current user: public

If you have questions about the server, please let us know.

Query: IDP02345 5-formyltetrahydroformate cycloligase family protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1220 [Francisella tularensis subsp. tularensis SCHU S4], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst MDKNQIRRELLNIRDSLINKTYLSEQISSKLISYIQANFTNPKIGSFASLKNEIDTQTINNHFENIYLPIVHPFIKHGLWFARDSKKYYLNKYKIKEPVYCVKDVVTAWELDIIIVPMVGFTSDKFRMGMGGGFYDYNLSFKKIHKWPLTIGIAFDEQQNNAIIIDKHDIKLDLIITPTRILLast
1 -99.200IDP02345 5-formyltetrahydroformate cycloligase family protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1220 [Francisella tularensis subsp. tularensis SCHU S4]  ali  100  1MDKNQIRRELLNIRDSLINKTYLSEQISSKLISYIQANFTNPKIGSFASLKNEIDTQTINNHFENIYLPIVHPFIKHGLWFARDSKKYYLNKYKIKEPVYCVKDVVTAWELDIIIVPMVGFTSDKFRMGMGGGFYDYNLSFKKIHKWPLTIGIAFDEQQNNAIIIDKHDIKLDLIITPTRIL 182
2 -63.800IDP06183 hypothetical protein jhp0698 [Helicobacter pylori J99] NP_223416 [Helicobacter pylori J99]  ali follow..  21  1..........................MACKLL--FWKLKDYQNILLYSPLGHELDIRPLIQKNKRVWLPKSIKKGASKEGFTIAPFRLPLRRLGWFDEPSL--SRYYKRELDCIVVPILGMDTSFRRVGFGLGMYDRSLPQLFKKKRPLVIFVSRELALANGILTDAYDIEANLYMNARIVM 160
3 -8.490IDP04586 50S ribosomal protein L16 [Bacillus anthracis str. Sterne] BAS0117 [Bacillus anthracis str. Sterne]  ali follow..  11  1.................................................................MLMPKRVKYRREHRGKMRGRAEIAFGEFGLQAQAASWITNRQIEAARRAMT--YTAKPLEVRMGSGKGAPEGWVAVVKPGKIMFEIAGVSEEVAREALRLAAHKLPVKCKFVKRE.. 135
4 -6.870IDP93874 putative adhesin [Yersinia enterocolitica subsp. enterocolitica WA-314] EKA29148 [Yersinia enterocolitica subsp. enterocolitica WA-314]  ali follow..  14  82.ELWALNINLYNNRSAFDAVKYGAVVYVPNQEEEQRATQQASLVASHLSQVGNLSSENRVDAFSRLAKGMLLSSTAKTVEEW-------LGHIGQAQ-QTDDKNDFSGSEIDL-FIPLLAFSQFGFRIGLG-GFFDQQISGNAHRR----VGFGGELEDYDERAANGYDIRTEAYL...... 298
5 -6.840IDP93937 adhesin [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001005042 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  15  82.ELWALNINLYNNRSAFDAIKYGAVVYVPNQEEEQQAAQQASLVASHLSQVGNLSSENRVDAFSRLAKGILLSSTAKTVEEW-------LGHIGQAQ-QTDDKNDFSGSEIDL-FIPLLAFSQFGFRIGLG-GFFDQQVSGNAHRR----VGFGGELEDYDERAANGYDIRTEAYL...... 298
6 -6.640IDP93812 invasin [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001006768 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  10  60GTSLAVSGNASNITRS-----MVNDAANQEVKHWLNRFGTTQ-VNVNFDKKFSLKESSL-----DWLLPWYDSASYVFFSQIRNKDSRNTLNIGA----------------SWMYGFNTFYDGHNHRIGVGANGYFR-LNGWHQSR---------DFADYNERPASGGDIHVKAYL...... 222
7 -6.390IDP01898 invasin-like protein [Salmonella typhimurium LT2] STM1669 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  21..........IPLPVIADSDNEIQSWIAGTASSISPHLQEGTLEDYAKGKIKALPGQAANHLVNEGIKSAFPEIIFRGGVNLEDGAKYRSSEFDMFIPVQETTSSLLFGQLGF--------GRTYVNVGMG-GFLDADIRYSHLR-----GGIGGEVELHDERPAYGFDLRTKGTL...... 218
8 -5.730IDP04011 stage II sporulation protein R [Clostridium perfringens ATCC 13124] CPF_2475 [Clostridium perfringens ATCC 13124]  ali follow..  12  39ISEKLIRFHVLANSDS-DIDQDLKLRVKDEVLKYISPILN--------ESQSLEESREILKREDKNIIKIAEDYIKSQGFDYTVETTLTRENF-------------PVKEYGNIVLPQGEYEAYRILIGEGKGFIDVTKGQVAYDETEKKMKDVLSEEEFKSVNKKENNVNFEFKVID.... 206
9 -5.500IDP02263 hypothetical protein GBAA0966 [Bacillus anthracis str. `Ames Ancestor`] GBAA0966 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  10  3......KTLIINAHPKVDDTSSVSIKVFKHFLESYKELI---------SNNETIEQINLYDD-----VPMIDKTVLSAWEKQGNGQELTREEQKVTERMSEILQQFKSANTYVIVLPLHNFNIPSK-----KDYMDNIM----------IARETFKYTETGSVGLLKDGRRMLVIQASGGI. 150
10 -5.260IDP01854 gene: pagC; virulence membrane protein PAGC precursor [Salmonella typhimurium LT2] STM1246 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  1MKNIILSTLVITTSVLVVNVAQADTNAFSVGYAQSKVQDFKNIRGVNVKYRYEDDSPVSFISSLSYLYGDRQASGSVEPEGIHYHDKFEVKYGSL----MVGPAYRLSDNFSLYALAGVGTRKTGFAWGAGVQMYEGS-NISSTKINGFNVGVGYRF......................... 185

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.