxoplasma gondii ME49]  ali follow..  14  78LIAIKDRQDPSLVEGICGSCAMNACLTPIKRGDRENEAMRLMPGQDIKHDPPVEILPLPHMMVLRDLVPDMTNFYAQYRSYECILCACCSTSCPSYWWEFTEERLAAINDTMCHGIMNCTVSCPKG-LNPAGAIQKMKDQVEARFSPAWKSLQAQQALEKSQKLAKD.......................................... 337
26 -18.100IDP01445 gene: sdhB; succinate dehydrogenase iron-sulfur subunit VC2088 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  18  35VLDALILLKEQDPSIACGSDG---------LNMNGKNGLACITPLSALKGDKIVIRPLPGLPVVRDLIVDMTQFYDNYAKYECIMCACCTTSCPSSRDTATDERLSNLDDARCHGIMNCVSVCPKGL.................................................................................. 218
27 -17.900IDP00470 putative iron-sulfur cluster-binding protein YPO0367 [Yersinia pestis CO92]  ali follow..  17  222...............................................................................EEQCGRCVACMTTCPTGAIVAP----YTVDARRCIGCDDCQLICPWN-SQLTDEDDFSPRAVLHTPQLLDLFAWNEEKFLRVTEGSAIRRIGHLRWLRNISVALGNAPYLDSIVLALETRRGLHPMLDEH 372
28 -17.900IDP00615 gene: sdhB; succinate dehydrogenase iron-sulfur subunit SACOL1160 [Staphylococcus aureus subsp. aureus COL]  ali follow..  16  52VIACLMEIRRNPVNIKCGACSM-SCSAIVDQLEQPIRLEPMN---DNLKRMKAWIPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEVCPNVTENNKFVGAQAISQVQCGNSQNCVNACPKGI.................................................................................. 242
29 -17.900IDP04683 iron-sulfur cluster-binding protein [Bacillus anthracis str. `Ames Ancestor`] GBAA3269 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  15  310.................................................................................KCIRCGACVNVCPVYRNIGGHAYGSV--PFASSLCGACTDVCPVK-IPLHDLLIEHRKDVVEQGFITKFEQLAFKGFTFMVSHPFVYEKAIKMAHTGLSIFAKDGYIANGPGPLKGWTESRD...... 450
30 -17.800IDP00546 gene: frdB; fumarate reductase iron-sulfur subunit YPO0359 [Yersinia pestis CO92]  ali follow..  24  147................................................................................SGCINCGLCYAACPQFG-HGKKERMPQLNGKNCTFVGYCSEVCPKH-VDPAAAIQQGKIDSAKDFMIAMLKPQ........................................................ 244
31 -17.700IDP01474 fumarate reductase iron-sulfur subunit VC2657 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  37VLDAIGYVKDHLDKD-CGSCG---------IMVNGVPKLACKSFLRDYPEGVK-IIGNDRKPEDGTNLQTPEQMARYKQFAGCINCGLCYAACPQFGLNPEFLGPAALTLAGCTFVGYCSEVCPKHVDPAAAVNQGKVESSLDFVIAMLNPDGSPKKVEA................................................. 252
32 -17.200IDP02194 gene: sdhB; succinate dehydrogenase iron-sulfur subunit [Francisella tularensis subsp. tularensis SCHU S4] FTT0075 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  17  37ALELIKEQDPTLAEGVCGSDGMNACITSVGELKQPIKVNPLPG---KNYEKVKPYLINDDEPPVKERLQSPEDRAKLDGLYECILCACCTTSCPSSRDTATEQRLEDLKDPRCRTIMNCVSVCPKGL.................................................................................. 215
33 -17.100IDP91392 hypothetical protein VV1_1289 [Vibrio vulnificus CMCP6] VV1_1289 [Vibrio vulnificus CMCP6]  ali follow..  17  186...............................................................................EEACGKCQACITSCPTQAIVDN----KVVDARRCIGCDDCQLVCPWN-ADLTQQGDFHRRSPLNNASLIALFQWDEPTFLKNMEGSAIRRIGHLQWLRNIAVAMGNAPFSPQIVTALESRKGMSELLDEH 336
34 -15.300IDP06171 gene: nuoG; NADH dehydrogenase subunit G [Helicobacter pylori J99] NP_223905 [Helicobacter pylori J99]  ali follow..  18  31..PTICYLSGCSPTVACKMC-IYSCNTKAKSIMQPLECGVCDKSGECELQDMTHLTGVEHQPYAVADDFKALDSWAKADPNLCIMCERCVTTCKENNLKATKADLHAVGSVPCYDCGECIAVCPVGALSYKDFAYTANAWELKKIHST--SAGCLISYDVRHFDTLGEESKIFRVLNDFYHNPICGAGRFAFDVSSSPKGSANLKEAQN 301
35 -15.100IDP02316 gene: nuoG; NADH dehydrogenase subunit G [Francisella tularensis subsp. tularensis SCHU S4] FTT0037 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  39..PRFCYHKKLSVAANCRMC-SPACATPVMDINHPLDCPICDQGGECELQDIAMGYGNTTSEYKRTVEDPELGPLVATDMTRCILCTRCVRFGEVKELGVMGRGDHSAEMVDSEISANIIDLCPVGALTSKPFRFKARSWELKQFPTL--ALATEINAHIYQNKLVRVVPRENDITGTWIADRDRYSQDRIQQPMIKKTGDWVDLSWEE 299
36 -14.600IDP02592 glycolate oxidase, iron-sulfur subunit, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA1308 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  29  23................................................................................LNCMRCGFCLPTCPTYIQSGYKESHSP-TLNVCLGCRACEPVCPSGV.................................................................................. 91
37 -10.900IDP90660 pyruvate ferredoxin/flavodoxin oxidoreductase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1476c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  18  681.......................................................................GVMVPRWIEANCIQCNQCASVCPHAVIRPKLSFKIQVSPLDCTGCELCVHECPTKEKSLVMVPLQEEMDFGEQENADYLFKEITYKDDILNKETTKGAQFAQPLFEFHGACPGCGETPYITLITRLFGERMIVANATG 846
38 -10.300IDP06284 ferredoxin [Streptococcus pneumoniae TIGR4] NP_346049 [Streptococcus pneumoniae TIGR4]  ali follow..  12  4............................................................................TLIPERCIACGLCQ-TYS--VRFYDDPDQLEKEISPSQDILEAVKNCPTRALIGNQ............................................................................. 66
39 -9.460IDP06013 LCCL-related multimodular protein CCp1C [Toxoplasma gondii] ACJ45039 [Toxoplasma gondii]  ali follow..  18 1455................CSEC----CNYNT-SLLPRSEWAQCEKKCRRNDPLASLLASGMITRLSTCLKELGDAAAHKKGNMACQACELC---CSLDQIGADLQDATEREQEECFQCAK--HFVPRENLEL............................................................................... 1569

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35