current user: public

If you have questions about the server, please let us know.

Query: IDP02444 hypothetical protein YPO2224 [Yersinia pestis CO92] YPO2224 [Yersinia pestis CO92], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MKYLLIFLLVLVVFVISVTLGANNDQLVAFNYLLAQGEYQLSTLLATLFAAGLVLGWVICGLFYLRVRISLGRAERKIKRIETQLEQPVEQSTLVSTAAVNKELast
1 -85.800IDP02444 hypothetical protein YPO2224 [Yersinia pestis CO92] YPO2224 [Yersinia pestis CO92]  ali  100  1MKYLLIFLLVLVVFVISVTLGANNDQLVAFNYLLAQGEYQLSTLLATLFAAGLVLGWVICGLFYLRVRISLGRAERKIKRIETQLEQPVEQSTLVSTAAVNKE 103
2 -8.900IDP00560 gene: hemY; putative protoheme IX biogenesis protein YPO3852 [Yersinia pestis CO92]  ali follow..  25  1MLRVLLLFLVLTVGIVLGPMLAGHQGYVLINYNVTTSVTGLAIMLVLLLVAFFIVEWVLRRIFRTGARTRGWFLGRKRTRARNQMKA................ 90
3 -7.860IDP91936 hypothetical protein SpneCM_03100 [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100003100 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  11  1MKKTFFLLVLGLFCLLPLSVFAIDFKINSYQGIHADNTAEFRQKIVYQFEEDF.................................................. 56
4 -7.130IDP05580 putative lipoprotein [Bacillus anthracis str. Ames] BA_0936 [Bacillus anthracis str. Ames]  ali follow..  26  2LKKLGILVLGSAVALSLVACGDSTKE............................................................................. 27
5 -6.860IDP05267 hypothetical protein lmo0255 [Listeria monocytogenes EGD-e] lmo0255 [Listeria monocytogenes EGD-e]  ali follow..  26  1MKKFLSILSILVLALLVTACGSDSSD............................................................................. 26
6 -6.800IDP05313 putative lipoprotein [Bacillus anthracis str. Ames] BA_1061 [Bacillus anthracis str. Ames]  ali follow..  14  1MRKLLTVIGITFLILAGCSNGDFEKEIDAGKTALTNKEYKNA-------------------LSSFERALDEKKDDSGAIVLVEQTKIMMEAVKLKEEKKIEE. 83
7 -6.640IDP01854 gene: pagC; virulence membrane protein PAGC precursor [Salmonella typhimurium LT2] STM1246 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  18  1MKNIILSTLVITTSVLVVNVAQADTNAFSVGYAQSKVQ................................................................. 38
8 -6.520IDP05365 hypothetical protein BA_2909 [Bacillus anthracis str. Ames] BA_2909 [Bacillus anthracis str. Ames]  ali follow..  15  1MKYMHRNGVVMLTIFLCITACSSGERIKEISDM...................................................................... 33
9 -6.340IDP04392 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1500 [Clostridium perfringens ATCC 13124]  ali follow..  17  1MRVLKGVILAIIPAFL--FMGCGEFSKNDVAKVLSEKEEQILNLTD......................................................... 48
10 -6.340IDP05442 putative lipoprotein [Bacillus anthracis str. Ames] BA_0171 [Bacillus anthracis str. Ames]  ali follow..  23  1MSKKLLSLFSAVIVAAFVITGCGQSD............................................................................. 26

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.