current user: public

If you have questions about the server, please let us know.

Query: IDP04061 gene: YPCD1.07; hypothetical protein YPCD1.07 [Yersinia pestis CO92] YPCD1.07 [Yersinia pestis CO92], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst MDKNKGIVFPPFSINIANIFVPDLSGANRFLACSLLEFLTYLSSVLLLMLWKILNIYIYGLMQHSRNQNIIAKRYIVYTVLFILKTANIRANPVTLSPLast
1 -97.200IDP04061 gene: YPCD1.07; hypothetical protein YPCD1.07 [Yersinia pestis CO92] YPCD1.07 [Yersinia pestis CO92]  ali  100  1MDKNKGIVFPPFSINIANIFVPDLSGANRFLACSLLEFLTYLSSVLLLMLWKILNIYIYGLMQHSRNQNIIAKRYIVYTVLFILKTANIRANPVTLSP 98
2 -5.850IDP02444 hypothetical protein YPO2224 [Yersinia pestis CO92] YPO2224 [Yersinia pestis CO92]  ali follow..  20  4..............................................LLIFLLVLVVFVISVTLGANNDQLVAFNYLLAQGEYQLST............ 43
3 -5.400IDP06445 gene: H3L; H3L [Monkeypox virus Zaire-96-I-16] NP_536520 [Monkeypox virus Zaire-96-I-16]  ali follow..  18  282.......FFGLFDINVIGLIV-----------------ILFIMFMLIFLLWFLTGTFVTAFI.................................... 324
4 -5.040IDP00603 gene: sarX; staphylococcal accessory protein X SACOL0726 [Staphylococcus aureus subsp. aureus COL]  ali follow..  1.........................................MAEKFKIIMTEALSLYIWGILNTEKLETLLGFYKQYKALSEYIDKKY.......... 49
5 -4.910IDP05521 putative cell surface protein [Clostridium difficile 630] CD1858 [Peptoclostridium difficile 630]  ali follow..  13  9.........................................AAGVILGAVLLIVGVVISLFAG---SKIVFAQGGLFTTLVNPIEAVAQIKVEVEVN. 61
6 -4.640IDP91584 hypothetical protein CBU_0425 [Coxiella burnetii RSA 493]  ali follow..  20  288.NKEPEIVIQTIKGWIEGLYYNDSTSSDKEAAIRVKVFLTHFLMIRILPLLNKDLVELFQPLFYGNHSHLGGKDY-YYKLLEKHTTQNTELSKVLQS. 382
7 -4.530IDP01057 gene: tuf; elongation factor Tu STM3445 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  56.EKARGITHVEYDTPTRHYAHVDCPGHADYVK-NMITGAAQMDGAILVV----------GPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLE. 148
8 -4.530IDP01035 gene: tuf; elongation factor Tu STM4146 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  56.EKARGITHVEYDTPTRHYAHVDCPGHADYVK-NMITGAAQMDGAILVV----------GPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLE. 148
9 -4.500IDP06393 gene: ORF20; ORF20 [Human herpesvirus 8] YP_001129373 [Human herpesvirus 8]  ali follow..  17  64...........FEVTLGH--IADLVSGGHQPVCYVVELKTCLSHQLIPTNTVRTSQRAQGLCQLSDSIHYITEAWTITPLLIFKNQKTLKTVYSE... 156
10 -4.490IDP01747 gene: ypeC; putative periplasmic protein [Salmonella typhimurium LT2] STM2407 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  21  1......................................................................MFRSLILAAALLAFTPLAANAGEITLLP 28

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.