current user: public

If you have questions about the server, please let us know.

Query: IDP02433 gene: aroE; shikimate 5-dehydrogenase [Coxiella burnetii RSA 493] CBU_0010 [Coxiella burnetii RSA 493], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst MDKYAVIGNPVEHSLSPVIFQAFEKQTNHSFDYLKIKAPVNGFAAAVKKFHDEGGKGANITLPFKEEAYQLADKRSQEANEAHVASALQFREDGTIYAVNYDGLGLVQDLTRNHNITLTQKSILIVGAGGATRGILGPLLNAAPEKIVIVNRTPSKAHALAKIFHLRGEIQGGGFDELEPMRYDVIIHATSLGHQGKFPPLPDGLIGSQSCCYDLSYGKIASPFLQWAKDQGAKYNFDGLGMLVEHNAAVFYLWFGIYPDTNPVIEMLQAHLLast
1 -107.000IDP02433 gene: aroE; shikimate 5-dehydrogenase [Coxiella burnetii RSA 493] CBU_0010 [Coxiella burnetii RSA 493]  ali  100  1MDKYAVIGNPVEHSLSPVIFQAFEKQTNHSFDYLKIKAPVNGFAAAVKKFHDEGGKGANITLPFKEEAYQLADKRSQEANEAHVASALQFREDGTIYAVNYDGLGLVQDLTRNHNITLTQKSILIVGAGGATRGILGPLLNAAPEKIVIVNRTPSKAHALAKIFHLRGEIQGGGFDELEPMRYDVIIHATSLGHQGKFPPLPDGLIGSQSCCYDLSYGKIASPFLQWAKDQGAKYNFDGLGMLVEHNAAVFYLWFGIYPDTNPVIEMLQAHL 272
2 -102.000IDP91167 gene: aroE; shikimate 5-dehydrogenase STM3401 [Salmonella enterica subsp. enterica serovar Typhimurium]  ali follow..  45  1METYAVFGNPIAHSKSPFIHQQFAQQLDIVHPYGRVLAPINNFINTLDAFFAAGGKGANITVPFKEEAFARSDELTERASLAGAVNTLKRLEDGRLLGDNTDGIGLLGDLER-LNFIRPGLRILLIGAGGASRGVLLPLLSLDC-AVTITNRTASRAEALAKIFAHTGSVHATDMDKLDGCEFDLIINATSSGIRGEIPAIPASLIHPSLCCYDMFYQKGNTPFLSWCVQQGAKRYADGLGMLVGQAAHAVLLWHGVLPQVEPVIEQLQQEL 270
3 -100.000IDP90792 gene: aroE; shikimate 5-dehydrogenase [Vibrio cholerae O1 biovar eltor str. N16961] VC0056 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  43  5IDQYAVFGNPINHSKSPFIHTLFARQTQQSMIYTAQCVPVDGFTEAAKHFFAQGGRGCNVTVPFKEEAYRFADRLTERARLAGAVNTLKKLDDGEILGDNTDGEGLVQDLLAQ-QVLLKGATILLIGAGGAARGVLKPLLDQQPASITVTNRTFAKAEQLAELVAAYGEVKAQAFEQL-KQSYDVIINSTSASLDGELPAIDPVIFSSRSVCYDMMYGKGYTVFNQWARQHGCAQAIDGLGMLVGQAAESFMLWRGLRPGTKQILRELRKNL 274
4 -96.500IDP04636 gene: aroE1; shikimate 5-dehydrogenase [Francisella tularensis subsp. tularensis SCHU S4] FTT0238 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  35  3.DLYHVIGFPVKHSLSPAIQMRLAQQYNQDMLFTAIEVAPQDLEAKIQEFKTPQVKGLSVTVPHKERVYALADDADTTAKAVQAASNVIFTAERKMIALNYDGLGIVNDIKNNYKIDFAGKKVLVVGAGGAAKAVVAAVLKESPLSLSITNRTLAKAKAIEELFKVDTKIKIIDFDNI-SDSFDIVINSTSSSIDGKLLPLKDSNFNKNAFAYDLMYADGGTIFTKWCQAHNIA-AADGKGMLKELSIAVFKYWRGL............... 257
5 -93.700IDP91168 similar to shikimate 5-dehydrogenase (AroD) lmo1490 [Listeria monocytogenes]  ali follow..  30  1MEKYVVIGNPIRHSLSPAMQNRIFQELGMNAEYNSVLIEEDAFETEIKKLMDSGVRGFNITTPFKERILPFLDELDNLAAASGAVNTV-LKKEDKWYGFNTDGKGYLEGLEEI-RSITEDDSILITGAGGASKAIYLALSTHTDAKITVANRTTEKAIEMTKDNNNHHAITLEEAEKQ-LADFTIIIQTTSIGLEANKSPISLANVKQGTICSDIIYNPAETAFLKEAKKNGAI-TQNGLPMFVNQGALAFEIWTGIKPERSLMKEAVLEQL 270
6 -89.900IDP90166 gene: aroE; shikimate dehydrogenase [Clostridium difficile 630] CD1837 [Peptoclostridium difficile 630]  ali follow..  23  1MNFFGLVGEKLSHSVSPQIHKRVFEILNIESAYKNFEISKEDISKLDGAIKLLGIQGVNVTVPYKERIMKYLDFISPEAKRIGAVNTIL-LRENMLYGYNTDYFGLDSMFKMA-NIDVQGKVAVILGTGGASKAALTYFIDSGIEKLYVSTRKKDDKKLLNSKAI------LIDYEELKHIKGDIILNATPVGMYPGISPVSKSIIQNFDILIDLIYNPGETEFLRIGNSMGKK-TCDGLYMLVGQAIKSQEIWQDTKIDNSILDVIYNE.. 263
7 -89.900IDP04232 gene: aroE; shikimate 5-dehydrogenase [Clostridium perfringens ATCC 13124] CPF_0693 [Clostridium perfringens ATCC 13124]  ali follow..  29  1MKLFGLIGEKLGHSLSPEIHNKVFKDNNIDGLYNLFSVKKDFENNIVESLKCLGVKGANVTIPYKEKVMDQLDIISHEAKAIGAVNTI-LIKDGKSYGYNTDYYGFGKMLERA-KVNIEGNSFFVLGAGGAARSILKYLEDSKAKKIVLVSRDREKAFKKFKDFNINFMSYG---ELEEINEEFALINTTPCGMYPNSVAVSEKVIKKFKVAVDIVYNPLETKFLKMAKDNGLK-TVDGLFMLVGQGVKAEEIWNGIKVDKSTEEDIYEE.. 266
8 -89.800IDP02833 gene: aroE; shikimate 5-dehydrogenase [Bacillus anthracis str. `Ames Ancestor`] GBAA4561 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  28  3.QLYGVIGNPIGHSLSPVMHNDAFEHLKMDAHYHAFLVKEEVLGEAVRGLKALGISGFNVTTPHKVAIMDYLDEIDPLAKQIGAVNTV-VHKDGKLIGYNTDGIGFVRALQSISSEPLQEKRILLLGAGGASRAIYFSLADAGVKEIDVANRTVDKAKELIAACTATVHSVALSLEKATQGNYDIIIQTTTIGMHPEHTPLQISSLKKGTIVSDIIYNPFETKILCEAKEQGAI-IQNGIDMFVYQGALAFEMWTGCVPNIERMKQLVIRNL 275
9 -88.300IDP91169 similar to shikimate 5-dehydrogenase lmo0490 [Listeria monocytogenes]  ali follow..  21  14.ELIGLIATPIRHSLSPTMHNEAFAKLGLDYVYLAFEVGDKELKDVVQGFRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTV-VNDDGVLTGHITDGTGYMRALKEA-GHDIIGKKMTICGAGGAATAICIQAALDGVKEISIFNRKDDFYANAEKTVEKINDIEDHEQLRKEIAESVIFTNATGVGMKPETLLPSADMLRPELIVSDVVYKPTKTRLLEIAEEQGCQ-TLNGLGMMLWQGAKAFEIWTHKEMPVDYIKEIL.... 290
10 -87.900IDP91166 gene: aroE; shikimate 5-dehydrogenase STM1359 [Salmonella enterica subsp. enterica serovar Typhimurium]  ali follow..  19  8.ELIGLMAYPIRHSLSPEMQNKALEKAGLPYTYMAFEVDNTTFASAIEGLKALKMRGTGVSMPNKQLACEYVDELTPAAKLVGAINTI-VNDDGYLRGYNTDGTGHIRAIKES-GFDMRGKTMVLLGAGGAATAIGAQAAIEGIKEIKLFNRKDDFFEKAVAFAKRVTDLADQHAFTEALASADILTNGTKVGMKPESLIGDVSLLRPELLVTECVYNPHMTKLLQQAQQAGCK-TIDGYGMLLWQGAEQFELWTGKAFPLDYVKQVMGFT. 287
11 -86.500IDP91170 similar to oxidoreductase lmo2236 [Listeria monocytogenes]  ali follow..  23  10.RLLGLIGTPIDHSKSPIMYNYSFQKAGLDYAYLAFDTPIQKVADTIKAIKTFNLRGANVTMPCKSEVLKHMDDLSPAARMIGAVNTI-VNEDGKLTGHITDGLGFIANLRDA-SVDVAGKKMTIIGAGGAATAIQVQCALDGAKEITIFNIFYDKAKQTVASIKQEVDLNDTEKLNAEITTSDILVNATLVGMHPNTPISDTSVFRKELIVADIIYNPKKTQLLLDAEAAGCK-TVGGLGMLLWQGAEAYKLFTGKDMPVSEVKDLYFN.. 289
12 -86.300IDP90864 gene: aroE; shikimate 5-dehydrogenase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0405 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  28  1MKFLAVIGDPISHSKSPRMHNNAIKALGLDSIYTRYHLRNAN--CLREDFFKLGLSGANITLPFKEKALDIADVKDDFARNIGSANTL-CLKEDKIYAYNTDALGFLEAIKDF----DNIKKALILGAGGTALALAYVLKQKGV-EVYIANRSKERFKDFLAYPTY-------LYKNLQDFDFDLVINSTSAGLKDENRELLDRILPKAKFAFEVIYGR-ETPFYRLCKEYHLK-IKDGLDMLLWQGVFAFELFFEIQDKREMIKNAMQQAL 259
13 -83.900IDP90926 gene: aroE; shikimate 5-dehydrogenase [Salmonella typhimurium LT2] STM3859 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  17  12..CMSLAARP--SNFGTRFHNYLYEALDLNYLYKAFSP--TDLTQAISGVRGLGIRGCAISMPFKEACIPLVDELDASAQAIHSVNTI-VNTNGHLKAYNTDYIAIARLLANYK--VSPDLVFALRGSGGMAKAVACALKDAGFTRGYIVAIDEASGKQLAELYGYEWR------PDTDGIEADLLINATPIGMAGDKLSYSEQEVDKASVIFDVVALPPVTPLIRYARERGKT-VITGSEVFAIQAVEQFVLYTGIRPDDALFQKAAAWS. 270
14 -83.200IDP90721 gene: aroE; shikimate 5-dehydrogenase [Yersinia pestis CO92] YPO1610 [Yersinia pestis CO92]  ali follow..  18  31.VCISLAARP--SNFGTRFHNFLYDALDLDYLYKAFTT--NDLAAAIGGVRALGFRGCAISMPFKEAVIPMVDEMDPSAKAINSVNTL-VNTGGYLKAYNTDYIAIAKLLQEYQ--VPVDNVFALRGSGGMAKAVAFALKNAGFKQGYIIATNEKTGKQLAEQSG------YIYRPDMQNIQADMLINATPVGMAGGALAFTETEVDRAKIVFDVVALPAVTPLIRYAQTQGKT-VITGAEVFAIQAVEQFVLYTGIRPSQALFEQAAAYAR 291
15 -79.200IDP91204 shikimate 5-dehydrogenase [Bacteroides thetaiotaomicron VPI-5482] BT_4215 [Bacteroides thetaiotaomicron VPI-5482]  ali follow..  23  1MEKYGLIGYPLRHSFSIGYFNEKFRSEGINAEYVNFEI--PNINDFMEVIEEPNLCGLNVTIPYKEQVIPFLNELDRDTAKIGAVNVIKIKGKVKLVGYNSDIIGFTQSIQP--LLQPQHKKALILGTGGASKAVYHGLKNLGI-ESVFVSRTHKTDDMLTYE----------ELTPEIMEEYTVIVNCTPVGMYPKVPNIPYELLTPNHLLYDLLYNPNVTLFMKKGEAQGAV-TKNGLEMLLLQAFAAWEIWH................. 247
16 -77.000IDP91203 gene: aroE; Shikimate 5-dehydrogenase [Bifidobacterium longum DJO10A] BLD_0429 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]  ali follow..  19  4.HRCAVLGKPVAHSLSPVLHNAAYRSLKLDWLYDKHEVGEDDLDAFLKGLDS-TWAGLSLTMPLKKTIQPYGVPENLWAKELKVANTAVFNGKPGIKLYNTDVIGIQLAFDHEHHTASRSGTALIIGNGNTATSALAACCMPEIGHIVVAARHPGKNTGLKPVAEKEIELGDDQALLEAARNATYVINTIPGHAADNDALANAGTEPFSGLLLDVIYDPRPTKLMEAWRAHGGH-AIGGEEMLLYQALVQVLLMTGIWDPSDADQRLQDTTT 306
17 -71.000IDP91171 RecName: Full=Shikimate biosynthesis protein AroDE; Includes: RecName: Full=3-dehydroquinate dehydratase; Short=3-dehydroquinase; AltName: Full=Type I DHQase; Includes: RecName: Full=Shikimate dehydrogenase CT_370 [Chlamydia trachomatis]  ali follow..  23  215.PICALIG-DTSRSIGHLTHNPFFSQLGVACPYIKLPLTPQELPKFFSTIRTQPFLGVSVTSPLKTAVLPFLDKQAPSVKASGSCNTL-VIRQGEIEGHDTDGEGLFSVLMQH-QIPLNNQRVAIIGAGGAAQSIATRLSRANC-ELLIFNRTKAHAEDLASRCQ----AKAFSLEELPLHRVSLIINCLPPSCTIPK--------AVAPCVVDINTIPKHSTFTQYARSQGSS-IIYGHEMFTQQALLQFRLWFPTLSFKHLEKTFIRRAA 468
18 -40.400IDP92648 RecName: Full=Pentafunctional AROM polypeptide; Includes: RecName: Full=3-dehydroquinate synthase; Short=DHQS; Includes: RecName: Full=3-phosphoshikimate 1-carboxyvinyltransferase; AltName: Full=5-enolpyruvylshikimate-3-phosphate synthase; Short=EPSP synthase; Short=EPSPS; Includes: RecName: Full=Shikimate kinase; Short=SK; Includes: RecName: Full=3-dehydroquinate dehydratase; Short=3-dehydroquinase; Includes: RecName: Full=Shikimate dehydrogenase AFUB_013230 [Aspergillus fumigatus A1163]  ali follow..  22 1290.KRFALFGSPISESRSPALHNTLFAEMGLPHEYTRLET--ANVEDVKDFIRAPDFGGASVTIPLKLDIMPLLDEITAEAEIIGAVNTVVPVSDGRLVGHNTDWQGMVQCLRNAAYGADGSASALVVGGGGTSRAAIYALHQMGFSPIYIVGRNPAKLESMVSTFPTSYNIQIVEGNEKLEHVPHVAIGTIPADRPIDDADASRTIEGSPRVLLEMAYKPRVTALMQLAVDAG--TTIPGLEALIGQGVHQVGLWTGIRPLYERARVCCDILL 1596
19 -14.600IDP02777 gene: hemA; glutamyl-tRNA reductase [Bacillus anthracis str. `Ames Ancestor`] GBAA4698 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  14  63............HTGRYYIKKFLADWFQLEIEEVAPYLTIFEQDGAIDHLFRVT-CGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFAHSETTIGESAMSVSYAAVELGKKIFGELTDCHVLILGAGKMGELALQNLYGSGARKVTVMNRTLSKAEIMAEKYM--GHAKPLSELQCALLEADILISSTGAS-KEMMTKVEKMRSGRPLFMVDILYDIDDLQGVVEANRAERLKEAEKIQFMIEEEIVLFKTWLSTLGVVPLISAL..... 348
20 -14.100IDP91454 gene: hemA; glutamyl-tRNA reductase [Vibrio vulnificus CMCP6] VV1_0254 [Vibrio vulnificus CMCP6]  ali follow..  15  59..........VKSGARSKVIDWLSQFHQIGLEELKPSLYVYEEQAAIRHLMRVS-CGLDSLVLGEPQILGQVKQAYSDSREQQAVDASLVRTETDIGGNAVSVAYAACTLAKHIFESLEKSTVLLVGAGETIELVAKHLHANGCSKMIVANRTRERALTLAEQFD--AQVISLQEIPNHLAKADIVISSTASP-KGMVETALKQRRHQPMLLVDILYTVDDLQSIIDSNIEQRKVEAIQAEAIVAEESAAFMSWLRSLQAVDSIREY..... 346
21 -14.100IDP90674 gene: hemA; glutamyl-tRNA reductase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0542 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  14  59..........VKMACAEFIVKSLALLCDVDKDILLEKADIFEDSGAIHHLFSVA-SSLDSLVVGETQIAGQLKDAFAFAVKNNFCGVHLSRRNETQISKNSISVASVAVAKAKELADLTQKKAVVIGAGEMGELAAKHLIAAGA-KVIILNRDLQKAKDLCERLGVLSEYDSLENLKKYLNQYEFFFSATNA----PNAIITNSLIEEKRYFFDIVFAVDDLEIVVQKNLALREQEARMAYGIIGRETSEFFRYLNDLALMPIIKAI..... 339
22 -14.100IDP02291 gene: hemA; glutamyl-tRNA reductase [Francisella tularensis subsp. tularensis SCHU S4] FTT0167 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  14  106.......................................................CGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELVRSETRIGHCPVSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSAFRNASAHYLSELPQL-IKKADIIIAAVNV---LEYIVTCKYVGDKPRVFIDIYYCVDDINAVIEDNKDKRKYESSKAQKIIVKSLEEYLEKEKAIISNSAIKEL..... 343
23 -14.000IDP04169 gene: hemA; glutamyl-tRNA reductase [Vibrio cholerae O1 biovar eltor str. N16961] VC2180 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  59..........VRSASKNKVIEWLSQFHQVSLDELKPSLYVHEEQAAIRHLMRVA-CGLDSLVLGEPQILGQVKQAYAEARENHAVNPATVRTETEIGGSAVSVAYAACTLAKHIFESLADATVLLVGAGETIELVAKHLAGHHCKRMIVANRTRERALSLAQQFG--ADVIALNEIPDYLAQADIVISSTASP-KGMVESALKARRHQPMLLVDILYSVDDLQSIVDSNIEQRKVEAIQAEAIVSEESATFMSWMRSLQAVDSIRDY..... 346
24 -14.000IDP90936 gene: hemA; glutamyl-tRNA reductase [Yersinia pestis CO92] YPO2016 [Yersinia pestis CO92]  ali follow..  15  63............ENLHEQLTAWLCNYHKLSPDDVRQSLYWHHGNDAVRHLMRVA-SGLDSQVLGEPQILGQVKKAFAESQRGQSLSSELVRTETEIGASAVSVAFAACSLARQIFESLSELHVLLVGAGETIELVARHLREHQVKHMIIANRTRERAQSLASEVG--AEVITLPEIDARLADADIIISSTASP-KGMVERALKTRRNQPMLFIDILYSVDDLQAIIQHNMAQRQAAAVQAESIVQQESMNFMTWLRAQGAVETIRDY..... 348
25 -13.800IDP02522 gene: hemA; glutamyl-tRNA reductase [Coxiella burnetii RSA 493] CBU_1966 [Coxiella burnetii RSA 493]  ali follow..  16  101.......................................................SGLDSMVLGEPQILGQMKQAYLLARRIGAVGSELIRSETAIGANPVSIAYAVVQLAKRIFSHLNQCQILLIGAGETIELVFSHLYNQGARHFFIANRTLTRAKQIAEPYH--AQAIRLSDIPTYLPKVDIVISATMSQ-KGAVESALRQRKRRPLFMADLLYNIDDLQTLIAQNRQTREAAAKQAEAMVEMQAIHYMRQLQVHKAGDTIRRF..... 344
26 -9.500IDP01849 gene: folD; methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase putative bifunctional protein [Francisella tularensis subsp. tularensis SCHU S4] FTT0892 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  10  38.....IVGNDPASKTYVASKEKACAQVGIDSQVITLHTTESELLELIDQLNNSSVHAILVQLPLPAHINK--NNVIYSIKPEKDVDGFHPTNVGRLQLRDKKCL--IMTMLREYGIKTEGAYAVVVGASNVVGKPVSQLLLNAKATVTTCHRFTTDLKSHTT-------------------KADILIVAV-----GKPNFITADMVKEGAVVIDVGINHVDGKIVGDVDFAAVKDKVAGVGELLYNTFQCAQ.................... 278

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.